HHsearch alignment for GI: 254780461 and conserved domain: cd00825

>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction. Members are involved in the synthesis of fatty acids and polyketides, a diverse group of natural products. Both pathways are an iterative series of additions of small carbon units, usually acetate, to a nascent acyl group. There are 2 classes of decarboxylating condensing enzymes, which can be distinguished by sequence similarity, type of active site residues and type of primer units (acetyl CoA or acyl carrier protein (ACP) linked units).
Probab=100.00  E-value=0  Score=570.10  Aligned_cols=322  Identities=39%  Similarity=0.563  Sum_probs=287.8

Q ss_pred             HHHCC-HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             97249-99999999999975341013322223333205632567630145677888751252212320012233235677
Q gi|254780461|r   65 MRFLS-QGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASA  143 (406)
Q Consensus        65 ~r~~d-~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~  143 (406)
T Consensus         4 ~~~~~~~vsl~al~aa~eAl~dAGl~~~~~~~~r~GV~~Gs~~g~~~~~~~~------~~~~~~~~p~~~~~~~~~~~a~   77 (332)
T cd00825           4 ITGLGSYVSILGFEAAERAIADAGLSREYQKNPIVGVVVGTGGGSPRFQVFG------ADAMRAVGPYVVTKAMFPGASG   77 (332)
T ss_pred             ECCCCHHHHHHHHHHHHHHHHHCCCCHHHCCCCCEEEEEEECCCCHHHHHHH------HCCCCCCCCCCCCCCCCCHHHH
T ss_conf             4354659999999999999997599934457888899999688318889853------1232236864246655348999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             877631223333333333444433432100113456055788731345667532222-2212233467866223222356
Q gi|254780461|r  144 TLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLF-DAMGAMSSHFNHDPCSASRPYD  222 (406)
Q Consensus       144 ~is~~~gl~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f-~~~~~ls~~~~~~p~~~~rPFd  222 (406)
T Consensus        78 ~is~~~gl~Gp~~tv~taCaS~l~Ai~~A~~~i~~G~~d~aivgg~~~~~~~~~~~~~~~~~~~------~~~~~~rpFd  151 (332)
T cd00825          78 QIATPLGIHGPAYDVSAACAGSLHALSLAADAVQNGKQDIVLAGGSEELAAPMDCEFDAMGALS------TPEKASRTFD  151 (332)
T ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHHHCCC------CCCCCCCCCC
T ss_conf             9999968989630313541688999999999998389987462031211798999999972778------9898878887


Q ss_pred             CCCCCEEECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEECCCCCCC--CCCHHHHHHHHHHHHHHH---HCCCCEEEEC
Q ss_conf             66664131265144311221320110011232012210102652123--443357789887542100---1002102210
Q gi|254780461|r  223 SRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMV--SPSGEGAIRCMRQALSSV---EEPVDYINTH  297 (406)
Q Consensus       223 ~~~~G~~~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~d~~~~~--~p~~~g~~~~i~~Al~~a---~~~i~~i~~h  297 (406)
T Consensus       152 ~~~~G~v~gEGa~~lvLe~~~~A~~rg~~i~a~i~g~~~~~dg~~~~~~~p~~~~~~~ai~~Al~~agi~p~~I~yI~ah  231 (332)
T cd00825         152 AAADGFVFGDGAGALVVEELEHALARGAHIYAEIVGTAATIDGAGMGAFAPSAEGLARAAKEALAVAGLTVWDIDYLVAH  231 (332)
T ss_pred             CCCCCEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEC
T ss_conf             88997200265403554008888752896203311345877898788879799999999999999849882001479917


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             24555444200122220235544336475210132358999999999999987184078688888976678887379988
Q gi|254780461|r  298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRI  377 (406)
Q Consensus       298 gtgt~~~D~~E~~ai~~~f~~~~~~v~s~K~~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~~~~l~~v~~~~  377 (406)
T Consensus       232 gtGt~~~D~~E~~Al~~~fg~~~~~v~S~Ks~~GH~~~AsG~~~li~~~lal~~~~ipp~~n~~~~~~~~~--~-~~~~~  308 (332)
T cd00825         232 GTGTPIGDVKELKLLRSEFGDKSPAVSATKAMTGNLSSAAVVLAVDEAVLMLEHGFIPPSIHIEELDEAGL--N-IVTET  308 (332)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC--C-CCCCC
T ss_conf             78685555999999999857899821057456445526569999999999986396089999899983325--6-67777


Q ss_pred             CCCCCCEEEEECCCCCCEEEEEEE
Q ss_conf             558835899935567773679999
Q gi|254780461|r  378 DNAKIDTVLSNSFGFGGTNATLVF  401 (406)
Q Consensus       378 ~~~~~~~al~~s~GfGG~n~~~vl  401 (406)
T Consensus       309 ~~~~~~~~~~nsfGfGG~Na~vvl  332 (332)
T cd00825         309 TPRELRTALLNGFGLGGTNATLVL  332 (332)
T ss_pred             CCCCCCEEEEECCCCCCEEEEEEC
T ss_conf             689998999967026814068869