HHsearch alignment for GI: 254780461 and conserved domain: PRK08131

>PRK08131 acetyl-CoA acetyltransferase; Provisional.
Probab=99.77  E-value=5.8e-18  Score=131.16  Aligned_cols=267  Identities=19%  Similarity=0.284  Sum_probs=170.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999975341013322223333205632567630145677888751252212320012233235677877631
Q gi|254780461|r   70 QGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWF  149 (406)
Q Consensus        70 ~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~  149 (406)
T Consensus        25 ~~~~L~a~~i~~~l~r~~i~~~~Id~----vi~G~v~~~g~~~--------------------------~n~aR~~al~a   74 (401)
T PRK08131         25 RPDDLAATVIRRLVEKSGFAGDDIED----VILGCTNQAGEDS--------------------------RNVARNALLLA   74 (401)
T ss_pred             CHHHHHHHHHHHHHHHCCCCHHHCCE----EEEEECCCCCCCC--------------------------CCHHHHHHHHC
T ss_conf             88999999999999972989899898----9998146656544--------------------------66999999966


Q ss_pred             --CCCCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCC------C-------C-------------
Q ss_conf             --22333333333344443343210011345605578873134566753222------2-------2-------------
Q gi|254780461|r  150 --KIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNL------F-------D-------------  201 (406)
Q Consensus       150 --gl~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~------f-------~-------------  201 (406)
T Consensus        75 Glp~~vp~~tVnr~CaSGl~Ai~~Aa~~I~~G~~dvvlagGvEsMS~~P~~~~~~~~~~~~~~~~~d~~~~~~~~~p~~~  154 (401)
T PRK08131         75 GLPVTVPGQTVNRLCASGLSAVIDAARAITCGEGDLYLAGGVESMSRAPFVMGKAESAFSRDAKVFDTTIGARFPNPKIV  154 (401)
T ss_pred             CCCCCCCEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHCCCCCCCCCCCCCCCCCCCHHCCCCCHHH
T ss_conf             99988871687525357899999999998579977258850650354641015664444555421243000025880566


Q ss_pred             ------CCCC--------------------CCCC-----------CC--CCC----------------CC----------
Q ss_conf             ------2122--------------------3346-----------78--662----------------23----------
Q gi|254780461|r  202 ------AMGA--------------------MSSH-----------FN--HDP----------------CS----------  216 (406)
Q Consensus       202 ------~~~~--------------------ls~~-----------~~--~~p----------------~~----------  216 (406)
T Consensus       155 ~~~~~~~Mg~tAe~~A~~~gisReeqD~~A~~Sh~ra~~A~~~G~f~~EIvPv~v~~~~~~~~~~~~~De~~R~~tt~e~  234 (401)
T PRK08131        155 KQYGGDSMPETGDNVAREFGISREDADRFAAQSQAKYQAAKEEGFFAGEILPIEVRQGKKLPPKLVAEDEHPRPSSTVEA  234 (401)
T ss_pred             HHHCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHCEEEEEECCCCCCCCEEEEECCCCCCCCCHHH
T ss_conf             65079837899999999859898999999999999999998759610123006704666678779972255568988434


Q ss_pred             --CCCC-CCC----CCCCEEECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEECCCCCCCCCC--HHHHHHHHHHHHHHH
Q ss_conf             --2223-566----6664131265144311221320110011232012210102652123443--357789887542100
Q gi|254780461|r  217 --ASRP-YDS----RRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPS--GEGAIRCMRQALSSV  287 (406)
Q Consensus       217 --~~rP-Fd~----~~~G~~~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~d~~~~~~p~--~~g~~~~i~~Al~~a  287 (406)
T Consensus       235 La~L~P~f~~GtvTagnsS~isDGAAavvl~s~~~a~~~gl~p~a~i~~~~~~g~-----~P~~~~~gpv~A~~~~L~~a  309 (401)
T PRK08131        235 LAKLKPLFEGGVVTAGNASGINDGAAALLIGSRAAGEKAGIKPMARILSSAAAGV-----EPRIMGIGPVEAIKKALARA  309 (401)
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEC-----CHHHHCCCHHHHHHHHHHHC
T ss_conf             7437986546875466667555468888772399999879980399997778874-----87784826599999999975


Q ss_pred             ---HCCCCEEEECCCCCCCCCCCHHHHHHCCCCC--CCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             ---1002102210245554442001222202355--4433647521--01323589999999999999871840786888
Q gi|254780461|r  288 ---EEPVDYINTHGTATPKGDKKEVEAIREVFKG--NIPYIQSTKS--LTGHSLGAAGAQEAIYCLIMMQERFIGESKNI  360 (406)
Q Consensus       288 ---~~~i~~i~~hgtgt~~~D~~E~~ai~~~f~~--~~~~v~s~K~--~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~  360 (406)
T Consensus       310 gl~~~Did~~EinEAFA----~~~l~~~~~-lgl~~d~~kvN~~GGaiA~GHP~GATGarl~~~l~~~L~~~--------  376 (401)
T PRK08131        310 GLTLDDMDIIEINEAFA----SQVLSCLKG-LGVDFDDPRVNPNGGAIAVGHPLGASGARLALTAARELQRR--------  376 (401)
T ss_pred             CCCCCCCCEEEEEHHHH----HHHHHHHHH-CCCCCCCCEECCCCCHHHHCCCCCCCHHHHHHHHHHHHHHC--------
T ss_conf             99812387778502668----889999998-09998878089886688738880200899999999999871--------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEEC
Q ss_conf             88976678887379988558835899935567773679999942
Q gi|254780461|r  361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY  404 (406)
Q Consensus       361 ~~~~~~~~~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~~~  404 (406)
T Consensus       377 --------------------~~~~g~~t~c~ggG~g~a~~iErv  400 (401)
T PRK08131        377 --------------------GGRYAVVSLCIGVGQGLAMVIERV  400 (401)
T ss_pred             --------------------CCCEEEEEECCCCCCEEEEEEEEC
T ss_conf             --------------------998899996221041308999966