HHsearch alignment for GI: 254780461 and conserved domain: PRK06845

>PRK06845 consensus.
Probab=99.79  E-value=9.8e-19  Score=135.99  Aligned_cols=265  Identities=22%  Similarity=0.307  Sum_probs=170.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999999999753410133222233332056325676301456778887512522123200122332356778776312
Q gi|254780461|r   71 GGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFK  150 (406)
Q Consensus        71 ~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~g  150 (406)
T Consensus        26 ~~~L~~~a~~~al~~~gi~~~~Id~----vi~G~~~~~g~~~--------------------------~~~aR~~aL~aG   75 (392)
T PRK06845         26 ATDLGVAAAKAALEQAGVSPEDIGH----VVFGNVIQTGKDA--------------------------IYLARHIGLKAG   75 (392)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHCCE----EEEEECCCCCCCC--------------------------CHHHHHHHHHCC
T ss_conf             9999999999999871979899798----9998156456543--------------------------349999999769


Q ss_pred             C--CCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCC--C------C-----------------C--
Q ss_conf             2--33333333334444334321001134560557887313456675322--2------2-----------------2--
Q gi|254780461|r  151 I--RGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSN--L------F-----------------D--  201 (406)
Q Consensus       151 l--~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~--~------f-----------------~--  201 (406)
T Consensus        76 lp~~vp~~tV~~~CaSG~~Ai~~A~~~I~sG~~dvvlagGvEsmS~~P~~~~~~~~~~~~g~~~~~~~~~~~~~d~~~~~  155 (392)
T PRK06845         76 LPVGVPALTVNRLCGSGFEAIIQAAKLIYLGEAEAVLAGGVESMSQAPYVVRGARWGVRYGKAELEDMLWSALTDSYAGM  155 (392)
T ss_pred             CCCCCCEEEEECHHHHHHHHHHHHHHHHHCCCCCEEEECCEECCCCCHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCCC
T ss_conf             99888748884430388999999999985799767886255205554232145422356676413355665054644687


Q ss_pred             CCCCC----CCCCC-------------------------------------------CCCCCCCCC-------------C
Q ss_conf             21223----34678-------------------------------------------662232223-------------5
Q gi|254780461|r  202 AMGAM----SSHFN-------------------------------------------HDPCSASRP-------------Y  221 (406)
Q Consensus       202 ~~~~l----s~~~~-------------------------------------------~~p~~~~rP-------------F  221 (406)
T Consensus       156 ~mg~~Ae~~a~~~gisRe~qD~~A~~Sh~ra~~A~~~g~f~~ei~pv~~~~~~~~~~~~~De~~r~~~t~e~l~~l~p~f  235 (392)
T PRK06845        156 PMAITAENLAEQYKISREEVDEYAVLSQRRAAAATEAGRFKEEIAPVTLPGKKGPVVLEKDEHPRPDTTLEKLRTLPAVF  235 (392)
T ss_pred             CHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEEEECCCCCCCCCCHHCCCCCCCCHHHHHCCCCCC
T ss_conf             58999999999849997787899999999999998849967672568831677887667000247899999980287654


Q ss_pred             CCCCCCEE-------ECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEECC-CCCCCCCCHHHHHHHHHHHHHHH---HCC
Q ss_conf             66666413-------12651443112213201100112320122101026-52123443357789887542100---100
Q gi|254780461|r  222 DSRRDGFV-------ISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCD-GDDMVSPSGEGAIRCMRQALSSV---EEP  290 (406)
Q Consensus       222 d~~~~G~~-------~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~d-~~~~~~p~~~g~~~~i~~Al~~a---~~~  290 (406)
T Consensus       236 ~~--~g~vTagnss~~sDGAAa~vl~s~~~a~~~g~~p~a~i~~~~~~g~dp~~----~~~~p~~A~~~al~~agl~~~D  309 (392)
T PRK06845        236 KE--DGVVTAGNASGINDGAAMLIVASESYAKKRGLKPLARLVSYGHAGCDPTI----MGIGPAPAIRAALERAGLTLSD  309 (392)
T ss_pred             CC--CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCHHH----HCCCHHHHHHHHHHHCCCCCCC
T ss_conf             10--16522478887877599988845999997799814999712466658677----1715999999999985999656


Q ss_pred             CCEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             21022102455544420012222023554433647521--0132358999999999999987184078688888976678
Q gi|254780461|r  291 VDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKS--LTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK  368 (406)
Q Consensus       291 i~~i~~hgtgt~~~D~~E~~ai~~~f~~~~~~v~s~K~--~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~~~  368 (406)
T Consensus       310 id~~EinEAFA----~~~l~~~~~-lgl~~~~vN~~GGaiA~GHPiGATG~r~v~~l~~~L~~~----------------  368 (392)
T PRK06845        310 MDLVEVNEAFA----AQYLAVEKE-LGLNPEITNVNGGAIALGHPLGASGARITITLAYELKRR----------------  368 (392)
T ss_pred             CCEEEEEHHHH----HHHHHHHHH-HCCCHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHC----------------
T ss_conf             88667614678----899999997-098915428884188609881104899999999999870----------------


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEEC
Q ss_conf             887379988558835899935567773679999942
Q gi|254780461|r  369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY  404 (406)
Q Consensus       369 ~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~~~  404 (406)
T Consensus       369 ------------~g~~gl~~~c~ggG~g~a~~iE~~  392 (392)
T PRK06845        369 ------------GAKYGVGSACIGGGQGIALVLENL  392 (392)
T ss_pred             ------------CCCEEEEEEEEECCCEEEEEEEEC
T ss_conf             ------------998899987000030317999829