HHsearch alignment for GI: 254780461 and conserved domain: pfam08545

>pfam08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III. This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III EC:2.3.1.41, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria.
Probab=97.71  E-value=1.9e-05  Score=53.00  Aligned_cols=64  Identities=30%  Similarity=0.515  Sum_probs=50.1

Q ss_pred             CCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCEEE
Q ss_conf             33333444433432100113456055788731345667532222221223346786622322235666664131265144
Q gi|254780461|r  157 SISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV  236 (406)
Q Consensus       157 ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~f~~~~~ls~~~~~~p~~~~rPFd~~~~G~~~gEGa~~  236 (406)
T Consensus         2 Di~~~Csg~~~aL~~A~~~i~sg~~~~vLvv~~e~~s~~~----------~-------------~~d~~~~~lfGDga~A   58 (80)
T pfam08545         2 DINAACSGFVYALSTAAALIRSGRAKNVLVVGAETLSRIL----------D-------------WTDRSTAVLFGDGAGA   58 (80)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCC----------C-------------CCCCCEEEEECCEEEE
T ss_conf             6064148899999999999987998858998511245536----------8-------------6677246998640269


Q ss_pred             EECCCHH
Q ss_conf             3112213
Q gi|254780461|r  237 IVLEEME  243 (406)
Q Consensus       237 ~vLe~~~  243 (406)
T Consensus        59 ~il~~~~   65 (80)
T pfam08545        59 VVLEATE   65 (80)
T ss_pred             EEEEECC
T ss_conf             9999717