HHsearch alignment for GI: 254780461 and conserved domain: PRK06633

>PRK06633 acetyl-CoA acetyltransferase; Provisional.
Probab=99.77  E-value=4.2e-18  Score=132.07  Aligned_cols=262  Identities=21%  Similarity=0.320  Sum_probs=171.6

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999975341013322223333205632567630145677888751252212320012233235677877631
Q gi|254780461|r   70 QGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWF  149 (406)
Q Consensus        70 ~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~  149 (406)
T Consensus        26 ~~~~L~a~vi~~~l~r~~i~p~~Id~----Vi~G~v~~~~~g---------------------------~n~AR~aaL~a   74 (392)
T PRK06633         26 PAPMLAAHLIKDILQNSKIDPALVNE----VILGQVITGGSG---------------------------QNPARQTLIHA   74 (392)
T ss_pred             CHHHHHHHHHHHHHHHCCCCHHHCCE----EEEEECCCCCCC---------------------------CCHHHHHHHHC
T ss_conf             88999999999999874999899998----999915756656---------------------------66999999976


Q ss_pred             CC--CCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCC------------------C--------
Q ss_conf             22--3333333333444433432100113456055788731345667532222------------------2--------
Q gi|254780461|r  150 KI--RGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLF------------------D--------  201 (406)
Q Consensus       150 gl--~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f------------------~--------  201 (406)
T Consensus        75 Glp~~vp~~TVnr~C~SGl~Ai~~aa~~I~~G~~dvviaGGvEsmS~~~~~~~~r~~~~~g~~~~~d~~~~~~l~d~~~~  154 (392)
T PRK06633         75 GIPKEVPGYTINKVCGSGLKSVALAANSIMTGDNEIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSG  154 (392)
T ss_pred             CCCCCCCEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99988872688773379999999999999679986777403354554433100256776787644523245776454579


Q ss_pred             -CCCC----CCC--------------------------C-C--------------------CCCC--CC------CCC-C
Q ss_conf             -2122----334--------------------------6-7--------------------8662--23------222-3
Q gi|254780461|r  202 -AMGA----MSS--------------------------H-F--------------------NHDP--CS------ASR-P  220 (406)
Q Consensus       202 -~~~~----ls~--------------------------~-~--------------------~~~p--~~------~~r-P  220 (406)
T Consensus       155 ~~Mg~tAE~~A~~~~isRe~qD~~A~~Sh~rA~~A~~~G~f~~EIvPv~~~~~~~~~~~~~De~iR~~ts~e~La~L~p~  234 (392)
T PRK06633        155 VFMGITAENISKQFNISRQEQDEFALSSHKKAAKAQLAGIFKDEILPIEVTVKKTTSLFDHDETVRPDTSLEILSKLRPA  234 (392)
T ss_pred             CCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHCCCC
T ss_conf             76889999999996989999999999999999999875996120787886114776333345776899998899507887


Q ss_pred             CCCCC-----CCEEECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEEC-CCCCCCCCCHHHHHHHHHHHHHHHH---CCC
Q ss_conf             56666-----64131265144311221320110011232012210102-6521234433577898875421001---002
Q gi|254780461|r  221 YDSRR-----DGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTC-DGDDMVSPSGEGAIRCMRQALSSVE---EPV  291 (406)
Q Consensus       221 Fd~~~-----~G~~~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~-d~~~~~~p~~~g~~~~i~~Al~~a~---~~i  291 (406)
T Consensus       235 f~~~GtvTAgNsS~~~DGAaavll~s~~~a~~~gl~p~ari~~~~~~g~dP~~----m~~~p~~A~~k~L~~agl~~~Di  310 (392)
T PRK06633        235 FDKNGVVTAGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSI----MGTAPVPASQKALSKAGWSVNDL  310 (392)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCHHH----HCCCHHHHHHHHHHHCCCCHHHC
T ss_conf             47899730766785430179999965999997699617999988998758576----35351999999999849983108


Q ss_pred             CEEEECCCCCCCCCCCHHHHHHCC-----CCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             102210245554442001222202-----3554433647521--013235899999999999998718407868888897
Q gi|254780461|r  292 DYINTHGTATPKGDKKEVEAIREV-----FKGNIPYIQSTKS--LTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEID  364 (406)
Q Consensus       292 ~~i~~hgtgt~~~D~~E~~ai~~~-----f~~~~~~v~s~K~--~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~  364 (406)
T Consensus       311 d~~Ein----------EAFA~q~l~~~~~l~~d~~kvN~~GGaiAlGHP~GaTGarl~~~l~~~L~~~------------  368 (392)
T PRK06633        311 EVIEVN----------EAFAAQSIYVNREMKWDMEKVNINGGAIAIGHPIGASGGRVLITLIHNLRRA------------  368 (392)
T ss_pred             CEEEEE----------HHHHHHHHHHHHHHCCCHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHC------------
T ss_conf             678860----------3668889999987099788868985588747881115899999999999871------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEEC
Q ss_conf             6678887379988558835899935567773679999942
Q gi|254780461|r  365 PEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY  404 (406)
Q Consensus       365 ~~~~~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~~~  404 (406)
T Consensus       369 ----------------~~~~Gl~s~C~ggG~G~A~iiE~v  392 (392)
T PRK06633        369 ----------------KAKKGLVTLCIGGGMGMAMCVEAV  392 (392)
T ss_pred             ----------------CCCEEEEEECCCCCHHHEEEEEEC
T ss_conf             ----------------999899996231043036999819