HHsearch alignment for GI: 254780461 and conserved domain: PRK06365

>PRK06365 acetyl-CoA acetyltransferase; Provisional.
Probab=99.83  E-value=8.7e-19  Score=136.32  Aligned_cols=279  Identities=21%  Similarity=0.285  Sum_probs=171.2

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999975341013322223333205632567630145677888751252212320012233235677877631223
Q gi|254780461|r   73 TWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIR  152 (406)
Q Consensus        73 ~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~gl~  152 (406)
T Consensus        25 ~l~~eA~~~AL~DAGl~~~dID----g~v~~~-~~~~--~~----------~----------~---~~~g~~~~~~lGl~   74 (415)
T PRK06365         25 LRVKKAFDYAMNDAGLTLADID----GSVASY-FSDH--FQ----------R----------Q---LMAGIMVQDYLGLV   74 (415)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCC----EEEEEE-CCCC--CC----------C----------C---CCHHHHHHHHCCCC
T ss_conf             9999999999997599989969----888984-1786--64----------2----------1---00558999971888


Q ss_pred             C-CCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCC-CC-----------CC-----------CC---CC
Q ss_conf             3-33333333444433432100113456055788731345667532-22-----------22-----------21---22
Q gi|254780461|r  153 G-TSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMS-NL-----------FD-----------AM---GA  205 (406)
Q Consensus       153 G-p~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~-~~-----------f~-----------~~---~~  205 (406)
T Consensus        75 ~~p~~~ve~~casg~~a~~~A~~~I~sG~~d~vlv~G~ek~s~~~~~~~~~~~~~~~d~~~e~p~g~~~~~~~Al~a~ry  154 (415)
T PRK06365         75 PKPSKRIEGGGATGGLAFQAGYEEIASGRMDVVAVYGFETMSHVNTWKGNEFIALASDTNFDYPIGGFYTGYYAMMAVRH  154 (415)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCHHHCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             86425773772899999999999997087878999741145678866653111025665534545554488999999999


Q ss_pred             CC---------------C--CCCCCCCC----------------CCCCCCCCCCCEEECCCEEEEECCCHHHHCCCCCCC
Q ss_conf             33---------------4--67866223----------------222356666641312651443112213201100112
Q gi|254780461|r  206 MS---------------S--HFNHDPCS----------------ASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKI  252 (406)
Q Consensus       206 ls---------------~--~~~~~p~~----------------~~rPFd~~~~G~~~gEGa~~~vLe~~~~A~~rGa~i  252 (406)
T Consensus       155 m~~yG~t~e~lA~Vavk~r~~A~~NP~A~~~~~iTvedvl~s~~Ia~PL~l-ldcc~~sDGAaAvVl~see~Ar~~~~~p  233 (415)
T PRK06365        155 MYEFGTTVEQMAKVSVKNHGNAIHNPYAQSPMKLTVEDVRKAPMVSYPLTR-LDVCAMSDGAAVAILASEDKAFEITDHP  233 (415)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHCCCHHHHCCCCCCHHHHHCCCCCCCCCHH-HCCCCCCCCEEEEEEECHHHHHHCCCCC
T ss_conf             998698899999999998775525937648888998998318844367202-1268888864999994589886557997


Q ss_pred             CCEEEEEEEECCCCCCCC----------------------CC---HHHHHHHHHHHHHHH---H--CCCCEEEECCCCCC
Q ss_conf             320122101026521234----------------------43---357789887542100---1--00210221024555
Q gi|254780461|r  253 YAELTGYGSTCDGDDMVS----------------------PS---GEGAIRCMRQALSSV---E--EPVDYINTHGTATP  302 (406)
Q Consensus       253 ~a~i~g~~~~~d~~~~~~----------------------p~---~~g~~~~i~~Al~~a---~--~~i~~i~~hgtgt~  302 (406)
T Consensus       234 -V~I~g~g~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Aa~~Ay~~AGi~~p~~DiDv~ev~D~Ft~  312 (415)
T PRK06365        234 -VLIKAIGTGTDTMRLADRPFGEVPLLPNENPSDYKNLKYPGVHSFRAGRMAAKEAYERANITDPLNDLDLIELHDAYTS  312 (415)
T ss_pred             -EEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCHH
T ss_conf             -7999999712542003454444544445672011023455410027999999999997499996145877998457629


Q ss_pred             CCCCCHHHHHHCC------------------CCCCCCCCCCCCCH--HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             4442001222202------------------35544336475210--132358999999999999987184078688888
Q gi|254780461|r  303 KGDKKEVEAIREV------------------FKGNIPYIQSTKSL--TGHSLGAAGAQEAIYCLIMMQERFIGESKNIEE  362 (406)
Q Consensus       303 ~~D~~E~~ai~~~------------------f~~~~~~v~s~K~~--~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~  362 (406)
T Consensus       313 ----~el~~lE~lGfc~~Geg~~~v~~G~~~~~G~-lPvN~sGGlls~Ghp~GatG~~q~vE~~~QLrG~-a~~r~----  382 (415)
T PRK06365        313 ----SEIQTYEDLGLCKYGEGGQFIDEGKPELDGK-IPVNPSGGLLAAGHPVGATGIMQAVFMFWQLQHT-IKKHF----  382 (415)
T ss_pred             ----HHHHHHHHCCCCCCCCHHHHHHCCCCCCCCC-CCCCCCCCHHCCCCCCCHHHHHHHHHHHHHHHCC-CCCCC----
T ss_conf             ----9999999849988983899997799668997-1267885233078656513999999999996175-02367----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEECC-CCCCEEEEEEEEE
Q ss_conf             9766788873799885588358999355-6777367999994
Q gi|254780461|r  363 IDPEFKGIPIVRKRIDNAKIDTVLSNSF-GFGGTNATLVFRR  403 (406)
Q Consensus       363 ~~~~~~~l~~v~~~~~~~~~~~al~~s~-GfGG~n~~~vl~~  403 (406)
T Consensus       383 -~~--~-------~~QV~~a~~al~~~~GG~~~~~~v~il~~  414 (415)
T PRK06365        383 -HD--D-------YLQVPNAKRGLIHSHAGTGTYVTVTIMEA  414 (415)
T ss_pred             -CC--C-------CCCCCCCCEEEEECCCCCCCEEEEEEEEC
T ss_conf             -77--5-------45689856898835775540179999934