HHsearch alignment for GI: 254780461 and conserved domain: PRK06065

>PRK06065 acetyl-CoA acetyltransferase; Provisional.
Probab=99.81  E-value=3.9e-18  Score=132.23  Aligned_cols=273  Identities=18%  Similarity=0.157  Sum_probs=174.4

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999975341013322223333205632567630145677888751252212320012233235677877631223
Q gi|254780461|r   73 TWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIR  152 (406)
Q Consensus        73 ~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~gl~  152 (406)
T Consensus        32 eL~~eA~~~Al~DAGl~~~dID----~~~~g~~~~~~~-------------g~-------------~~~~~~~~~~~g~~   81 (393)
T PRK06065         32 ELAWEAARQALDEAGLELKDID----CVVIGSAPDAFD-------------GV-------------HMKGEYLAHGSGGI   81 (393)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCC----EEEEECCCCCCC-------------CC-------------CCHHHHHHHHCCCC
T ss_conf             9999999999998499989989----999955676545-------------43-------------20368999754777


Q ss_pred             -CCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCC---CCCCC--------CC--------CCCC-CCCC-
Q ss_conf             -3333333334444334321001134560557887313456675---32222--------22--------1223-3467-
Q gi|254780461|r  153 -GTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWT---MSNLF--------DA--------MGAM-SSHF-  210 (406)
Q Consensus       153 -Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~---~~~~f--------~~--------~~~l-s~~~-  210 (406)
T Consensus        82 ~~p~~~v~~~~asg~~a~~~A~~~I~sG~~d~vlvvg~ek~~~~~~~~~~~~~~~~d~~~~~~~g~~~~~~~Al~a~rym  161 (393)
T PRK06065         82 RKPVSRVFVGGATGVMVPIAGWYHVASGLCKKVLAVAEEKMSPARPHPQSVFRYIWDPILEKPLNPNLIWIFAMEMHRYM  161 (393)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCHHHHHHHCCHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             88447874452788999999999986787768999874046888766314666303501136678867999999999999


Q ss_pred             ---------------------CCCCCC----------------CCCCCCCCCCCEEECCCEEEEECCCHHHHCCCCCCCC
Q ss_conf             ---------------------866223----------------2223566666413126514431122132011001123
Q gi|254780461|r  211 ---------------------NHDPCS----------------ASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIY  253 (406)
Q Consensus       211 ---------------------~~~p~~----------------~~rPFd~~~~G~~~gEGa~~~vLe~~~~A~~rGa~i~  253 (406)
T Consensus       162 ~~yG~t~E~lA~Vav~~r~~A~~NP~A~~r~~~t~edvl~S~~Ia~PL~-l~Dc~~~sDGAaAvVl~s~e~A~~l~~~p-  239 (393)
T PRK06065        162 HVCGVKKEDIALVSVKNKRNALNNPYAQLAANITVEDVLNSEVLVWPVQ-LLDVSPVSDGAAAMVLASEDVARRYTDTP-  239 (393)
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHCCHHHCCCCCCHHHHCCCCCCHHCCC-HHHCCCCCCCEEEEEEECHHHHHHCCCCC-
T ss_conf             9849999999999999999874492966479999688604741221324-25318878821899994489997568997-


Q ss_pred             CEEEEEEEECCCCCCCCCC---HHHHHHHHHHHHHHH---H--CCCCEEEECCCCCCCCCCCHHHHHHCC----------
Q ss_conf             2012210102652123443---357789887542100---1--002102210245554442001222202----------
Q gi|254780461|r  254 AELTGYGSTCDGDDMVSPS---GEGAIRCMRQALSSV---E--EPVDYINTHGTATPKGDKKEVEAIREV----------  315 (406)
Q Consensus       254 a~i~g~~~~~d~~~~~~p~---~~g~~~~i~~Al~~a---~--~~i~~i~~hgtgt~~~D~~E~~ai~~~----------  315 (406)
T Consensus       240 v~I~g~g~~~~~~~~~~~d~~~~~~~~~aa~~Ay~~AGi~~p~~DiDv~evyD~Ft~----~el~~lE~lGfc~~Ge~~~  315 (393)
T PRK06065        240 VWVEGVGWTLDNTEWTNRDLAYPRYVEFAARMAYKMAGIERPRKEIDVAEPYDPFDY----KELHHIEGLMLAKRGEAPK  315 (393)
T ss_pred             EEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHCCCEEEEECCCCH----HHHHHHHHCCCCCCCCHHH
T ss_conf             899999974367664545533217999999999997699997200737985067508----8999999849998983799


Q ss_pred             --------CCCCCCCCCCCCCHH--HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             --------355443364752101--3235899999999999998718407868888897667888737998855883589
Q gi|254780461|r  316 --------FKGNIPYIQSTKSLT--GHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTV  385 (406)
Q Consensus       316 --------f~~~~~~v~s~K~~~--GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~~~~l~~v~~~~~~~~~~~a  385 (406)
T Consensus       316 ~v~~G~~~~~G~-lPvNtsGGlls~Ghp~gatG~~~~~Ea~~QLrG~A--------------g------~rQV~~~~~~g  374 (393)
T PRK06065        316 LLKEGVFDRDGD-IPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTA--------------G------KMQVKKPVHTG  374 (393)
T ss_pred             HHHCCCCCCCCC-CCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHCCCC--------------C------CCCCCCCCCEE
T ss_conf             997799567997-13538971002888561569999999999965776--------------7------77479987789


Q ss_pred             EEECCC-CCCEEEEEEEE
Q ss_conf             993556-77736799999
Q gi|254780461|r  386 LSNSFG-FGGTNATLVFR  402 (406)
Q Consensus       386 l~~s~G-fGG~n~~~vl~  402 (406)
T Consensus       375 l~~~~Gg~~~~~~v~il~  392 (393)
T PRK06065        375 VAQAWGDLMQAGTVIVMR  392 (393)
T ss_pred             EECCCCCCHHCEEEEEEC
T ss_conf             981667500345999955