HHsearch alignment for GI: 254780461 and conserved domain: PRK09258

>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.
Probab=99.70  E-value=6.1e-16  Score=118.54  Aligned_cols=308  Identities=17%  Similarity=0.163  Sum_probs=175.4

Q ss_pred             EEEEEEEEECCCC-CCHHHHHHHHHCC--CCCCEECCCCCCCCCCEEECCEECCCHHHCCCHHHHHHCCHHHHHHHHHHH
Q ss_conf             8999332670889-8999999999818--876233677575478512454014786684898999724999999999999
Q gi|254780461|r    4 VAVTGMGIVSSIG-NNVSEVAISLREA--RSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHLAMQ   80 (406)
Q Consensus         4 V~ItG~G~v~p~G-~~~~e~w~~L~~G--~sgi~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~r~~d~~~~l~l~aa~   80 (406)
T Consensus         1 v~I~~~g~ylP~~~vtn~el~~~~~~~~~~~~~~~~~i~~~tGI~~Rr~a~---------------~~e~~sdma~~Aa~   65 (339)
T PRK09258          1 VFINSLAYELAPVVVTSSEIESRLAPLYQRLRIPMGQLEALTGIRERRWWP---------------KGHQLSDGATEAAR   65 (339)
T ss_pred             CEEEEEEEECCCCCCCHHHHHHHHCCCHHHHCCCCCHHHHCCCCEEEEECC---------------CCCCHHHHHHHHHH
T ss_conf             989899987799617489999775330454258711323346730353679---------------99988999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC--CCCCC
Q ss_conf             9753410133222233332056325676301456778887512522123200122332356778776312233--33333
Q gi|254780461|r   81 EAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRG--TSYSI  158 (406)
Q Consensus        81 ~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~gl~G--p~~ti  158 (406)
T Consensus        66 ~AL~~agi~p~dIDl----lI~at~tpd------------------~~~P---------~tA~~v~~~LGl~~~~~afDi  114 (339)
T PRK09258         66 KALAEAGIDASDIGL----LINTSVCRD------------------QLEP---------ATACRVHAELGLSKDCAIFDI  114 (339)
T ss_pred             HHHHHCCCCHHHCCE----EEEECCCCC------------------CCCC---------CHHHHHHHHHCCCCCEEEEEE
T ss_conf             999975999899999----999051148------------------5378---------189999998479987478651


Q ss_pred             CCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCEEEEE
Q ss_conf             33344443343210011345605578873134566753222222122334678662232223566666413126514431
Q gi|254780461|r  159 SSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV  238 (406)
Q Consensus       159 ~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f~~~~~ls~~~~~~p~~~~rPFd~~~~G~~~gEGa~~~v  238 (406)
T Consensus       115 ~~aCsGf~~aL~~A~~~i~sg~~~~~LvV~aE~~s~~~d~~~~~~---~----~~~~~~~~~f~~~~a~~~~GdGA~A~v  187 (339)
T PRK09258        115 SNACLGFLNGMLDAANMIELGQIDYGLVVSGESARDIVEATIARM---L----ADPTMTRQNFAQSLATLTLGSGAVAVV  187 (339)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHC---C----CCCCCHHHHCCCCCCCEECCCCEEEEE
T ss_conf             043167999999999999769998899997541210024443210---2----466620333022111042166217999


Q ss_pred             CCCHHHHCCCCCCCCCEEEEEEEECCC--------------CCCCCCCHHHH--------HHHHHHHHHHH---HCCCCE
Q ss_conf             122132011001123201221010265--------------21234433577--------89887542100---100210
Q gi|254780461|r  239 LEEMERAKARGAKIYAELTGYGSTCDG--------------DDMVSPSGEGA--------IRCMRQALSSV---EEPVDY  293 (406)
Q Consensus       239 Le~~~~A~~rGa~i~a~i~g~~~~~d~--------------~~~~~p~~~g~--------~~~i~~Al~~a---~~~i~~  293 (406)
T Consensus       188 l~~~~~~~~-~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dg~~~~~~~~~~~~~~~~~~L~~~gl~~~dId~  262 (339)
T PRK09258        188 LTRGSLVPR-AHRL----LGGVTRAATEHHQLCQGGLDEAGHGLMRTDAVLLLKEGVELAVDTWEAFLQQLGWSVEQVDK  262 (339)
T ss_pred             EECCCCCCC-CCEE----ECCCCCCCCCHHHCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCE
T ss_conf             953677888-8645----14554577210010247888787655653589999999999999999999983999899889


Q ss_pred             EEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22102455544420012222023554433647521013235899999999999998718407868888897667888737
Q gi|254780461|r  294 INTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIV  373 (406)
Q Consensus       294 i~~hgtgt~~~D~~E~~ai~~~f~~~~~~v~s~K~~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~~~~l~~v  373 (406)
T Consensus       263 ~v~HQan~-----~~~~~i~~~Lgi~~ek~~~~~~~~GNT~sASiPlaL~---~a~~~g~ik~-----------------  317 (339)
T PRK09258        263 VVCHQVGA-----AHTRAVLKALGIDPEKVFPTFPLLGNMGPVSLPITLA---MAAEQGFLKK-----------------  317 (339)
T ss_pred             EEECCCCH-----HHHHHHHHHCCCCHHHHHCHHHHHCCHHHHHHHHHHH---HHHHCCCCCC-----------------
T ss_conf             98625769-----9999999981968777103186458689899999999---9998299999-----------------


Q ss_pred             CCCCCCCCCCEEEEECCCCCCEEEEEEEE
Q ss_conf             99885588358999355677736799999
Q gi|254780461|r  374 RKRIDNAKIDTVLSNSFGFGGTNATLVFR  402 (406)
Q Consensus       374 ~~~~~~~~~~~al~~s~GfGG~n~~~vl~  402 (406)
T Consensus       318 --------Gd~vll~~~GaGl~~~~~~~~  338 (339)
T PRK09258        318 --------GDRVALLGIGSGLNCSMLGIK  338 (339)
T ss_pred             --------CCEEEEEEEEHHHHHHHHEEE
T ss_conf             --------799999988478765567376