HHsearch alignment for GI: 254780461 and conserved domain: cd00832

>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria. CLFs have been shown to have decarboxylase activity towards malonyl-acyl carrier protein (ACP). CLFs are similar to other elongation ketosynthase domains, but their active site cysteine is replaced by a conserved glutamine.
Probab=100.00  E-value=0  Score=717.57  Aligned_cols=394  Identities=24%  Similarity=0.366  Sum_probs=367.5

Q ss_pred             CCEEEEEEEEECCCCCCHHHHHHHHHCCCCCCEECCCCCCCCCCEEECCE-ECCCHHHCCCHHHHHHCCHHHHHHHHHHH
Q ss_conf             72899933267088989999999998188762336775754785124540-14786684898999724999999999999
Q gi|254780461|r    2 RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAELIDRKAMRFLSQGGTWGHLAMQ   80 (406)
Q Consensus         2 ~rV~ItG~G~v~p~G~~~~e~w~~L~~G~sgi~~~~~~~~~~~~~~~~g~-~~~~~~~~~~~~~~r~~d~~~~l~l~aa~   80 (406)
T Consensus         1 rRVvItG~g~~~P~g~~~~~~w~~L~~G~s~i~~~~~~~~~~~~~~~~g~v~~f~~~~~~~~~~~~~~d~~~~~~l~aa~   80 (399)
T cd00832           1 RRAVVTGIGVVAPNGLGVEEYWKAVLDGRSGLGPITRFDPSGYPARLAGEVPDFDAAEHLPGRLLPQTDRMTRLALAAAD   80 (399)
T ss_pred             CCEEEECCEEECCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCEEEECCCCCHHHCCCHHHHHHCCHHHHHHHHHHH
T ss_conf             92999716778979599999999997299835427755755687764567798780116898898746999999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             97534101332222333320563256763014567788875125221232001223323567787763122333333333
Q gi|254780461|r   81 EAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISS  160 (406)
Q Consensus        81 ~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~gl~Gp~~ti~~  160 (406)
T Consensus        81 ~Al~dAGl~~~~~~~~~~gv~~g~~~g~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~is~~~gl~Gp~~tv~t  159 (399)
T cd00832          81 WALADAGVDPAALPPYDMGVVTASAAGGFEFGQRELQKLWSK-GPRHVSAYQSFAWFYAVNTGQISIRHGMRGPSGVVVA  159 (399)
T ss_pred             HHHHHCCCCHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHC
T ss_conf             988860998456487742899942567602558999999741-8542561121356677888899998289887410211


Q ss_pred             CCCCCCCCCCCEECCCCCCEEEEEEEECCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCEEEEEC
Q ss_conf             3444433432100113456055788731345-667532222221223346786622322235666664131265144311
Q gi|254780461|r  161 ACATSAHCIGNAAELIQSGKQDIMFAGGQED-LDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL  239 (406)
Q Consensus       161 acaSgl~Al~~A~~~L~~G~~D~aivGg~d~-~~~~~~~~f~~~~~ls~~~~~~p~~~~rPFd~~~~G~~~gEGa~~~vL  239 (406)
T Consensus       160 acsssl~Ai~~A~~~i~~G-~d~~i~Gg~~~~l~p~~~~~~~~~g~ls~~--~~p~~~~rPFD~~r~G~v~GEGa~~lvL  236 (399)
T cd00832         160 EQAGGLDALAQARRLVRRG-TPLVVSGGVDSALCPWGWVAQLSSGRLSTS--DDPARAYLPFDAAAAGYVPGEGGAILVL  236 (399)
T ss_pred             CCCHHHHHHHHHHHHHHCC-CCHHHCCCCCEEECCHHHHHHHHHHHHCCC--CCCCCCCCCCCCCCCCEEECCCEEEEEE
T ss_conf             4707999999999998769-720121774045162889999875664569--9998650477678980664276678884


Q ss_pred             CCHHHHCCCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHH---HCCCCEEEECCCCCCCCCCCHHHHHHCCC
Q ss_conf             221320110011232012210102652123443357789887542100---10021022102455544420012222023
Q gi|254780461|r  240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV---EEPVDYINTHGTATPKGDKKEVEAIREVF  316 (406)
Q Consensus       240 e~~~~A~~rGa~i~a~i~g~~~~~d~~~~~~p~~~g~~~~i~~Al~~a---~~~i~~i~~hgtgt~~~D~~E~~ai~~~f  316 (406)
T Consensus       237 e~~~~A~~rGa~i~a~i~G~~~~~d~~~~-~~~~~~~~~a~~~Al~~agi~p~~I~yI~aHgTGT~~gD~~E~~Ai~~~f  315 (399)
T cd00832         237 EDAAAARERGARVYGEIAGYAATFDPPPG-SGRPPGLARAIRLALADAGLTPEDVDVVFADAAGVPELDRAEAAALAAVF  315 (399)
T ss_pred             CCHHHHHHCCCEEEEEEEEEEECCCCCCC-CCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             54988987889599999888984899899-98979999999999997199967056999833758556999999999996


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEE
Q ss_conf             55443364752101323589999999999999871840786888889766788873799885588358999355677736
Q gi|254780461|r  317 KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTN  396 (406)
Q Consensus       317 ~~~~~~v~s~K~~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~~~~l~~v~~~~~~~~~~~al~~s~GfGG~n  396 (406)
T Consensus       316 g~~~~pv~S~K~~iGH~~~AaG~~~~i~~ll~l~~g~ippt~n~~~~~p~~~-l~~v~~~~~~~~~~~al~nsfGfGG~N  394 (399)
T cd00832         316 GPRGVPVTAPKTMTGRLYAGGAPLDVATALLALRDGVIPPTVNVTDVPPAYG-LDLVTGRPRPAALRTALVLARGRGGFN  394 (399)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCEEEEECCCCCCEE
T ss_conf             6999878995422110699999999999999983596198999899998888-523789987899899999440568032


Q ss_pred             EEEEE
Q ss_conf             79999
Q gi|254780461|r  397 ATLVF  401 (406)
Q Consensus       397 ~~~vl  401 (406)
T Consensus       395 a~lvl  399 (399)
T cd00832         395 SALVV  399 (399)
T ss_pred             EEEEC
T ss_conf             68969