RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780460|ref|YP_003064873.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >gnl|CDD|48032 cd01287, FabA, FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site. The FabA structure is a homodimer with two independent active sites located at the dimer interface. Each active site is tunnel-shaped and completely inaccessible to solvent. No metal ions or cofactors are required for ligand binding or catalysis.. Length = 150 Score = 165 bits (420), Expect = 4e-42 Identities = 61/147 (41%), Positives = 81/147 (55%), Gaps = 8/147 (5%) Query: 27 AQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDA 86 +LP +LM R+T+I GG + G +RAE DI P+ WFF CHF DPVMPG LGL+A Sbjct: 1 PRLPGGQLLMLDRVTEIDPGGGTFGLGYLRAEKDIDPDDWFFPCHFHGDPVMPGSLGLEA 60 Query: 87 LWQLTGFFLGWLGE-------LGKGRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILR-GR 138 + QL F+L WLG +G K+RG +TP K V Y + K++ R G Sbjct: 61 MIQLLQFYLIWLGLGTGVDNPRFQGAPGGPGEWKYRGQITPHNKKVTYEVHIKEVGRDGP 120 Query: 139 VVLGAADGWVKVNGKEIYQANDLRVCL 165 AD + V+G IY+A D+ V L Sbjct: 121 RPYIIADASLWVDGLRIYEAKDIAVRL 147 >gnl|CDD|31107 COG0764, FabA, 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism]. Length = 147 Score = 136 bits (343), Expect = 3e-33 Identities = 48/158 (30%), Positives = 73/158 (46%), Gaps = 13/158 (8%) Query: 13 ILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHF 72 +L GE+ + P L+ R+ +I E G + A ++T N FF HF Sbjct: 1 LLAIDIGEILELLPHRYP---FLLVDRVLEIDEEGK-----RIVAIKNVTINEPFFTGHF 52 Query: 73 KNDPVMPGCLGLDALWQLTGFFLGWLGELGK--GRAVSVSNIKFRGMVTPDCKLVEYGID 130 DP+MPG L L+A+ Q GF LGWL G + + N KF+ V P + ++ Sbjct: 53 PGDPIMPGVLILEAMAQAAGFLLGWLLGNKGKLGYFLGIDNAKFKRPVLPG---DQLELE 109 Query: 131 FKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCLTID 168 K + R+ +G A G V+GK + +A L + D Sbjct: 110 VKLLKSRRLGIGKAKGVATVDGKVVAEAELLFAGVEKD 147 >gnl|CDD|48029 cd00493, FabA_FabZ, FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation. The third step of the elongation cycle, the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, is catalyzed by FabA or FabZ. FabA is bifunctional and catalyzes an additional isomerization reaction of trans-2-acyl-ACP to cis-3-acyl-ACP, an essential reaction to unsaturated fatty acid synthesis. FabZ is the primary dehydratase that participates in the elongation cycles of saturated as well as unsaturated fatty acid biosynthesis, whereas FabA is more active in the dehydration of beta-hydroxydecanoyl-ACP. The FabA structure is homodimeric with two independent active sites located at the dimer interface.. Length = 131 Score = 101 bits (252), Expect = 1e-22 Identities = 47/135 (34%), Positives = 64/135 (47%), Gaps = 15/135 (11%) Query: 29 LPKPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALW 88 + PML+ R+ +I G + AE ++TPN FF HF DPVMPG LG++A+ Sbjct: 1 PHRYPMLLVDRVLEIDPGGR------IVAEKNVTPNEPFFQGHFPGDPVMPGVLGIEAMA 54 Query: 89 QLTGFFLGWLGELGK-----GRAVSVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGA 143 Q G LG G V +KFRG V P L ++L+ R LG Sbjct: 55 QAAAALAGLLGLGKGNPPRLGYLAGVRKVKFRGPVLPGDTLTLEV----ELLKVRRGLGK 110 Query: 144 ADGWVKVNGKEIYQA 158 DG V+GK + +A Sbjct: 111 FDGRAYVDGKLVAEA 125 >gnl|CDD|48033 cd01288, FabZ, FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway.. Length = 131 Score = 65.6 bits (160), Expect = 7e-12 Identities = 38/134 (28%), Positives = 64/134 (47%), Gaps = 14/134 (10%) Query: 29 LP-KPPMLMFHRITQISETGGNYNQGVVRAEMDITPNLWFFDCHFKNDPVMPGCLGLDAL 87 LP + P L+ R+ ++ + +V A ++T N FF HF +P+MPG L ++AL Sbjct: 1 LPHRYPFLLVDRVLELEP-----GKSIV-AIKNVTINEPFFQGHFPGNPIMPGVLIIEAL 54 Query: 88 WQLTGFFLGWLGELGKGRAV---SVSNIKFRGMVTPDCKLVEYGIDFKKILRGRVVLGAA 144 Q G E +G+ V + +FR V P +L+ ++L+ R +G Sbjct: 55 AQAAGILGLKSLEDFEGKLVYFAGIDKARFRKPVVPGDQLILEV----ELLKLRRGIGKF 110 Query: 145 DGWVKVNGKEIYQA 158 G V+GK + +A Sbjct: 111 KGKAYVDGKLVAEA 124 >gnl|CDD|48035 cd03440, hot_dog, The hotdog fold was initially identified in the E. coli FabA (beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase) structure and subsequently in 4HBT (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A number of other seemingly unrelated proteins also share the hotdog fold. These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism, and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate. This superfamily also includes the PaaI-like protein FapR, a non-catalytic bacterial homolog involved in transcriptional regulation of fatty acid biosynthesis.. Length = 100 Score = 30.9 bits (69), Expect = 0.21 Identities = 14/71 (19%), Positives = 22/71 (30%), Gaps = 6/71 (8%) Query: 55 VRAEMDITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKF 114 + +TP ++ G L L + G LG G G +++F Sbjct: 1 FVLRLTVTPEDIDGG------GIVHGGLLLALADEAAGAAAARLGGRGLGAVTLSLDVRF 54 Query: 115 RGMVTPDCKLV 125 V P L Sbjct: 55 LRPVRPGDTLT 65 >gnl|CDD|36436 KOG1222, KOG1222, KOG1222, Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport]. Length = 791 Score = 27.7 bits (61), Expect = 1.5 Identities = 10/48 (20%), Positives = 16/48 (33%), Gaps = 6/48 (12%) Query: 50 YNQGVVRAEMDITPNLWFFDCHFKNDPVM-----PGCLGLDALWQLTG 92 N + + + H N+P M P LD L+ +T Sbjct: 722 DNNDPLFNDNADNDS-NSNSNHSNNNPAMSTYSRPLSQDLDDLYNMTS 768 >gnl|CDD|113504 pfam04736, Eclosion, Eclosion hormone. Eclosion hormone is an insect neuropeptide that triggers the performance of ecdysis behaviour, which causes shedding of the old cuticle at the end of a molt. Length = 62 Score = 26.2 bits (58), Expect = 5.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 98 LGELGKGRAVSVSNIKFRGMVTPDCK 123 LG +G+ + + I+F+G + PDC+ Sbjct: 25 LGAFFEGQLCAEACIQFKGKLIPDCE 50 >gnl|CDD|31807 COG1620, LldP, L-lactate permease [Energy production and conversion]. Length = 522 Score = 25.5 bits (56), Expect = 6.7 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 83 GLDALWQLTGFFLGWLGELGKGRAVSVSNIKF 114 + L FLGW+G G + + SN+ F Sbjct: 410 HTGEAFPLFSPFLGWIGVFLTG-SNTSSNLLF 440 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.143 0.457 Gapped Lambda K H 0.267 0.0683 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,232,419 Number of extensions: 113924 Number of successful extensions: 171 Number of sequences better than 10.0: 1 Number of HSP's gapped: 164 Number of HSP's successfully gapped: 10 Length of query: 172 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 85 Effective length of database: 4,383,754 Effective search space: 372619090 Effective search space used: 372619090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.7 bits)