HHsearch alignment for GI: 254780461 and conserved domain: PRK07661

>PRK07661 acetyl-CoA acetyltransferase; Provisional.
Probab=99.71  E-value=1.3e-16  Score=122.81  Aligned_cols=259  Identities=22%  Similarity=0.304  Sum_probs=168.9

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999975341013322223333205632567630145677888751252212320012233235677877631
Q gi|254780461|r   70 QGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWF  149 (406)
Q Consensus        70 ~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~  149 (406)
T Consensus        20 ~~~~L~a~~i~~~l~r~~i~-~~id~----vi~G~~~~~~~~g--------------------------~n~aR~aal~a   68 (384)
T PRK07661         20 RPDDLGALVVKETLKRANYE-GPIDD----LIIGCAMPEAEQG--------------------------LNMARNIGALA   68 (384)
T ss_pred             CHHHHHHHHHHHHHHHCCCC-CCCCE----EEEEECCCCCCCC--------------------------CCHHHHHHHHC
T ss_conf             99999999999999860989-63596----9999476646556--------------------------66999999976


Q ss_pred             CC--CCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCC----------------CCCCCC-----
Q ss_conf             22--3333333333444433432100113456055788731345667532222----------------221223-----
Q gi|254780461|r  150 KI--RGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLF----------------DAMGAM-----  206 (406)
Q Consensus       150 gl--~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f----------------~~~~~l-----  206 (406)
T Consensus        69 Glp~~vp~~TVnr~C~SGl~Ai~~aa~~I~~G~~dvviAGGvEsMS~~P~~~~~~~~~~~~~~~~p~~~~~Mg~tAE~~A  148 (384)
T PRK07661         69 GLPYTVPAITINRYCSSGLQSIAYGAERIMLGHSEAVLAGGAESMSLVPMMGHVVRPNSRLVEAAPEYYMGMGHTAEQVA  148 (384)
T ss_pred             CCCCCCCEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEECCEECCCCCCCCCCCCCCCCHHHCCCCHHHCCHHHHHHHHH
T ss_conf             99988772677350216899999999999769976787546212257866766568981221258433315879999999


Q ss_pred             ----------------C---------CCC---------------C--CCC---------CC------------CCCC-CC
Q ss_conf             ----------------3---------467---------------8--662---------23------------2223-56
Q gi|254780461|r  207 ----------------S---------SHF---------------N--HDP---------CS------------ASRP-YD  222 (406)
Q Consensus       207 ----------------s---------~~~---------------~--~~p---------~~------------~~rP-Fd  222 (406)
T Consensus       149 ~~~gIsRe~qD~~A~~Sh~rA~~A~~~G~f~~EIvPv~~~~~~~~~~~~~~~~~~~~~~DE~~R~~tt~e~La~L~P~F~  228 (384)
T PRK07661        149 VKYGVSREDQDAFAVRSHQRAAKALAEGKFADEIVPVDVTLRTVGENNKLQEETITFSQDEGVRAETTLDILGKLRPAFN  228 (384)
T ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHCEEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHCCCCCC
T ss_conf             98599999999999999999999998599622067887402224655665676557825888688999888832777758


Q ss_pred             CCCCCEE-------ECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEECCCCCCCCCC--HHHHHHHHHHHHHHHH---CC
Q ss_conf             6666413-------1265144311221320110011232012210102652123443--3577898875421001---00
Q gi|254780461|r  223 SRRDGFV-------ISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPS--GEGAIRCMRQALSSVE---EP  290 (406)
Q Consensus       223 ~~~~G~~-------~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~d~~~~~~p~--~~g~~~~i~~Al~~a~---~~  290 (406)
T Consensus       229 ~~--GtvTAgNss~~~DGAAa~ll~s~~~a~~~gl~p~a~i~~~a~~g~-----~P~~m~~gPv~A~~k~L~ragl~~~D  301 (384)
T PRK07661        229 VR--GSVTAGNSSQMSDGAAAVLLMDREKAVSDGLKPLAKFRSFAVAGV-----PPEVMGIGPIAAIPKALKLAGLELSD  301 (384)
T ss_pred             CC--CCEECCCCCCCCCHHHHHHHCCHHHHHHCCCCEEEEEECCEEEEE-----CHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99--857787368432057999970799999879980599974458983-----87986046999999999986998667


Q ss_pred             CCEEEECCCCCCCCCCCHHHHHH-----CCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             21022102455544420012222-----023554433647521--01323589999999999999871840786888889
Q gi|254780461|r  291 VDYINTHGTATPKGDKKEVEAIR-----EVFKGNIPYIQSTKS--LTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEI  363 (406)
Q Consensus       291 i~~i~~hgtgt~~~D~~E~~ai~-----~~f~~~~~~v~s~K~--~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~  363 (406)
T Consensus       302 iD~~Ein----------EAFA~q~l~~~~~l~id~~kvN~~GGaiAlGHP~GatGarl~~tl~~~L~~~-----------  360 (384)
T PRK07661        302 IGLFELN----------EAFASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLIHEMKRR-----------  360 (384)
T ss_pred             CCEEEEH----------HHHHHHHHHHHHHHCCCHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHH-----------
T ss_conf             7755650----------6678889999998399888839986588748880344799999999999981-----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEEC
Q ss_conf             76678887379988558835899935567773679999942
Q gi|254780461|r  364 DPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY  404 (406)
Q Consensus       364 ~~~~~~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~~~  404 (406)
T Consensus       361 -----------------~~~~Glas~C~ggG~g~A~~iEr~  384 (384)
T PRK07661        361 -----------------NEQFGIVTMCIGGGMGAAGVFELL  384 (384)
T ss_pred             -----------------CCCEEEEEECCCCCHHHEEEEEEC
T ss_conf             -----------------999899996332052236999949