BLAST/PSIBLAST alignment of GI: 254780461 and GI: 227824079 at iteration 1
>gi|227824079|ref|YP_002828052.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium fredii NGR234] Length = 406
>gi|227343081|gb|ACP27299.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I, FabB [Sinorhizobium fredii NGR234] Length = 406
 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/406 (74%), Positives = 350/406 (86%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL EA+SGITFS DFA+ GF+CQVWG+P L+  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGNNADEVTASLSEAKSGITFSPDFAEHGFKCQVWGQPTLDPTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQ G W H+AM++AI D+ L+  +IT+ERTG+I GSGG ST+ IV AA+ TR
Sbjct: 61  DRRAMRFLSQAGAWNHVAMKQAIADAGLEASDITNERTGIIMGSGGASTRTIVEAAETTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPKAMSSTASATL+TWF+I G +YSISSAC+TSAHCIGNAAE+IQ GK
Sbjct: 121 KNVSPKRIGPFAVPKAMSSTASATLATWFQIHGVNYSISSACSTSAHCIGNAAEMIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P SASR YD  RDGFVI+GGA V+VLE
Sbjct: 181 QDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPSSASRAYDVDRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQALS+V+  VDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALSTVKGDVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD+KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ  FIGES +I
Sbjct: 301 TPVGDQKEIGAIREVFGEKIPHIQSTKSLTGHSLGAAGVQESIYGLLMMQAGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +DPEF+G+PIVRKRIDNAKIDTVLSNSFGFGGTNATLVF+RY G
Sbjct: 361 ATLDPEFEGVPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRYNG 406