HHsearch alignment for GI: 254780461 and conserved domain: PRK09352

>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.
Probab=99.66  E-value=6.6e-15  Score=112.09  Aligned_cols=284  Identities=19%  Similarity=0.280  Sum_probs=168.3

Q ss_pred             CCCEEEEEEEEECCCC-CCHHHHHHHHHCCCCCCEECCCC--CCCCCCEEECCEECCCHHHCCCHHHHHHCCHHHHHHHH
Q ss_conf             9728999332670889-89999999998188762336775--75478512454014786684898999724999999999
Q gi|254780461|r    1 MRRVAVTGMGIVSSIG-NNVSEVAISLREARSGITFSEDF--AKFGFRCQVWGKPLLNAAELIDRKAMRFLSQGGTWGHL   77 (406)
Q Consensus         1 M~rV~ItG~G~v~p~G-~~~~e~w~~L~~G~sgi~~~~~~--~~~~~~~~~~g~~~~~~~~~~~~~~~r~~d~~~~l~l~   77 (406)
T Consensus         1 m~~a~I~g~g~ylP~~~v~n~el~~~~~--~~-----~~~i~~~tGI~~R~~a~~~---------------e~~~~ma~~   58 (319)
T PRK09352          1 MMYAKILGTGSYLPERVVTNDDLEKMVD--TS-----DEWIVTRTGIKERRIAAPD---------------ETTSDLATE   58 (319)
T ss_pred             CCCCEEEEEEEECCCCEECHHHHHHHCC--CC-----HHHHHHCCCCEEEEECCCC---------------CCHHHHHHH
T ss_conf             9633898999978996586999998719--98-----8999756494589988999---------------999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC-CCC
Q ss_conf             9999753410133222233332056325676301456778887512522123200122332356778776312233-333
Q gi|254780461|r   78 AMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRG-TSY  156 (406)
Q Consensus        78 aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~gl~G-p~~  156 (406)
T Consensus        59 Aa~~aL~~ag~~~~dIdl----li~~t~t~d------------------~~~P---------~~a~~v~~~LGl~~~~~f  107 (319)
T PRK09352         59 AAKKALEAAGIDPEDIDL----IIVATTTPD------------------YLFP---------STACLVQARLGAKNAPAF  107 (319)
T ss_pred             HHHHHHHHCCCCHHHCCE----EEEEECCCC------------------CCCC---------HHHHHHHHHHCCCCCCEE
T ss_conf             999999975989889979----999741789------------------9896---------699999999789997375


Q ss_pred             CCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCEEE
Q ss_conf             33333444433432100113456055788731345667532222221223346786622322235666664131265144
Q gi|254780461|r  157 SISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV  236 (406)
Q Consensus       157 ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f~~~~~ls~~~~~~p~~~~rPFd~~~~G~~~gEGa~~  236 (406)
T Consensus       108 Di~~~C~g~~~aL~~A~~~i~~g~~~~~Lvv~~e~~S~~----------~d-------------~~d~~~~~lfGDGAaA  164 (319)
T PRK09352        108 DLSAACSGFVYALSTADQFIRSGAYKNALVIGAEKLSRI----------VD-------------WTDRSTCVLFGDGAGA  164 (319)
T ss_pred             EHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHCCCC----------CC-------------CCCCHHEEEECCCCCE
T ss_conf             374345689999999999986698762699611010142----------45-------------5550001661585007


Q ss_pred             EECCCHHHHCCCCCCCCCEEEEEEEECCCCC---CC----------------CCCHHH--------HHHHHHHHHHHH--
Q ss_conf             3112213201100112320122101026521---23----------------443357--------789887542100--
Q gi|254780461|r  237 IVLEEMERAKARGAKIYAELTGYGSTCDGDD---MV----------------SPSGEG--------AIRCMRQALSSV--  287 (406)
Q Consensus       237 ~vLe~~~~A~~rGa~i~a~i~g~~~~~d~~~---~~----------------~p~~~g--------~~~~i~~Al~~a--  287 (406)
T Consensus       165 ~vl~~~~~~---~--~----~~~~~~tdg~~~~~~~~~~~~~~~~~~~~~~~~m~g~~v~~~a~~~~~~~i~~~L~~~gl  235 (319)
T PRK09352        165 VVLEASEEP---G--I----LSTHLGSDGSGGDLLYLPGGGSRGPASGETYLRMEGREVFKFAVREMAKVAREALEAAGL  235 (319)
T ss_pred             EEEEECCCC---C--E----EEEEEEECCCCCCEEEECCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999754888---7--3----689999748888758967888889878775467644999999998549999999987499


Q ss_pred             -HCCCCEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             -1002102210245554442001222202355443364752101323589999999999999871840786888889766
Q gi|254780461|r  288 -EEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPE  366 (406)
Q Consensus       288 -~~~i~~i~~hgtgt~~~D~~E~~ai~~~f~~~~~~v~s~K~~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~  366 (406)
T Consensus       236 ~~~dId~~i~Hq~~~~-----~~~~~~~~lgi~~ek~~~~l~~~GNt~sasipi~L~---~~~~~g~lk-----------  296 (319)
T PRK09352        236 TPEDIDWLVPHQANLR-----IIDATAKKLGLPMEKVVVTVDKYGNTSAASIPLALD---EAVRDGRIK-----------  296 (319)
T ss_pred             CHHHCCEEEECCCCHH-----HHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHH---HHHHCCCCC-----------
T ss_conf             8323878998267689-----999999981979888565487538458878999999---999839999-----------


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEE
Q ss_conf             788873799885588358999355677736799999
Q gi|254780461|r  367 FKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR  402 (406)
Q Consensus       367 ~~~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~  402 (406)
T Consensus       297 --------------~Gd~vll~~~G~G~s~~~~vlr  318 (319)
T PRK09352        297 --------------RGDLVLLEGFGGGLTWGAALVR  318 (319)
T ss_pred             --------------CCCEEEEEEEEHHHEEEEEEEE
T ss_conf             --------------9799999998447431788997