HHsearch alignment for GI: 254780461 and conserved domain: cd00831

>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs. PKS generate an array of different products, dependent on the nature of the starter molecule. They share a common chemical strategy, after the starter molecule is loaded onto the active site cysteine, a carboxylative condensation reation extends the polyketide chain. Plant-specific PKS are dimeric iterative PKSs, using coenzyme A esters to deliver substrate to the active site, but they differ in the choice of starter molecule and the number of condensation reactions.
Probab=99.33  E-value=3.2e-11  Score=89.08  Aligned_cols=279  Identities=17%  Similarity=0.178  Sum_probs=147.7

Q ss_pred             EEEEEEEEECCCCC-CHHHHHHHHHCCCCC---C---EECCC-CCCCCCCEEECCEECCC--------HHHCCCHHHHHH
Q ss_conf             89993326708898-999999999818876---2---33677-57547851245401478--------668489899972
Q gi|254780461|r    4 VAVTGMGIVSSIGN-NVSEVAISLREARSG---I---TFSED-FAKFGFRCQVWGKPLLN--------AAELIDRKAMRF   67 (406)
Q Consensus         4 V~ItG~G~v~p~G~-~~~e~w~~L~~G~sg---i---~~~~~-~~~~~~~~~~~g~~~~~--------~~~~~~~~~~r~   67 (406)
T Consensus         2 A~I~gigt~~P~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~tgI~~R~~~~~~~~~~~~~~~~~~~~~~~r~~~~   81 (361)
T cd00831           2 ATILAIGTAVPPHRVPQSELVDFYRRLFSSDHLPELKEKLKRLCAKTGIETRYLVLPGGEETYAPRPEMSPSLDERNDIA   81 (361)
T ss_pred             EEEEEEEEECCCEEECHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHH
T ss_conf             19999887779926759999999987443334356789999999726986155552661220245655588878887779


Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             49999999999999753410133222233332056325676301456778887512522123200122332356778776
Q gi|254780461|r   68 LSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLST  147 (406)
Q Consensus        68 ~d~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~  147 (406)
T Consensus        82 ~~~~~~la~~Aa~~AL~~ag~~~~dId~----lI~~Tst~---~----------------~~P---------s~a~~v~~  129 (361)
T cd00831          82 LEEARELAEEAARGALDEAGLRPSDIDH----LVVNTSTG---N----------------PTP---------SLDAMLIN  129 (361)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHCCE----EEEECCCC---C----------------CCC---------CHHHHHHH
T ss_conf             9899999999999999981989899999----99986599---9----------------989---------76999999


Q ss_pred             HHCCCCCC--CCCC-CCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             31223333--3333-33444433432100113456055788731345667532222221223346786622322235666
Q gi|254780461|r  148 WFKIRGTS--YSIS-SACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSR  224 (406)
Q Consensus       148 ~~gl~Gp~--~ti~-~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f~~~~~ls~~~~~~p~~~~rPFd~~  224 (406)
T Consensus       130 ~LGl~~~~~~~dl~~~gCsg~~~aL~~A~~~i~~g~~~~vLVV~~E~~S~~~-~~-----------~d~~~~~v------  191 (361)
T cd00831         130 RLGLRPDVKRYNLGGMGCSAGAIALDLAKDLLEANPGARVLVVSTELCSLWY-RG-----------PDHRSMLV------  191 (361)
T ss_pred             HHCCCCCHHEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCEEC-CC-----------CCCHHHHH------
T ss_conf             7389987003556467556899999999999982999769999612112020-68-----------87577755------


Q ss_pred             CCCEEECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEE--------------CCCCCCC-CCC-----HHHHHHHHHHHH
Q ss_conf             66413126514431122132011001123201221010--------------2652123-443-----357789887542
Q gi|254780461|r  225 RDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGST--------------CDGDDMV-SPS-----GEGAIRCMRQAL  284 (406)
Q Consensus       225 ~~G~~~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~--------------~d~~~~~-~p~-----~~g~~~~i~~Al  284 (406)
T Consensus       192 -~~~LFGDGA~A~vl~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~l~~~v~~~~~~~~~~~~~~~l  269 (361)
T cd00831         192 -GNALFGDGAAAVLLSNDPRDRRRER-PLFELVRAASTLLPDSEDAMGWHLGEEGLTFVLSRDVPRLVEKNLERVLRKLL  269 (361)
T ss_pred             -HHCCCCCCCEEEEEECCCCCCCCCC-CEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             -4200047725899842676665666-52688377761246888766665057753785063699999999999999999


Q ss_pred             HHH-----HCCCCEEEECCCCCCCCCCCHHHHHHCCCCCCCCCCC---CCCCHHHHHHHHHHH
Q ss_conf             100-----1002102210245554442001222202355443364---752101323589999
Q gi|254780461|r  285 SSV-----EEPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQ---STKSLTGHSLGAAGA  339 (406)
Q Consensus       285 ~~a-----~~~i~~i~~hgtgt~~~D~~E~~ai~~~f~~~~~~v~---s~K~~~GH~~gasG~  339 (406)
T Consensus       270 ~~~~~~~~~~di~~~~~Hq~~~~I-----i~~v~~~Lgl~~~~~~~s~~~l~~~GNtsSaSip  327 (361)
T cd00831         270 ARLGIGLFKLAFDHWCVHPGGRAV-----LDAVEKALGLSPEDLEASRMVLRRYGNMSSSSVL  327 (361)
T ss_pred             HHHCCCCCHHHCCEEEECCCCHHH-----HHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             982589996772558878786899-----9999998298968832578789863853988999