HHsearch alignment for GI: 254780461 and conserved domain: COG3424

>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism].
Probab=97.47  E-value=0.00047  Score=44.36  Aligned_cols=198  Identities=18%  Similarity=0.193  Sum_probs=109.5

Q ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCC-CCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             89997249999999999999753410133222233332056325676-30145677888751252212320012233235
Q gi|254780461|r   62 RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPS-TKCIVSAADLTREHCSTRRIGPFAVPKAMSST  140 (406)
Q Consensus        62 ~~~~r~~d~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~-~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~  140 (406)
T Consensus        67 ekN~ifie~a~~l~v~a~r~aL~~~~l~pedId~----vv~vtsTG~~~Ps~da--ri~~~-Lg---l~p~~--------  128 (356)
T COG3424          67 EKNEIFIEEAVPLGVDALRRALDGSPLRPEDIDA----VVTVTSTGLATPSLDA--RIVGE-LG---LSPDT--------  128 (356)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHCCE----EEEEEECCCCCCCHHH--HHHHH-CC---CCCCC--------
T ss_conf             6303499987999999999885269999778867----9999502554787549--98861-39---99764--------


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             67787763122333333333344443343210011345605578873134566753222222122334678662232223
Q gi|254780461|r  141 ASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRP  220 (406)
Q Consensus       141 ~a~~is~~~gl~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f~~~~~ls~~~~~~p~~~~rP  220 (406)
T Consensus       129 --~Rvp----------v~glGCaaga~glara~~y~ra~P~~~vlvV~vELCS-Lt~~~~d-----------~t~-----  179 (356)
T COG3424         129 --RRVP----------VWGLGCAAGAAGLARARDYCRAAPDANVLVVCVELCS-LTYVFAD-----------DTK-----  179 (356)
T ss_pred             --CEEE----------EECCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEE-EEEECCC-----------CCC-----
T ss_conf             --0522----------0032014211578999999750866508999946321-5543478-----------875-----


Q ss_pred             CCCCCCC-EEECCCEEEEECCCHHHHC---CCCCCCCC----------EEEEEEEECCCCCC-CCCCHHHHHH-----HH
Q ss_conf             5666664-1312651443112213201---10011232----------01221010265212-3443357789-----88
Q gi|254780461|r  221 YDSRRDG-FVISGGAAVIVLEEMERAK---ARGAKIYA----------ELTGYGSTCDGDDM-VSPSGEGAIR-----CM  280 (406)
Q Consensus       221 Fd~~~~G-~~~gEGa~~~vLe~~~~A~---~rGa~i~a----------~i~g~~~~~d~~~~-~~p~~~g~~~-----~i  280 (406)
T Consensus       180 --s~lVgtaLF~DG~AA~vv~gd~~~~~~~~~~p~i~~s~StL~~dse~~Mgwdv~d~G~~~vlSrdlp~lIe~~l~~~V  257 (356)
T COG3424         180 --SNLVGTALFGDGAAAVVVSGDRRAEGKRPLRPDILDSFSTLYPDSEDIMGWDVGDQGLKVVLSRDLPNLIESYLAPNV  257 (356)
T ss_pred             --CCCEEEEEECCCEEEEEEECCCCCCCCCCCCCEECCCCCCCCCCCCCCCCEEECCCCEEEEECCCHHHHHHHHHHHHH
T ss_conf             --451333300487058998346433466789750004545468862100115304884799975732689999852558


Q ss_pred             H---HHHHHHHCCCCEEEECCCCCCCCCCCH
Q ss_conf             7---542100100210221024555444200
Q gi|254780461|r  281 R---QALSSVEEPVDYINTHGTATPKGDKKE  308 (406)
Q Consensus       281 ~---~Al~~a~~~i~~i~~hgtgt~~~D~~E  308 (406)
T Consensus       258 ~~fL~~~~ls~~dI~~w~~HPGG~KVida~~  288 (356)
T COG3424         258 TTFLATHGLSIEDIEAWVVHPGGPKVIDAYE  288 (356)
T ss_pred             HHHHHHCCCCHHHHCEEEECCCCCHHHHHHH
T ss_conf             9999976876654111555799706999998