BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780461|ref|YP_003064874.1| 3-oxoacyl-(acyl carrier
protein) synthase I [Candidatus Liberibacter asiaticus str. psy62]
         (406 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780461|ref|YP_003064874.1| 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040138|gb|ACT56934.1| 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 406

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/406 (100%), Positives = 406/406 (100%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI
Sbjct: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR
Sbjct: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK
Sbjct: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE
Sbjct: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA
Sbjct: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI
Sbjct: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG
Sbjct: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406


>gi|315122090|ref|YP_004062579.1| 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495492|gb|ADR52091.1| 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 406

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/406 (85%), Positives = 379/406 (93%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR+AVTGMGIVSSIGNNVSEVA +L +A+SGITFSEDFA+ GFRCQVWGKP LN AEL+
Sbjct: 1   MRRIAVTGMGIVSSIGNNVSEVATALWKAQSGITFSEDFARLGFRCQVWGKPDLNEAELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRFLSQGG WGH+AMQ+AI DS L   EITHERTGLI GSGGPSTKCIV +A LT+
Sbjct: 61  DRKAMRFLSQGGMWGHIAMQQAIADSGLDQSEITHERTGLIVGSGGPSTKCIVDSAQLTQ 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           EH +TRR+GPFAVPKAMSSTASA LSTWFKI GTSYSISSAC+TSAHCIGNAAELIQSGK
Sbjct: 121 EHLNTRRVGPFAVPKAMSSTASANLSTWFKILGTSYSISSACSTSAHCIGNAAELIQSGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFN +P +ASRPYDS+RDGFVISGGAA++V+E
Sbjct: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNDNPRAASRPYDSQRDGFVISGGAAILVME 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           EMERAKARGAKIYAEL+GYGSTCDG DMVSPSGEGA+RCMRQALSSV+ P+DYINTHGTA
Sbjct: 241 EMERAKARGAKIYAELSGYGSTCDGCDMVSPSGEGAVRCMRQALSSVQNPIDYINTHGTA 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GDKKE+EAI+EVFK +IP+IQSTKSLTGHSLGAAGAQEAIY LIMMQ+ FIGESKNI
Sbjct: 301 TLIGDKKEIEAIKEVFKDDIPHIQSTKSLTGHSLGAAGAQEAIYSLIMMQKNFIGESKNI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EEIDPEFKG+PIVRKRIDN +IDTVLSNSFGFGGTNATLVF+RYKG
Sbjct: 361 EEIDPEFKGLPIVRKRIDNVQIDTVLSNSFGFGGTNATLVFQRYKG 406


>gi|15964000|ref|NP_384353.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium meliloti
           1021]
 gi|307306412|ref|ZP_07586156.1| Beta-ketoacyl synthase [Sinorhizobium meliloti BL225C]
 gi|307319299|ref|ZP_07598728.1| Beta-ketoacyl synthase [Sinorhizobium meliloti AK83]
 gi|15073176|emb|CAC41684.1| Probable 3-oxoacyl-acyl-carrier-protein synthase I [Sinorhizobium
           meliloti 1021]
 gi|306895135|gb|EFN25892.1| Beta-ketoacyl synthase [Sinorhizobium meliloti AK83]
 gi|306902254|gb|EFN32851.1| Beta-ketoacyl synthase [Sinorhizobium meliloti BL225C]
          Length = 406

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/406 (73%), Positives = 354/406 (87%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG++  EV  SLR+ARSGITFS DFA+ GF+CQVWG P L+ ++L+
Sbjct: 1   MRRVVVTGLGIVSSIGSDADEVTASLRDARSGITFSPDFAEHGFKCQVWGAPTLDPSDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQGG W H+AM++AI DS L+  +IT+ERTG+I GSGGPST+ IV AA++TR
Sbjct: 61  DRRAMRFLSQGGAWNHVAMKQAIADSGLEAGDITNERTGIIMGSGGPSTRAIVEAAEITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPF VPKAMSSTASATL+TWF+I G +YSISSAC+TSAHCIGNAAE+IQ GK
Sbjct: 121 KNNSPKRIGPFVVPKAMSSTASATLATWFQIHGVNYSISSACSTSAHCIGNAAEMIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 181 QDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPSVASRAYDANRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V+  VDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVKGEVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD+KE+ AIREVF   +P++QSTKSLTGHSLGAAG QE+IY L+MMQ  FIGES +I
Sbjct: 301 TPVGDQKEIGAIREVFGEKMPHVQSTKSLTGHSLGAAGVQESIYGLLMMQAGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            E+DPEF+G+PIVRKRIDNAKIDTVLSNSFGFGGTNATLVF+RY G
Sbjct: 361 TELDPEFEGVPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRYNG 406


>gi|222084316|ref|YP_002542845.1| 3-oxoacyl-(acyl-carrier-protein) synthase I protein [Agrobacterium
           radiobacter K84]
 gi|221721764|gb|ACM24920.1| 3-oxoacyl-(acyl-carrier-protein) synthase I protein [Agrobacterium
           radiobacter K84]
          Length = 407

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/407 (73%), Positives = 354/407 (86%), Gaps = 1/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGN+  EV  SLREA+SGI+FS DFA+ GF+CQVWG P ++  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGNDAQEVTASLREAKSGISFSNDFAEHGFKCQVWGSPKIDTTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQGG W H+AM++A+ DS L+  +I++ERTG+I GSGGPST+ ++ AAD+TR
Sbjct: 61  DRRAMRFLSQGGAWNHVAMKQALADSGLEESDISNERTGIIMGSGGPSTRTLIEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +R+GPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+IQ GK
Sbjct: 121 KNNSPKRVGPFAVPKAMSSTASATLATWFKIYGVNYSISSACSTSAHCIGNAAEMIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHD-PCSASRPYDSRRDGFVISGGAAVIVL 239
           QD+MFAGG EDLDWTMSNLFDAMGAMSS FN D P +ASR YD+ RDGFVI+GGA V+VL
Sbjct: 181 QDVMFAGGHEDLDWTMSNLFDAMGAMSSKFNEDHPETASRAYDASRDGFVIAGGAGVLVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V+  VDYINTHGT
Sbjct: 241 EELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVKGDVDYINTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF   IP IQSTKSLTGHSLGAAG QE+IY ++MMQERFIGES +
Sbjct: 301 STPVGDSKEIGAIREVFGSKIPPIQSTKSLTGHSLGAAGVQESIYSILMMQERFIGESAH 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I E+DPEF+G+P+VRKRIDNAKID  LSNSFGFGGTNATLVF+RY G
Sbjct: 361 ITELDPEFEGVPVVRKRIDNAKIDIALSNSFGFGGTNATLVFQRYNG 407


>gi|227824079|ref|YP_002828052.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium fredii
           NGR234]
 gi|227343081|gb|ACP27299.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I, FabB [Sinorhizobium
           fredii NGR234]
          Length = 406

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/406 (74%), Positives = 350/406 (86%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL EA+SGITFS DFA+ GF+CQVWG+P L+  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGNNADEVTASLSEAKSGITFSPDFAEHGFKCQVWGQPTLDPTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQ G W H+AM++AI D+ L+  +IT+ERTG+I GSGG ST+ IV AA+ TR
Sbjct: 61  DRRAMRFLSQAGAWNHVAMKQAIADAGLEASDITNERTGIIMGSGGASTRTIVEAAETTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPKAMSSTASATL+TWF+I G +YSISSAC+TSAHCIGNAAE+IQ GK
Sbjct: 121 KNVSPKRIGPFAVPKAMSSTASATLATWFQIHGVNYSISSACSTSAHCIGNAAEMIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P SASR YD  RDGFVI+GGA V+VLE
Sbjct: 181 QDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPSSASRAYDVDRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQALS+V+  VDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALSTVKGDVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD+KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ  FIGES +I
Sbjct: 301 TPVGDQKEIGAIREVFGEKIPHIQSTKSLTGHSLGAAGVQESIYGLLMMQAGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +DPEF+G+PIVRKRIDNAKIDTVLSNSFGFGGTNATLVF+RY G
Sbjct: 361 ATLDPEFEGVPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRYNG 406


>gi|150398635|ref|YP_001329102.1| 3-oxoacyl-(acyl carrier protein) synthase I [Sinorhizobium medicae
           WSM419]
 gi|150030150|gb|ABR62267.1| Beta-ketoacyl synthase [Sinorhizobium medicae WSM419]
          Length = 406

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 301/406 (74%), Positives = 352/406 (86%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG++  EV  SLR+ARSGITFS DFA+ GF+CQVWG P L+  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGSDADEVTASLRDARSGITFSPDFAEHGFKCQVWGAPALDPTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQGG W H+AM++AI DS L+  +IT+ERTG+I GSGGPST+ IV AAD+TR
Sbjct: 61  DRRAMRFLSQGGAWNHVAMKQAIADSGLEAGDITNERTGIIMGSGGPSTRTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPKAMSSTASATL+TWF+I G +YSISSAC+TSAHCIGNAAE+IQ GK
Sbjct: 121 KNNSPKRIGPFAVPKAMSSTASATLATWFQIHGVNYSISSACSTSAHCIGNAAEMIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 181 QDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPAIASRAYDANRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+ERAKARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQAL++V   VDYINTHGT+
Sbjct: 241 ELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAARCMRQALATVNGDVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD+KE+ AIREVF   +P+IQSTKSLTGHSLGAAG QE+IY L+MMQ  FIGES +I
Sbjct: 301 TPVGDQKEIGAIREVFGEKMPHIQSTKSLTGHSLGAAGVQESIYGLLMMQAGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            E+D EF+G+PIVRKRIDNA+IDTVLSNSFGFGGTNATLVF+RY G
Sbjct: 361 TELDAEFEGVPIVRKRIDNARIDTVLSNSFGFGGTNATLVFQRYNG 406


>gi|163757758|ref|ZP_02164847.1| 3-oxoacyl-(acyl carrier protein) synthase [Hoeflea phototrophica
           DFL-43]
 gi|162285260|gb|EDQ35542.1| 3-oxoacyl-(acyl carrier protein) synthase [Hoeflea phototrophica
           DFL-43]
          Length = 407

 Score =  635 bits (1639), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 298/405 (73%), Positives = 352/405 (86%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN SEV  SLR A+SGI+FS+DFA  GFR  VWG P L+  EL+
Sbjct: 1   MRRVVVTGMGIVSSIGNNASEVTESLRNAKSGISFSQDFADHGFRSHVWGAPTLDPTELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLS+GG W H+AMQ+AI D+ +   +IT+ERTG++ GSGGPST+ ++ AAD+TR
Sbjct: 61  DRRAMRFLSRGGAWNHVAMQQAIDDAGVSEADITNERTGIVMGSGGPSTRTLIDAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPK+MSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAELIQ GK
Sbjct: 121 KNGSPKRIGPFAVPKSMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAELIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNH-DPCSASRPYDSRRDGFVISGGAAVIVL 239
           QD+MFAGG EDLDWTMSNLFDAMGAMSS +N   P +ASR YD+ RDGFVI+GGA V+VL
Sbjct: 181 QDMMFAGGHEDLDWTMSNLFDAMGAMSSKYNESSPATASRAYDTTRDGFVIAGGAGVLVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E AKARGAKIYAELTGYG+T DG DMV+PSGEGA+RCMRQAL++V+  VDY+NTHGT
Sbjct: 241 EELEHAKARGAKIYAELTGYGATSDGYDMVAPSGEGAVRCMRQALATVKGRVDYVNTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  ++PY+QSTKSLTGHSLGAAGAQEAIY L+MMQE F+GES +
Sbjct: 301 STPVGDSKEIGAIREVFADDLPYVQSTKSLTGHSLGAAGAQEAIYSLLMMQEGFVGESAH 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           I E+DPEF G+PIVR+RID+AKIDT LSNSFGFGGTNATLVF+R+
Sbjct: 361 ITELDPEFDGVPIVRERIDDAKIDTALSNSFGFGGTNATLVFQRH 405


>gi|222147156|ref|YP_002548113.1| 3-oxoacyl-(acyl carrier protein) synthase I [Agrobacterium vitis
           S4]
 gi|221734146|gb|ACM35109.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Agrobacterium vitis
           S4]
          Length = 407

 Score =  635 bits (1638), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/407 (74%), Positives = 354/407 (86%), Gaps = 1/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN +EV  SLR+ARSGI+FS DFA+ GF+CQVWG+P L+  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGNNAAEVTASLRDARSGISFSPDFAEHGFKCQVWGQPSLDTTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAADLT 119
           DR+AMRFLSQGG W H+AM++AI DS L+  + + +ERTG+I GSGGPST+ IV AAD+T
Sbjct: 61  DRRAMRFLSQGGAWNHVAMKQAIADSGLEEKDYSANERTGIIMGSGGPSTRQIVEAADIT 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+IQ G
Sbjct: 121 RQNKSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMIQWG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDIMFAGG EDLDW+MS+LFDAMGAMS+ +N  P  ASR YD+ RDGFVI+GGA V+VL
Sbjct: 181 KQDIMFAGGHEDLDWSMSDLFDAMGAMSTKYNETPALASRAYDTNRDGFVIAGGAGVLVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E AKARGAKIYAELTGYG+T DG DMV+PSGEGAIRCMRQALS+V+  VDYINTHGT
Sbjct: 241 EELEHAKARGAKIYAELTGYGATSDGYDMVAPSGEGAIRCMRQALSTVKGDVDYINTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIR VF   IP IQSTKSLTGHSLGAAG QE+IY L+MMQE FIGES +
Sbjct: 301 STPVGDSKEIGAIRTVFGDKIPPIQSTKSLTGHSLGAAGVQESIYGLLMMQEGFIGESAH 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I E+DPEF+G+P+VRKRIDNAKIDTVLSNSFGFGGTNATLVF+R+ G
Sbjct: 361 ITELDPEFEGVPVVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRHNG 407


>gi|325291592|ref|YP_004277456.1| 3-oxoacyl-acyl carrier protein synthase I [Agrobacterium sp. H13-3]
 gi|325059445|gb|ADY63136.1| 3-oxoacyl-acyl carrier protein synthase I [Agrobacterium sp. H13-3]
          Length = 407

 Score =  635 bits (1637), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 301/407 (73%), Positives = 352/407 (86%), Gaps = 1/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG + +EV  SLR+A+SGI+FS DFA+ GF+CQVWGKP L+  EL+
Sbjct: 1   MRRVVVTGLGIVSSIGGDAAEVTASLRDAKSGISFSPDFAEHGFKCQVWGKPSLDPTELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAADLT 119
           DR+AMRFLSQGG W H+AM++AI DS L+  +I+ +ERTG+I GSGGPST+ IV AAD+T
Sbjct: 61  DRRAMRFLSQGGAWNHVAMKQAIADSGLEESDISGNERTGIIMGSGGPSTRTIVEAADIT 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
            ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+IQ G
Sbjct: 121 LKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMIQWG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD+MFAGG EDLDW+MSNLFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VL
Sbjct: 181 KQDVMFAGGHEDLDWSMSNLFDAMGAMSSKYNETPNLASRAYDVNRDGFVIAGGAGVLVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQALS+V+  +DYINTHGT
Sbjct: 241 EELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALSTVKGDIDYINTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQERFIGES +
Sbjct: 301 STPVGDSKEIGAIREVFGDKIPHIQSTKSLTGHSLGAAGVQESIYGLLMMQERFIGESAH 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I E+DPEF G+PIVR RIDNAKIDT+LSNSFGFGGTNATLVF+R+ G
Sbjct: 361 ISELDPEFAGVPIVRSRIDNAKIDTILSNSFGFGGTNATLVFQRHNG 407


>gi|110636262|ref|YP_676470.1| 3-oxoacyl-(acyl carrier protein) synthase I [Mesorhizobium sp.
           BNC1]
 gi|110287246|gb|ABG65305.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Chelativorans sp.
           BNC1]
          Length = 406

 Score =  634 bits (1635), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/406 (74%), Positives = 347/406 (85%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SLREA+SGI+FS DFA+ GFRCQVWG P L+  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGNNAQEVTASLREAKSGISFSPDFAEHGFRCQVWGAPSLDPTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLS+GG W H+AM++AI DS L+  +ITHERTG+I GSGGPST+ IV AAD TR
Sbjct: 61  DRRAMRFLSKGGAWNHVAMEQAIADSGLEEQDITHERTGIIMGSGGPSTRIIVEAADTTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNA ELIQ GK
Sbjct: 121 EKGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAYELIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG EDLDWTMSNLFDAMGAMSS  N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 181 QDMIFAGGHEDLDWTMSNLFDAMGAMSSKHNDTPSTASRAYDVTRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+ SGEGA+RCMRQALS+V+  VDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVALSGEGAVRCMRQALSTVKGKVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+R+VF   IP I STKSLTGHSLGAAGAQE+IY ++MMQE FIGES +I
Sbjct: 301 TPVGDSGEIGAVRQVFGNEIPPISSTKSLTGHSLGAAGAQESIYSILMMQEGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            E+DPEF+G+PIVRKRIDNAKIDTVLSNSFGFGGTNATLVF+RY G
Sbjct: 361 TELDPEFEGVPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRYAG 406


>gi|159184184|ref|NP_353185.2| 3-oxoacyl-(acyl carrier protein) synthase I [Agrobacterium
           tumefaciens str. C58]
 gi|159139516|gb|AAK85970.2| 3-oxoacyl-(acyl-carrier-protein) synthase [Agrobacterium
           tumefaciens str. C58]
          Length = 407

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 298/407 (73%), Positives = 352/407 (86%), Gaps = 1/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG + +EV  SLR+A+SGI+FS DFA+ GF+CQVWGKP L+  +L+
Sbjct: 1   MRRVVVTGLGIVSSIGGDAAEVTASLRQAKSGISFSPDFAEHGFKCQVWGKPSLDPTDLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAADLT 119
           DR+AMRFLSQGG W H+AM++AI DS L+  +I+ +ERTG+I GSGGPST+ IV AAD+T
Sbjct: 61  DRRAMRFLSQGGAWNHVAMKQAIADSGLEESDISGNERTGIIMGSGGPSTRTIVEAADIT 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
            ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+IQ G
Sbjct: 121 LKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMIQWG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD+MFAGG EDLDW+MSNLFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VL
Sbjct: 181 KQDVMFAGGHEDLDWSMSNLFDAMGAMSSKYNETPGVASRAYDVNRDGFVIAGGAGVLVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQAL++V+  +DYINTHGT
Sbjct: 241 EELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALATVKGDIDYINTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQERFIGES +
Sbjct: 301 STPVGDSKEIGAIREVFGDKIPHIQSTKSLTGHSLGAAGVQESIYGLLMMQERFIGESAH 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I E+DPEF G+PIVR RID+AKIDT+LSNSFGFGGTNATLVF+R+ G
Sbjct: 361 ISELDPEFAGVPIVRSRIDDAKIDTILSNSFGFGGTNATLVFQRHNG 407


>gi|209551628|ref|YP_002283545.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209537384|gb|ACI57319.1| Beta-ketoacyl synthase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 410

 Score =  627 bits (1617), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 299/410 (72%), Positives = 352/410 (85%), Gaps = 4/410 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           MRRV VTG+GIVSSIGN+ +EV  SLR+A+SGI+FS DFA+ GF+CQVWG P L AAEL 
Sbjct: 1   MRRVVVTGLGIVSSIGNDAAEVTESLRQAKSGISFSSDFAEHGFKCQVWGSPKLGAAELA 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAA 116
             +DR+AMRFLSQGG W H+AM++A+ DS L+  +   +ERTG+I GSGGPST+ ++ AA
Sbjct: 61  ELVDRRAMRFLSQGGAWNHVAMKQALADSGLEEKDYAQNERTGIIMGSGGPSTRTLIEAA 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D+T ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+I
Sbjct: 121 DITVKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMI 180

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P SASR YD  RDGFVI+GGA V
Sbjct: 181 QWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNRDGFVIAGGAGV 240

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +VLEE+ERAKARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQAL++V+  VDY+NT
Sbjct: 241 LVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALATVKGDVDYVNT 300

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ+ FIGE
Sbjct: 301 HGTSTPVGDSKEIGAIREVFGAKIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGE 360

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           S +I E+DPEF+G+PIVRKRID+AKID  LSNSFGFGGTNATLVF+RY G
Sbjct: 361 SAHITELDPEFEGVPIVRKRIDDAKIDIALSNSFGFGGTNATLVFQRYNG 410


>gi|241207061|ref|YP_002978157.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240860951|gb|ACS58618.1| Beta-ketoacyl synthase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 410

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 296/410 (72%), Positives = 352/410 (85%), Gaps = 4/410 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           MRRV VTG+G+VSSIGN+ +EV  SLR+A+SGI+FS DFA+ GF+CQVWG P L +AEL 
Sbjct: 1   MRRVVVTGLGVVSSIGNDAAEVTESLRQAKSGISFSSDFAEHGFKCQVWGSPKLGSAELA 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAA 116
             +DR+AMRFLSQGG W H+AM++A+ DS L+  +   +ERTG+I GSGGPST+ ++ AA
Sbjct: 61  ELVDRRAMRFLSQGGAWNHVAMKQALADSGLEEKDYAQNERTGIIMGSGGPSTRTLIEAA 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           ++T ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+I
Sbjct: 121 EITIKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMI 180

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P SASR YD  RDGFVI+GGA V
Sbjct: 181 QWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNRDGFVIAGGAGV 240

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +VLEE+ERAKARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQAL++V+  VDY+NT
Sbjct: 241 LVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALATVKGDVDYVNT 300

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ+ FIGE
Sbjct: 301 HGTSTPVGDSKEIGAIREVFGSKIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGE 360

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           S +I E+DPEF+G+PIVRKRID+AKID  LSNSFGFGGTNATLVF+RY G
Sbjct: 361 SAHITELDPEFEGVPIVRKRIDDAKIDIALSNSFGFGGTNATLVFQRYNG 410


>gi|86355768|ref|YP_467660.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhizobium etli CFN 42]
 gi|86279870|gb|ABC88933.1| 3-oxoacyl-(acyl-carrier-protein) synthase I protein [Rhizobium etli
           CFN 42]
          Length = 410

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 298/410 (72%), Positives = 350/410 (85%), Gaps = 4/410 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           MRRV VTG+GIVSSIG++ +EV  SLR+A+SGI+FS DFA+ GF+CQVWG P L  AEL 
Sbjct: 1   MRRVVVTGLGIVSSIGSDAAEVTESLRQAKSGISFSNDFAEHGFKCQVWGSPKLGPAELG 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAA 116
             +DR+AMRFLSQGG W H+AM++AI DS L+  +   +ER G+I GSGGPST+ ++ AA
Sbjct: 61  ELVDRRAMRFLSQGGAWNHVAMKQAIADSGLEEKDYAQNERAGIIMGSGGPSTRTLIEAA 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D+T ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+I
Sbjct: 121 DITVKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMI 180

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V
Sbjct: 181 QWGKQDMMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDTASRAYDVNRDGFVIAGGAGV 240

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +VLEE+ERAKARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQALS+V+  VDYINT
Sbjct: 241 LVLEELERAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALSTVKGDVDYINT 300

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ+ FIGE
Sbjct: 301 HGTSTPVGDSKEIGAIREVFGAKIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGE 360

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           S +I E+DPEF+G+PIVR+RIDNAKID  LSNSFGFGGTNATLVF+RY G
Sbjct: 361 SAHIAELDPEFEGVPIVRQRIDNAKIDIALSNSFGFGGTNATLVFQRYNG 410


>gi|190889776|ref|YP_001976318.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Rhizobium etli CIAT 652]
 gi|190695055|gb|ACE89140.1| 3-oxoacyl-[acyl-carrier-protein] synthase protein [Rhizobium etli
           CIAT 652]
          Length = 410

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 296/410 (72%), Positives = 349/410 (85%), Gaps = 4/410 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           MRRV VTG+GIVSSIG++ +EV  SLR+A+SGI+FS DFA+ GF+CQVWG P L  AEL 
Sbjct: 1   MRRVVVTGLGIVSSIGSDAAEVTESLRQAKSGISFSNDFAEHGFKCQVWGSPKLGPAELA 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAA 116
             +DR+AMRFLSQGG W H+AM++AI DS L+  +   +ER G+I GSGGPST+ ++ AA
Sbjct: 61  ELVDRRAMRFLSQGGAWNHVAMKQAIADSGLEEKDYAQNERAGIIMGSGGPSTRTLIEAA 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D+T ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+I
Sbjct: 121 DITVKNNSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMI 180

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQD+MFAGG EDLDWTMSNLFDAMGAMSS +N  P SASR YD  RDGFVI+GGA V
Sbjct: 181 QWGKQDVMFAGGHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNRDGFVIAGGAGV 240

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +VLEE+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V+  VDYINT
Sbjct: 241 LVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVKGDVDYINT 300

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ+ FIGE
Sbjct: 301 HGTSTPVGDSKEIGAIREVFGARIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGE 360

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           S +I E+DPEF+G+PIVRKRIDNAKID  LSNSFGFGGTNATLVF+R+ G
Sbjct: 361 SAHISELDPEFEGVPIVRKRIDNAKIDIALSNSFGFGGTNATLVFQRHNG 410


>gi|319779760|ref|YP_004139236.1| beta-ketoacyl synthase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165648|gb|ADV09186.1| Beta-ketoacyl synthase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 406

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 293/404 (72%), Positives = 344/404 (85%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN +EV  SL +ARSGI+FS+ FA+ GFRCQVWG P L+ + +I
Sbjct: 1   MRRVVVTGLGIVSSIGNNANEVQASLHDARSGISFSDSFAEHGFRCQVWGAPTLDPSAMI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQG  W H+AM +AI D+ L   +IT+ERTG++ GSGGPST+ IV AA+ T 
Sbjct: 61  DRRAMRFLSQGAAWNHVAMDQAIADAGLGESDITNERTGIVMGSGGPSTRTIVEAAETTL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGN  ELIQ GK
Sbjct: 121 KNGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNGYELIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG EDLDWTMS+LFDAMGAMSS FN    +ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 181 QDIVFAGGHEDLDWTMSDLFDAMGAMSSKFNDKASTASRAYDANRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V  PVDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVSTPVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF   +PYI STKSLTGHSLGAAG QE+IY ++MMQ  FIGES +I
Sbjct: 301 TPVGDSKEMGAIREVFGPEMPYITSTKSLTGHSLGAAGVQESIYSILMMQGGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +DPEF+G+PIVRKRID+A+IDTVLSNSFGFGGTNATLVF+RY
Sbjct: 361 ETLDPEFEGMPIVRKRIDDARIDTVLSNSFGFGGTNATLVFQRY 404


>gi|13474638|ref|NP_106207.1| 3-oxoacyl-(acyl carrier protein) synthase I [Mesorhizobium loti
           MAFF303099]
 gi|14025392|dbj|BAB51993.1| beta-ketoacyl-ACP synthase I [Mesorhizobium loti MAFF303099]
          Length = 406

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 293/404 (72%), Positives = 343/404 (84%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN +EV  SL +ARSGI+FS+ FA+ GFRCQVWG P L+ + +I
Sbjct: 1   MRRVVVTGLGIVSSIGNNANEVQTSLHDARSGISFSDSFAEHGFRCQVWGAPTLDPSAMI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQG  W H+AM +AI D+ L   +IT+ERTG++ GSGGPST+ IV AA+ T 
Sbjct: 61  DRRAMRFLSQGAAWNHVAMDQAIADAGLGESDITNERTGIVMGSGGPSTRTIVEAAETTL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGN  ELIQ GK
Sbjct: 121 KNGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNGYELIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG EDLDWTMS+LFDAMGAMSS FN    +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 181 QDMVFAGGHEDLDWTMSDLFDAMGAMSSKFNDRASAASRAYDVNRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V  PVDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVSTPVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF   +P+I STKSLTGHSLGAAG QE+IY ++MMQ  FIGES +I
Sbjct: 301 TPVGDSKEMGAIREVFGEKMPFITSTKSLTGHSLGAAGVQESIYSILMMQGGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +DPEF+G+PIVRKRIDNAKIDTVLSNSFGFGGTNATLVF+RY
Sbjct: 361 ETLDPEFEGMPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRY 404


>gi|260461971|ref|ZP_05810216.1| Beta-ketoacyl synthase [Mesorhizobium opportunistum WSM2075]
 gi|259032218|gb|EEW33484.1| Beta-ketoacyl synthase [Mesorhizobium opportunistum WSM2075]
          Length = 406

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 292/404 (72%), Positives = 343/404 (84%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN +EV  SL +ARSGI+FS+ FA+ GFRCQVWG P L+ + +I
Sbjct: 1   MRRVVVTGIGIVSSIGNNANEVQTSLHDARSGISFSDSFAEHGFRCQVWGAPTLDPSAMI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFLSQG  W H+AM +AI D+ L   ++T+ERTG++ GSGGPST+ IV AA+ T 
Sbjct: 61  DRRAMRFLSQGAAWNHVAMDQAIADAGLGEDDVTNERTGIVMGSGGPSTRTIVEAAETTL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +RIGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGN  ELIQ GK
Sbjct: 121 KNGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNGYELIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG EDLDWTMS+LFDAMGAMSS FN    +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 181 QDMVFAGGHEDLDWTMSDLFDAMGAMSSKFNDKASTASRAYDVNRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQA+S++  PVDYINTHGT+
Sbjct: 241 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQAMSTISTPVDYINTHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF   +P+I STKSLTGHSLGAAG QE+IY ++MMQ  FIGES +I
Sbjct: 301 TPVGDSKEMGAIREVFGEKMPFITSTKSLTGHSLGAAGVQESIYSILMMQGGFIGESAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +DPEF+G+PIVRKRIDNAKIDTVLSNSFGFGGTNATLVF+RY
Sbjct: 361 ETLDPEFEGMPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFQRY 404


>gi|116249883|ref|YP_765721.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115254531|emb|CAK05605.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (EC 2.3.1.41)
           (Beta-ketoacyl-ACP synthase I) (KAS I) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 399

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 287/399 (71%), Positives = 342/399 (85%), Gaps = 4/399 (1%)

Query: 12  VSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL---IDRKAMRFL 68
           +SSIGN+ +EV  SLR+A+SGI+FS DFA+ GF+CQVWG P L +AEL   +DR+AMRFL
Sbjct: 1   MSSIGNDAAEVTESLRQAKSGISFSSDFAEHGFKCQVWGSPKLGSAELAELVDRRAMRFL 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEIT-HERTGLIAGSGGPSTKCIVSAADLTREHCSTRR 127
           SQGG W H+AM++A+ DS L+  +   +ERTG+I GSGGPST+ ++ AA++T ++ S +R
Sbjct: 61  SQGGAWNHVAMKQALADSGLEEKDYAQNERTGIIMGSGGPSTRTLIEAAEITIKNNSPKR 120

Query: 128 IGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAG 187
           IGPFAVPKAMSSTASATL+TWFKI G +YSISSAC+TSAHCIGNAAE+IQ GKQD+MFAG
Sbjct: 121 IGPFAVPKAMSSTASATLATWFKIHGVNYSISSACSTSAHCIGNAAEMIQWGKQDVMFAG 180

Query: 188 GQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKA 247
           G EDLDWTMSNLFDAMGAMSS +N  P SASR YD  RDGFVI+GGA V+VLEE+ERAKA
Sbjct: 181 GHEDLDWTMSNLFDAMGAMSSKYNDTPDSASRAYDVNRDGFVIAGGAGVLVLEELERAKA 240

Query: 248 RGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKK 307
           RGAKIYAE+ GYG+T DG DMV+PSGEGAIRCMRQAL++V+  VDY+NTHGT+TP GD K
Sbjct: 241 RGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMRQALATVKGDVDYVNTHGTSTPVGDSK 300

Query: 308 EVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEF 367
           E+ AIREVF   IP+IQSTKSLTGHSLGAAG QE+IY L+MMQ+ FIGES +I E+DPEF
Sbjct: 301 EIGAIREVFGSKIPHIQSTKSLTGHSLGAAGVQESIYSLLMMQQGFIGESAHITELDPEF 360

Query: 368 KGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +G+PIVRKRID+AKID  LSNSFGFGGTNATLVF+RY G
Sbjct: 361 EGVPIVRKRIDDAKIDIALSNSFGFGGTNATLVFQRYNG 399


>gi|154244011|ref|YP_001414969.1| 3-oxoacyl-(acyl carrier protein) synthase I [Xanthobacter
           autotrophicus Py2]
 gi|154158096|gb|ABS65312.1| Beta-ketoacyl synthase [Xanthobacter autotrophicus Py2]
          Length = 407

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 278/405 (68%), Positives = 322/405 (79%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGN+  EV  SLREA+SGI+F+ED AK GFRCQV G P LNA E++
Sbjct: 1   MRRVVVTGMGIVSSIGNSTQEVLASLREAKSGISFAEDQAKLGFRCQVQGAPTLNAEEVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI DS L+P E+++ RTG++ GSGGPST+ IV AAD+ R
Sbjct: 61  DRRAMRFHGGGTAWNHVAMDQAIRDSGLEPSEVSNPRTGIVMGSGGPSTRTIVEAADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E IQ GK
Sbjct: 121 TK-GPKRIGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEQIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+S+LFDAMGAMSS FN  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVVFAGGCEELDWTLSSLFDAMGAMSSKFNATPHKASRAYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR ALS+V  P+DYIN H T+
Sbjct: 240 ELEHAKARGAKIYGEVAGYGATSDGYDMVAPSGEGAERCMRMALSTVNLPIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR+VF      P I +TKSLTGHSLGA G QEAIYCL+MMQ  FI ES 
Sbjct: 300 TPAGDPPEIEAIRKVFGVGEKCPPISATKSLTGHSLGATGVQEAIYCLLMMQNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NIEE+DP F  +PIVR R DN K+  VLSNSFGFGGTNA+LVF+ 
Sbjct: 360 NIEELDPVFADMPIVRARQDNVKLGAVLSNSFGFGGTNASLVFKH 404


>gi|146337236|ref|YP_001202284.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bradyrhizobium sp.
           ORS278]
 gi|146190042|emb|CAL74034.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (Beta-ketoacyl-ACP
           synthase I) (KAS I) [Bradyrhizobium sp. ORS278]
          Length = 407

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/405 (67%), Positives = 327/405 (80%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSSIGNN  EV  SL EA+SGI+ +E +A+ GFR QV G P LN AE++
Sbjct: 1   MRRVVITGMGIVSSIGNNTQEVLASLYEAKSGISRAEKYAELGFRSQVQGAPTLNPAEVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++AI DS L+P ++++ RTG+I GSGGPST+ +V AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQAILDSGLEPTDVSNVRTGIIMGSGGPSTRTLVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS  N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELDWTLSVLFDAMGAMSSKHNETPATASRPYDVSRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+ERAKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ ALS+V+  +DYIN H T+
Sbjct: 240 ELERAKARGAKIYGEIVGYGATSDGYDMVAPSGEGAERCMQMALSTVKTRIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR+VF      P I +TK+LTGHSLGA G QEAIY L+MM+  FI ES 
Sbjct: 300 TPAGDPPEIEAIRKVFGSGEKCPPIAATKALTGHSLGATGVQEAIYSLLMMKNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI E+DP F  +PIVR+RIDNAK+ TVLSNSFGFGGTNATLVF+ 
Sbjct: 360 NITELDPVFADMPIVRRRIDNAKLGTVLSNSFGFGGTNATLVFKH 404


>gi|239833221|ref|ZP_04681550.1| 3-oxoacyl-(acyl carrier protein) synthase I [Ochrobactrum
           intermedium LMG 3301]
 gi|239825488|gb|EEQ97056.1| 3-oxoacyl-(acyl carrier protein) synthase I [Ochrobactrum
           intermedium LMG 3301]
          Length = 407

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 330/408 (80%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGNNTEEVTASLREAKSGISRAEEYAELGFRCQVHGAPNIDVEALV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E++++RTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLADEEVSNDRTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAFEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V+  +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVKTKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR+VF      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQVFGSGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDNA+++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNAQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|256045776|ref|ZP_05448654.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|260563071|ref|ZP_05833557.1| beta-ketoacyl synthase [Brucella melitensis bv. 1 str. 16M]
 gi|265992192|ref|ZP_06104749.1| beta-ketoacyl synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260153087|gb|EEW88179.1| beta-ketoacyl synthase [Brucella melitensis bv. 1 str. 16M]
 gi|263003258|gb|EEZ15551.1| beta-ketoacyl synthase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 407

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 331/408 (81%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+N  EV  SLREA+SGI+ +E++AK GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGSNTEEVTASLREAKSGISRAEEYAKLGFRCQVHGAPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF-KGNI-PYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F  G++ P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDVCPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|292659757|pdb|3LRF|A Chain A, Crystal Structure Of Beta-Ketoacyl Synthase From Brucella
           Melitensis
 gi|297787758|pdb|3MQD|A Chain A, Crystal Structure Of Beta-Ketoacyl Synthase From Brucella
           Me With Fol 0758, (1-Methyl-1h-Indazol-3-Yl) Methanol
          Length = 428

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/408 (66%), Positives = 331/408 (81%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+N  EV  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 22  MRRVVVTGMGIVSSIGSNTEEVTASLREAKSGISRAEEYAELGFRCQVHGAPDIDIESLV 81

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 82  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 141

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 142 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 200

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 201 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 260

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 261 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 320

Query: 301 TPKGDKKEVEAIREVF-KGNI-PYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F  G++ P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 321 TPAGDAPEIEAIRQIFGAGDVCPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 380

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 381 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 428


>gi|17988240|ref|NP_540874.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella melitensis
           bv. 1 str. 16M]
 gi|17984007|gb|AAL53138.1| 3-oxoacyl-(acyl-carrier-protein) synthase i [Brucella melitensis
           bv. 1 str. 16M]
          Length = 407

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/408 (66%), Positives = 331/408 (81%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+N  EV  S+REA+SGI+ +E++AK GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGSNTEEVTASVREAKSGISRAEEYAKLGFRCQVHGAPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF-KGNI-PYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F  G++ P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDVCPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|62291008|ref|YP_222801.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus bv. 1
           str. 9-941]
 gi|82700919|ref|YP_415493.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella melitensis
           biovar Abortus 2308]
 gi|189025222|ref|YP_001935990.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus S19]
 gi|225853596|ref|YP_002733829.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella melitensis
           ATCC 23457]
 gi|237816511|ref|ZP_04595504.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus str.
           2308 A]
 gi|254690304|ref|ZP_05153558.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus bv. 6
           str. 870]
 gi|254694792|ref|ZP_05156620.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus bv. 3
           str. Tulya]
 gi|254696421|ref|ZP_05158249.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254731333|ref|ZP_05189911.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus bv. 4
           str. 292]
 gi|256112496|ref|ZP_05453417.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella melitensis
           bv. 3 str. Ether]
 gi|256258557|ref|ZP_05464093.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus bv. 9
           str. C68]
 gi|256264959|ref|ZP_05467491.1| beta-ketoacyl synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|260546272|ref|ZP_05822012.1| beta-ketoacyl synthase [Brucella abortus NCTC 8038]
 gi|260755843|ref|ZP_05868191.1| beta-ketoacyl synthase [Brucella abortus bv. 6 str. 870]
 gi|260759066|ref|ZP_05871414.1| beta-ketoacyl synthase [Brucella abortus bv. 4 str. 292]
 gi|260760792|ref|ZP_05873135.1| beta-ketoacyl synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884868|ref|ZP_05896482.1| beta-ketoacyl synthase [Brucella abortus bv. 9 str. C68]
 gi|261215118|ref|ZP_05929399.1| beta-ketoacyl synthase [Brucella abortus bv. 3 str. Tulya]
 gi|265993932|ref|ZP_06106489.1| beta-ketoacyl synthase [Brucella melitensis bv. 3 str. Ether]
 gi|297247395|ref|ZP_06931113.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Brucella abortus bv. 5
           str. B3196]
 gi|62197140|gb|AAX75440.1| FabB, 3-oxoacyl-(acyl-carrier-protein) synthase I [Brucella abortus
           bv. 1 str. 9-941]
 gi|82617020|emb|CAJ12129.1| Beta-ketoacyl synthase [Brucella melitensis biovar Abortus 2308]
 gi|189020794|gb|ACD73516.1| Beta-ketoacyl synthase [Brucella abortus S19]
 gi|225641961|gb|ACO01875.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237788578|gb|EEP62793.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella abortus str.
           2308 A]
 gi|260096379|gb|EEW80255.1| beta-ketoacyl synthase [Brucella abortus NCTC 8038]
 gi|260669384|gb|EEX56324.1| beta-ketoacyl synthase [Brucella abortus bv. 4 str. 292]
 gi|260671224|gb|EEX58045.1| beta-ketoacyl synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675951|gb|EEX62772.1| beta-ketoacyl synthase [Brucella abortus bv. 6 str. 870]
 gi|260874396|gb|EEX81465.1| beta-ketoacyl synthase [Brucella abortus bv. 9 str. C68]
 gi|260916725|gb|EEX83586.1| beta-ketoacyl synthase [Brucella abortus bv. 3 str. Tulya]
 gi|262764913|gb|EEZ10834.1| beta-ketoacyl synthase [Brucella melitensis bv. 3 str. Ether]
 gi|263095443|gb|EEZ19044.1| beta-ketoacyl synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|297174564|gb|EFH33911.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Brucella abortus bv. 5
           str. B3196]
 gi|326410171|gb|ADZ67236.1| Beta-ketoacyl synthase [Brucella melitensis M28]
 gi|326539889|gb|ADZ88104.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 407

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/408 (66%), Positives = 331/408 (81%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+N  EV  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGSNTEEVTASLREAKSGISRAEEYAELGFRCQVHGAPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF-KGNI-PYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F  G++ P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDVCPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|92115673|ref|YP_575402.1| 3-oxoacyl-(acyl carrier protein) synthase I [Nitrobacter
           hamburgensis X14]
 gi|91798567|gb|ABE60942.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Nitrobacter
           hamburgensis X14]
          Length = 407

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/405 (67%), Positives = 326/405 (80%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+SGIT ++ +A+ GFR QV G P LN A++I
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLSSLFEAKSGITRADKYAELGFRSQVQGAPTLNPADVI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL++G  W H+AM++AI DS L+P +I++ERTG+I GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLAEGAAWNHVAMEQAIRDSGLEPTDISNERTGIIMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E IQ GK
Sbjct: 121 SK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAFETIQIGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW++S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRAYDVSRDGFVIAGGAGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA RCMR A+S+V+  VDYIN H T+
Sbjct: 240 ELEHAKARGARIYGEVVGYGATSDGYDMVAPSGEGAERCMRMAMSTVKTKVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR+VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 300 TPAGDPPEIEAIRKVFGTGEKCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI E+DP F  +PIVRKRIDNA++ TV+SNSFGFGGTNATLVF+R
Sbjct: 360 NITELDPAFADMPIVRKRIDNARVGTVMSNSFGFGGTNATLVFKR 404


>gi|306843589|ref|ZP_07476190.1| 3-oxoacyl-acyl carrier protein synthase I [Brucella sp. BO1]
 gi|306276280|gb|EFM57980.1| 3-oxoacyl-acyl carrier protein synthase I [Brucella sp. BO1]
          Length = 407

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/408 (66%), Positives = 327/408 (80%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGNNTEEVTASLREAKSGISRAEEYAELGFRCQVHGAPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ RTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNARTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|254718210|ref|ZP_05180021.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella sp. 83/13]
 gi|265983167|ref|ZP_06095902.1| beta-ketoacyl synthase [Brucella sp. 83/13]
 gi|306839950|ref|ZP_07472744.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella sp. NF 2653]
 gi|264661759|gb|EEZ32020.1| beta-ketoacyl synthase [Brucella sp. 83/13]
 gi|306404914|gb|EFM61199.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella sp. NF 2653]
          Length = 407

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/408 (66%), Positives = 328/408 (80%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  +V  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGNNTEKVTASLREAKSGISRAEEYAELGFRCQVHGAPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSNVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|23503019|ref|NP_699146.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella suis 1330]
 gi|148559582|ref|YP_001259965.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella ovis ATCC
           25840]
 gi|161620080|ref|YP_001593967.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella canis ATCC
           23365]
 gi|163844185|ref|YP_001628590.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella suis ATCC
           23445]
 gi|225626536|ref|ZP_03784575.1| Beta-ketoacyl synthase [Brucella ceti str. Cudo]
 gi|254700803|ref|ZP_05162631.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella suis bv. 5
           str. 513]
 gi|254705171|ref|ZP_05166999.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella suis bv. 3
           str. 686]
 gi|254709147|ref|ZP_05170958.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella pinnipedialis
           B2/94]
 gi|254713428|ref|ZP_05175239.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella ceti
           M644/93/1]
 gi|254716215|ref|ZP_05178026.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella ceti
           M13/05/1]
 gi|256030672|ref|ZP_05444286.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella pinnipedialis
           M292/94/1]
 gi|256158673|ref|ZP_05456556.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella ceti
           M490/95/1]
 gi|256254077|ref|ZP_05459613.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella ceti B1/94]
 gi|256370567|ref|YP_003108078.1| 3-oxoacyl-(acyl carrier protein) synthase [Brucella microti CCM
           4915]
 gi|260169576|ref|ZP_05756387.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella sp. F5/99]
 gi|260567361|ref|ZP_05837831.1| beta-ketoacyl synthase [Brucella suis bv. 4 str. 40]
 gi|261217989|ref|ZP_05932270.1| beta-ketoacyl synthase [Brucella ceti M13/05/1]
 gi|261221218|ref|ZP_05935499.1| beta-ketoacyl synthase [Brucella ceti B1/94]
 gi|261316646|ref|ZP_05955843.1| beta-ketoacyl synthase [Brucella pinnipedialis B2/94]
 gi|261321161|ref|ZP_05960358.1| beta-ketoacyl synthase [Brucella ceti M644/93/1]
 gi|261751311|ref|ZP_05995020.1| beta-ketoacyl synthase [Brucella suis bv. 5 str. 513]
 gi|261755876|ref|ZP_05999585.1| beta-ketoacyl synthase [Brucella suis bv. 3 str. 686]
 gi|261759103|ref|ZP_06002812.1| beta-ketoacyl synthase [Brucella sp. F5/99]
 gi|265987718|ref|ZP_06100275.1| beta-ketoacyl synthase [Brucella pinnipedialis M292/94/1]
 gi|265997179|ref|ZP_06109736.1| beta-ketoacyl synthase [Brucella ceti M490/95/1]
 gi|294851397|ref|ZP_06792070.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Brucella sp. NVSL
           07-0026]
 gi|23349060|gb|AAN31061.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Brucella suis 1330]
 gi|148370839|gb|ABQ60818.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Brucella ovis ATCC
           25840]
 gi|161336891|gb|ABX63196.1| Hypothetical protein BCAN_A2214 [Brucella canis ATCC 23365]
 gi|163674908|gb|ABY39019.1| Hypothetical protein BSUIS_A2009 [Brucella suis ATCC 23445]
 gi|225618193|gb|EEH15236.1| Beta-ketoacyl synthase [Brucella ceti str. Cudo]
 gi|256000730|gb|ACU49129.1| 3-oxoacyl-(acyl carrier protein) synthase [Brucella microti CCM
           4915]
 gi|260156879|gb|EEW91959.1| beta-ketoacyl synthase [Brucella suis bv. 4 str. 40]
 gi|260919802|gb|EEX86455.1| beta-ketoacyl synthase [Brucella ceti B1/94]
 gi|260923078|gb|EEX89646.1| beta-ketoacyl synthase [Brucella ceti M13/05/1]
 gi|261293851|gb|EEX97347.1| beta-ketoacyl synthase [Brucella ceti M644/93/1]
 gi|261295869|gb|EEX99365.1| beta-ketoacyl synthase [Brucella pinnipedialis B2/94]
 gi|261739087|gb|EEY27083.1| beta-ketoacyl synthase [Brucella sp. F5/99]
 gi|261741064|gb|EEY28990.1| beta-ketoacyl synthase [Brucella suis bv. 5 str. 513]
 gi|261745629|gb|EEY33555.1| beta-ketoacyl synthase [Brucella suis bv. 3 str. 686]
 gi|262551647|gb|EEZ07637.1| beta-ketoacyl synthase [Brucella ceti M490/95/1]
 gi|264659915|gb|EEZ30176.1| beta-ketoacyl synthase [Brucella pinnipedialis M292/94/1]
 gi|294819986|gb|EFG36985.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Brucella sp. NVSL
           07-0026]
          Length = 407

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/408 (66%), Positives = 328/408 (80%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+N  EV  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGSNTEEVTASLREAKSGISRAEEYAELGFRCQVHGAPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|75674232|ref|YP_316653.1| 3-oxoacyl-(acyl carrier protein) synthase I [Nitrobacter
           winogradskyi Nb-255]
 gi|74419102|gb|ABA03301.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Nitrobacter
           winogradskyi Nb-255]
          Length = 407

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/405 (67%), Positives = 326/405 (80%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGN+  EV  SL EA+SGIT +E +A+ GFR QV G P LN A+++
Sbjct: 1   MRRVVVTGMGIVSSIGNSTQEVLSSLFEAKSGITRAEKYAELGFRSQVQGAPTLNPADVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL++G  W H+AM++AI DS L+P E+++ERTG+I GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLAEGAAWNHVAMEQAIRDSGLEPNEVSNERTGIIMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E IQ GK
Sbjct: 121 SK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYETIQIGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW++S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRAYDVSRDGFVIAGGAGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA RCMR ALS+V+  VDYIN H T+
Sbjct: 240 ELEHAKARGARIYGEVAGYGATSDGYDMVAPSGEGAERCMRMALSTVKTKVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR+VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 300 TPAGDPPEIEAIRKVFGAGDKCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI E+DP F  +PIVRKRID+A+I TV+SNSFGFGGTNATLVF+R
Sbjct: 360 NITELDPVFADMPIVRKRIDDARIGTVMSNSFGFGGTNATLVFKR 404


>gi|85714166|ref|ZP_01045155.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrobacter sp. Nb-311A]
 gi|85699292|gb|EAQ37160.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrobacter sp. Nb-311A]
          Length = 407

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/405 (67%), Positives = 326/405 (80%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+SGIT +E +A+ GFR QV G P LN A++I
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLSSLFEAKSGITRAEKYAELGFRSQVQGAPTLNPADVI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL++G  W H+AM++AI DS L+P +I++ERTG+I GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLAEGAAWNHVAMEQAIRDSGLEPSDISNERTGIIMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +Y+ISSACATS HCIGNA E IQ GK
Sbjct: 121 SK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYTISSACATSNHCIGNAYETIQIGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW++S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRAYDVSRDGFVIAGGAGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA RCMR A+S+V+  VDYIN H T+
Sbjct: 240 ELEHAKARGARIYGEIVGYGATSDGYDMVAPSGEGAERCMRMAMSTVKTKVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR+VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 300 TPAGDPPEIEAIRKVFGTGDKCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI E+DP F  +PIVRKRID+A+I TV+SNSFGFGGTNATLVF+R
Sbjct: 360 NITELDPVFADMPIVRKRIDDARIGTVMSNSFGFGGTNATLVFKR 404


>gi|153008076|ref|YP_001369291.1| 3-oxoacyl-(acyl carrier protein) synthase I [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559964|gb|ABS13462.1| Beta-ketoacyl synthase [Ochrobactrum anthropi ATCC 49188]
          Length = 407

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/408 (66%), Positives = 329/408 (80%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLREA+SGI+ +E++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGNNTEEVTASLREAKSGISRAEEYAELGFRCQVHGAPNIDVEALV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E++++RTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLSEEEVSNDRTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAFEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V+  +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVKGKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E++AIR+VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 300 TPAGDAPEIDAIRQVFGSGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMHNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDNA+++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNAQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|209883651|ref|YP_002287508.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Oligotropha
           carboxidovorans OM5]
 gi|209871847|gb|ACI91643.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Oligotropha
           carboxidovorans OM5]
          Length = 439

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/405 (67%), Positives = 321/405 (79%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+ GIT +E++AK GFR QV G P LN AE +
Sbjct: 33  MRRVVVTGMGIVSSIGNNTQEVLASLHEAKPGITRAEEYAKLGFRSQVQGAPTLNPAEFV 92

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL++G  W H+AM +AI DS L+  ++++ERTG+I GSGGPS + IV AAD TR
Sbjct: 93  DRRAMRFLAEGAAWNHVAMDQAIRDSGLEETDVSNERTGIIMGSGGPSARTIVEAADTTR 152

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 153 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEMIQYGK 211

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 212 QDVMFAGGCEELDWSLSVLFDAMGAMSSKYNDTPSTASRAYDVNRDGFVIAGGAGVVVLE 271

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR ALS+V+  +DYIN H T+
Sbjct: 272 ELEHAKARGAKIYGEIVGYGATSDGYDMVAPSGEGAERCMRMALSTVKASIDYINPHATS 331

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+ AIR VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 332 TPAGDPPEINAIRHVFGVGDKCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICESA 391

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI+E+DP F  +PIVRKRID+AKI  VLSNSFGFGGTNATLVF+R
Sbjct: 392 NIQELDPVFADMPIVRKRIDDAKIGAVLSNSFGFGGTNATLVFKR 436


>gi|296448467|ref|ZP_06890349.1| Beta-ketoacyl synthase [Methylosinus trichosporium OB3b]
 gi|296254019|gb|EFH01164.1| Beta-ketoacyl synthase [Methylosinus trichosporium OB3b]
          Length = 407

 Score =  561 bits (1445), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 274/405 (67%), Positives = 323/405 (79%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLREARSGI  ++ +A+ GFRCQV G P L+ + ++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVVASLREARSGIVKADKYAELGFRCQVHGAPTLDPSTIV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF + G  W H+AM +AI D+ L   +I++ER+G+I GSGGPSTK +V +AD+ R
Sbjct: 61  DRRAMRFHAMGTAWNHVAMDQAILDAGLGAEDISNERSGIIMGSGGPSTKVVVESADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E IQ GK
Sbjct: 121 TK-GPKRIGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAFEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L+W +S LFDAMGAMSS FN  P +ASR YD  RDGFVI GGA V+VLE
Sbjct: 180 QDLMFAGGCEELEWELSVLFDAMGAMSSSFNDRPATASRAYDKNRDGFVIGGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E ERAKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V+ P+DYIN H T+
Sbjct: 240 EYERAKARGAKIYAEIAGYGATSDGHDMVAPSGEGAVRCMRQALATVKTPIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD KE+EAIREVF G    P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPVGDLKEIEAIREVFGGGDKSPPISATKSLTGHSLGATGVQEAIYSLLMMQNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NIEE+DPEF  +PI+R+R DN  +  VLSNSFGFGGTNATLVF+ 
Sbjct: 360 NIEELDPEFSDMPILRERRDNVALRAVLSNSFGFGGTNATLVFKH 404


>gi|256060131|ref|ZP_05450313.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella neotomae
           5K33]
 gi|261324109|ref|ZP_05963306.1| beta-ketoacyl synthase [Brucella neotomae 5K33]
 gi|261300089|gb|EEY03586.1| beta-ketoacyl synthase [Brucella neotomae 5K33]
          Length = 407

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/408 (66%), Positives = 328/408 (80%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+N  EV  SLREA+SGI+ ++++A+ GFRCQV G P ++   L+
Sbjct: 1   MRRVVVTGMGIVSSIGSNTEEVTASLREAKSGISRAKEYAELGFRCQVHGTPDIDIESLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L   E+++ERTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIADAGLTEEEVSNERTGIIMGSGGPSTRTIVDSADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+
Sbjct: 240 DLETALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TPAGDAPEIEAIRQIFGAGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +IEE+DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 360 HIEELDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 407


>gi|299133363|ref|ZP_07026558.1| Beta-ketoacyl synthase [Afipia sp. 1NLS2]
 gi|298593500|gb|EFI53700.1| Beta-ketoacyl synthase [Afipia sp. 1NLS2]
          Length = 407

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/405 (67%), Positives = 323/405 (79%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+ GIT +E++AK GFR QV G P LN AE++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHEAKPGITRAEEYAKLGFRSQVQGAPTLNPAEVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL++G  W H+AM++AI DS L+  ++++ RTG+I GSGGPS + IV AAD TR
Sbjct: 61  DRRAMRFLAEGAAWNHVAMEQAIRDSGLEESDVSNVRTGIIMGSGGPSARTIVEAADTTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L W++S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELHWSLSVLFDAMGAMSSKYNDTPSTASRAYDVNRDGFVIAGGAGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA RCMR ALS+V+  +DYIN H T+
Sbjct: 240 ELEHAKARGARIYGEIVGYGATSDGYDMVAPSGEGAERCMRMALSTVKGQIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+ AIR+VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 300 TPAGDPPEINAIRKVFGVGDKCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI+E+DP F  +PIVRKRIDNAK+ TVLSNSFGFGGTNATLVF+R
Sbjct: 360 NIQELDPVFADMPIVRKRIDNAKVGTVLSNSFGFGGTNATLVFKR 404


>gi|27375881|ref|NP_767410.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bradyrhizobium
           japonicum USDA 110]
 gi|27349019|dbj|BAC46035.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Bradyrhizobium
           japonicum USDA 110]
          Length = 407

 Score =  554 bits (1428), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/405 (66%), Positives = 322/405 (79%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+SGI+ +E +A+ GFR QV G P L+ A ++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHEAKSGISRAEKYAELGFRSQVQGAPTLDPATVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL QG  W H+AM++AI DS L P ++++ RTG+I GSGGPS + IV +AD+TR
Sbjct: 61  DRRAMRFLGQGAAWNHIAMEQAILDSGLSPEDVSNIRTGIIMGSGGPSARTIVESADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HC+GNA E IQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCVGNAYETIQIGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA RCMR A+S+V+  VDYIN H T+
Sbjct: 240 ELEHAKARGARIYGEIVGYGATSDGYDMVAPSGEGAERCMRMAMSTVKTKVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EA+R+VF      P I +TK+LTGHSLGA G QEAIY L+MM   FI ES 
Sbjct: 300 TPAGDPPEIEALRKVFGVGEKCPPISATKALTGHSLGATGVQEAIYSLLMMNNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +I+E+DP F  +PIVRKRIDN KI TVLSNSFGFGGTNATLVF R
Sbjct: 360 HIQELDPVFADMPIVRKRIDNVKIGTVLSNSFGFGGTNATLVFSR 404


>gi|115522284|ref|YP_779195.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhodopseudomonas
           palustris BisA53]
 gi|115516231|gb|ABJ04215.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodopseudomonas
           palustris BisA53]
          Length = 408

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 271/406 (66%), Positives = 322/406 (79%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+SGIT +E  A+ GFR QV+G P LN+A+L+
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHEAKSGITRAEKHAELGFRSQVYGLPTLNSADLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM +A+ DS L+  +I++ RTG++ GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMDQALLDSGLEQDDISNIRTGIVMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA ELIQ GK
Sbjct: 121 TK-GPKRIGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++SNLFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELDWSLSNLFDAMGAMSSKYNDTPATASRPYDVSRDGFVIAGGAGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ AL +     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKMALETTGGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E++A+R VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPELQALRNVFGTGDKCPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI E+DP F  +PIVRKR+DNAK+  VLSNSFGFGGTNATLVF+R
Sbjct: 360 ANITELDPAFADMPIVRKRVDNAKLGAVLSNSFGFGGTNATLVFKR 405


>gi|328541687|ref|YP_004301796.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [polymorphum gilvum
           SL003B-26A1]
 gi|326411439|gb|ADZ68502.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Polymorphum gilvum
           SL003B-26A1]
          Length = 405

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/404 (65%), Positives = 325/404 (80%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG+   EV  SLRE RSGI  ++++A  GFRCQV G P L+ +E++
Sbjct: 1   MRRVVVTGMGIVSSIGDTTQEVLASLREGRSGIVRAQEYADIGFRCQVHGAPKLDPSEVL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+  RF+  G  W ++AMQ+AI DS L+  ++T+ERTG+I GSGGPST+ IV AAD+ R
Sbjct: 61  DRRTTRFMGDGAAWNYIAMQQAIQDSGLEDGDVTNERTGIIMGSGGPSTRAIVQAADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP AVPKAMSST SATL+T FKI G +YSIS+ACAT+  CIGNAAELIQ GK
Sbjct: 121 EK-GPKRIGPTAVPKAMSSTNSATLATPFKIHGVNYSISAACATTNICIGNAAELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +ASRPYD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDIVFAGGGEELDWTLSVLFDAMGAMSSKYNDTPATASRPYDANRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IYAE+ GYG+T DG DMV+PSGEGA RCM+ ALS+V+ PVDYIN H T+
Sbjct: 240 ELEHAKARGARIYAEIVGYGATSDGYDMVAPSGEGAQRCMKLALSTVDCPVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIR VF   IP I +TK+LTGHSLGAAG QEAIY ++MMQ RFI  S +I
Sbjct: 300 TPVGDAKEIEAIRAVFGDKIPPISATKALTGHSLGAAGVQEAIYSILMMQNRFIAPSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +DPEF  +PIVR+R+DN +++ VLSN FGFGGTNAT+VF+++
Sbjct: 360 ETLDPEFADVPIVRERVDNVELNCVLSNGFGFGGTNATVVFKKF 403


>gi|170740468|ref|YP_001769123.1| 3-oxoacyl-(acyl carrier protein) synthase I [Methylobacterium sp.
           4-46]
 gi|168194742|gb|ACA16689.1| Beta-ketoacyl synthase [Methylobacterium sp. 4-46]
          Length = 408

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/406 (66%), Positives = 324/406 (79%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRVA+TGMGIVSSIGN   EV  SLREARSGIT +E FA  GFRCQV G P L+   ++
Sbjct: 1   MRRVAITGMGIVSSIGNTTQEVLASLREARSGITRAEPFAAHGFRCQVQGAPTLDPETVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM++AI D+ L+  E++HERTG+I GSGGPST  IV AAD+ R
Sbjct: 61  DRRAMRFHGGGTAWNHVAMEQAIRDAGLEESEVSHERTGIIMGSGGPSTHAIVEAADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNAAE+IQ+G+
Sbjct: 121 AK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAAEIIQAGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMS+ +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWTLSVLFDAMGAMSAKYNDTPARASRAYDAARDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE-EPVDYINTHGT 299
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQAL  ++   +DYIN H T
Sbjct: 240 ELEHAKARGARIYGEIAGYGATSDGHDMVAPSGEGAVRCMRQALEGLKGVKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD+KE+EAIREVF    + P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDEKEIEAIREVFGSGESCPPIAATKSLTGHSLGATGVQEAIYSLLMMNNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NIEE+DP F  +PI+R+R+D+A++  VLSNSFGFGGTNATLV + 
Sbjct: 360 ANIEELDPAFADMPILRRRVDDARLGHVLSNSFGFGGTNATLVLKH 405


>gi|220920427|ref|YP_002495728.1| 3-oxoacyl-(acyl carrier protein) synthase I [Methylobacterium
           nodulans ORS 2060]
 gi|219945033|gb|ACL55425.1| Beta-ketoacyl synthase [Methylobacterium nodulans ORS 2060]
          Length = 408

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/406 (65%), Positives = 325/406 (80%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRVA+TGMGIVSSIGNN  EV  SLREARSGIT +E FA  GFRCQV G P L+   ++
Sbjct: 1   MRRVAITGMGIVSSIGNNTQEVLASLREARSGITHAESFAAHGFRCQVQGAPTLDPESVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM++AI D+ L+  E++HERTG+I GSGGPST+ IV AAD+ R
Sbjct: 61  DRRAMRFHGGGTAWNHVAMEQAIRDAGLEEREVSHERTGIIMGSGGPSTRAIVEAADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAM STASATL+TWFKI+G +YSISSACATS HCIGNAAE+IQ+G+
Sbjct: 121 AK-GPKRVGPFAVPKAMCSTASATLATWFKIKGVNYSISSACATSNHCIGNAAEIIQAGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMS+ +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWTLSVLFDAMGAMSAKYNDTPARASRAYDAGRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE-EPVDYINTHGT 299
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQAL+ ++   +DYIN H T
Sbjct: 240 ELEHAKARGARIYGEIAGYGATSDGHDMVAPSGEGAVRCMRQALAGLKGVTIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD KE+EAIREVF    + P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDDKEIEAIREVFGTGDSCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            +I+E+DP F  +PI+R+R+D+A++  VLSNSFGFGGTNATL+ + 
Sbjct: 360 AHIDELDPAFADMPILRRRVDDARLGHVLSNSFGFGGTNATLILKH 405


>gi|39933503|ref|NP_945779.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhodopseudomonas
           palustris CGA009]
 gi|39647349|emb|CAE25870.1| beta-ketoacyl-ACP synthase I [Rhodopseudomonas palustris CGA009]
          Length = 408

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 269/408 (65%), Positives = 321/408 (78%), Gaps = 4/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL +A+SGI+ +E  A+ GFR QV G P LN A+++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFRSQVQGAPTLNPADVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++AI DS L+  EI++ RTG++ GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQAIADSGLEESEISNIRTGIVMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA ELIQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ ALS+     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKMALSTTGGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E+ AIR VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPEMNAIRAVFGIGDKCPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            +I E+DP F  +PIVRKR+DNAK+  VLSNSFGFGGTNATLVF+R +
Sbjct: 360 AHITELDPAFADMPIVRKRVDNAKLGAVLSNSFGFGGTNATLVFKRLE 407


>gi|316931657|ref|YP_004106639.1| beta-ketoacyl synthase [Rhodopseudomonas palustris DX-1]
 gi|315599371|gb|ADU41906.1| Beta-ketoacyl synthase [Rhodopseudomonas palustris DX-1]
          Length = 408

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/408 (65%), Positives = 321/408 (78%), Gaps = 4/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL +A+ GI+ +E  A+ GFR QV G P LN A+++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLYDAKPGISRAEKHAELGFRSQVQGAPTLNPADVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++AI DS L+  EI++ERTG++ GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQAIADSGLEESEISNERTGIVMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA ELIQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDISRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ AL++     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKMALATTGGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E+ A+R VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPEINALRNVFGAGDKCPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            NI E+DP F  +PIVRKR++NAK+  VLSNSFGFGGTNATLVF+R +
Sbjct: 360 ANITELDPVFADMPIVRKRVENAKLGAVLSNSFGFGGTNATLVFKRLE 407


>gi|91974703|ref|YP_567362.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhodopseudomonas
           palustris BisB5]
 gi|91681159|gb|ABE37461.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodopseudomonas
           palustris BisB5]
          Length = 408

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/406 (66%), Positives = 320/406 (78%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL +A+SGI+ +E  A+ GFR QV G P LN A+++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFRSQVQGLPSLNPADVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++A+ DS L+  +I++ RTG++ GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQALADSGLEESDISNPRTGIVMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA ELIQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDVSRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ ALS+     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKMALSTTGGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E+ A+R VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPEINALRNVFGAGDKCPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI E+DP F  +PIVRKRIDNAKI  VLSNSFGFGGTNATLVF+R
Sbjct: 360 ANITELDPAFADMPIVRKRIDNAKIGAVLSNSFGFGGTNATLVFKR 405


>gi|319407995|emb|CBI81649.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella
           schoenbuchensis R1]
          Length = 406

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/406 (64%), Positives = 324/406 (79%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI+SSIGN +  V  SLREA+SGI+++ ++A+ GFR +V+ KP +N  EL+
Sbjct: 1   MRRVVVTGMGIISSIGNGLQTVLTSLREAKSGISYAPEYAELGFRSRVYAKPNVNIEELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+P E+++E TG+I GSGGPST+ IV AAD+TR
Sbjct: 61  DRRAMRFHGYGTAWNHIAMDQAIADAGLEPSEVSNEHTGIIMGSGGPSTRSIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPF VPKAMSSTA+ATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-GPKRVGPFVVPKAMSSTAAATLATFFKIKGVNYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q+ +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QNRVFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPEKASRAYDINRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR AL++V+  +DYIN H TA
Sbjct: 240 ELEVAKARGAKIYGEIVGYGATSDGHDMVAPSGEGAERCMRMALATVKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR++F      P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TPIGDPPEIEAIRQIFGTGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PIVRKR D+ +++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPAFADMPIVRKRRDHQELNTVLSNTFGFGGTNATLVFQRY 405


>gi|192288861|ref|YP_001989466.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhodopseudomonas
           palustris TIE-1]
 gi|192282610|gb|ACE98990.1| Beta-ketoacyl synthase [Rhodopseudomonas palustris TIE-1]
          Length = 408

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/408 (65%), Positives = 321/408 (78%), Gaps = 4/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL +A+SGI+ +E  A+ GFR QV G P LN A+++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFRSQVQGAPTLNPADVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++AI DS L+  EI++ RTG++ GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQAIADSGLEESEISNIRTGIVMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA ELIQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ AL++     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKMALATTGGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E+ AIR VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPEMNAIRAVFGIGDKCPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            +I E+DP F  +PIVRKR+DNAK+  VLSNSFGFGGTNATLVF+R +
Sbjct: 360 AHITELDPAFADMPIVRKRVDNAKLGAVLSNSFGFGGTNATLVFKRLE 407


>gi|319406527|emb|CBI80169.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella sp. 1-1C]
          Length = 406

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/406 (65%), Positives = 321/406 (79%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI+S+IGN +  V  SL EA+SG+ ++   A+ GFR +V+ KP +N  E +
Sbjct: 1   MRRVVVTGMGIISAIGNELQTVLTSLYEAKSGVCYAPKHAELGFRSRVYAKPSINIEEFV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W  +AM  AITD+ L+P E+++E TG+I GSGGPST+ IV AADLTR
Sbjct: 61  DRRAMRFHGYGTAWNQIAMDRAITDAGLEPNEVSNEYTGIIMGSGGPSTRSIVEAADLTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-GPKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q+ +FAGG EDLDWT+S LFDAMGAMSS +NH P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QNRIFAGGCEDLDWTLSVLFDAMGAMSSKYNHTPETASRAYDINRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMVSPSGEGA RCMR AL++++  +DYIN H TA
Sbjct: 240 ELELAKARGAKIYGEIVGYGATSDGHDMVSPSGEGAERCMRMALATIKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T  GD  E++AIR +F G    P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TIVGDSSEIDAIRRIFGGGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PIVRKR+DN K++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPAFSDMPIVRKRLDNQKLNTVLSNTFGFGGTNATLVFQRY 405


>gi|90421872|ref|YP_530242.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhodopseudomonas
           palustris BisB18]
 gi|90103886|gb|ABD85923.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodopseudomonas
           palustris BisB18]
          Length = 408

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 269/406 (66%), Positives = 320/406 (78%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL EA+ GIT ++ FA+ GFR QV G P LN A+ +
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHEAKPGITRADKFAELGFRSQVQGAPTLNPADTV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++AI DS L+  +I++ RTG+I GSGGPS + IV AAD+TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQAIQDSGLEQDDISNIRTGIIMGSGGPSARTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E+IQ  K
Sbjct: 121 SK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEMIQWNK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA VIVLE
Sbjct: 180 QDVVFAGGCEELDWSLSVLFDAMGAMSSKYNATPSTASRPYDVSRDGFVIAGGAGVIVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ AL++     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKMALATTNGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E++A+R VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPEMQALRAVFGTGEACPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI E+DP F  +PIVRKRIDNAK+ TVLSNSFGFGGTNATLVF+R
Sbjct: 360 ANITELDPVFADMPIVRKRIDNAKVGTVLSNSFGFGGTNATLVFKR 405


>gi|49474946|ref|YP_032987.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bartonella henselae
           str. Houston-1]
 gi|49237751|emb|CAF26943.1| 3-oxoacyl-[acyl-carrier-protein ] synthase I [Bartonella henselae
           str. Houston-1]
          Length = 406

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 265/406 (65%), Positives = 324/406 (79%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS+IGNN   V  SL EA+SGI+++  +AK GFR +V+GKP +N  EL+
Sbjct: 1   MRRVVVTGMGIVSAIGNNPGTVLTSLYEAKSGISYAPQYAKLGFRSRVYGKPDINIEELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A+RF  +G  W H+AM +AI D+ L+P E+++E TG+I GSGG ST+ IV AAD+TR
Sbjct: 61  DRRALRFHGRGTAWNHIAMDQAIADAGLEPHEVSNEHTGIIMGSGGASTQSIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  S +R+GPF VPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-SPKRVGPFVVPKAMSSTASATLATFFKIKGVNYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDRIFAGGCEDLDWTLSVLFDAMGAMSSKYNDVPEKASRAYDAHRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR AL++V+  +DYIN H TA
Sbjct: 240 ELECAKARGAKIYGEIVGYGATSDGHDMVAPSGEGAERCMRMALATVKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR +F      P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TPVGDPPEIEAIRRIFGAGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PIVR+R D+ +++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPAFADMPIVRERRDHQQLNTVLSNTFGFGGTNATLVFQRY 405


>gi|240849799|ref|YP_002971187.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bartonella grahamii
           as4aup]
 gi|240266922|gb|ACS50510.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bartonella grahamii
           as4aup]
          Length = 406

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/407 (65%), Positives = 322/407 (79%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS+IGN    V  SLREA+SGI+++  +A+ GFR +V+GKP +N  EL+
Sbjct: 1   MRRVVVTGMGIVSAIGNGPEAVLTSLREAKSGISYAPQYAQLGFRSRVYGKPDINIEELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A+RF  +G  W H+AM +AI D+ L+P E+++E TG+I GSGG ST  IV AAD+TR
Sbjct: 61  DRRALRFHGRGTAWNHIAMDQAIADAGLEPHEVSNEHTGIIMGSGGASTHSIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +RIGPF VPK MSSTASATL+T+FKI+G +YSISSACATS HCIGNA E IQ GK
Sbjct: 121 QK-GPKRIGPFVVPKVMSSTASATLATFFKIKGVNYSISSACATSNHCIGNAYETIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDRIFAGGCEDLDWTLSVLFDAMGAMSSKYNDVPEKASRAYDANRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMVSPSGEGA RCMR AL++V+  +DYIN H TA
Sbjct: 240 ELEVAKARGAKIYGEIVGYGATSDGHDMVSPSGEGAERCMRMALATVKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR +F      P I +TKSLTGHSLGAAG QEAIY L+MMQ  FI ES 
Sbjct: 300 TPVGDPPEIEAIRRIFGAGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMQHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +IEE+DP F  +PIVRKR D+ +++TVLSN+FGFGGTNATLVF+RY+
Sbjct: 360 HIEELDPAFADMPIVRKRRDHQQLNTVLSNTFGFGGTNATLVFQRYE 406


>gi|49473798|ref|YP_031840.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bartonella quintana
           str. Toulouse]
 gi|49239301|emb|CAF25627.1| 3-oxoacyl-[acyl-carrier-protein ] synthase I [Bartonella quintana
           str. Toulouse]
          Length = 406

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 263/406 (64%), Positives = 323/406 (79%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS+IGNN   V  SL EA+SGI+++  +A+ GFR +V+GKP +N  EL+
Sbjct: 1   MRRVVVTGMGIVSAIGNNPQAVLTSLHEAKSGISYASQYAELGFRSRVYGKPDINIEELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A+RF  +G  W H+AM +AI D+ L+P E+++E TG+I GSGG ST  IV AAD+TR
Sbjct: 61  DRRALRFHGRGTAWNHIAMDQAIADAGLEPHEVSNEHTGIIMGSGGASTLSIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  + +R+GPF VPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-NPKRVGPFVVPKAMSSTASATLATFFKIKGVNYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDRIFAGGCEDLDWTLSVLFDAMGAMSSKYNDVPEKASRAYDTHRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR AL++V+  +DYIN H TA
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMRMALATVKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR +F      P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TPVGDPPEIEAIRRIFGTGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PIVR+R D+ +++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPAFADMPIVRERRDHQQLNTVLSNTFGFGGTNATLVFQRY 405


>gi|323135703|ref|ZP_08070786.1| Beta-ketoacyl synthase [Methylocystis sp. ATCC 49242]
 gi|322398794|gb|EFY01313.1| Beta-ketoacyl synthase [Methylocystis sp. ATCC 49242]
          Length = 407

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 266/405 (65%), Positives = 319/405 (78%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGN   EV  SLREA+SGI  +E +A+ GFR QV G P L+ + ++
Sbjct: 1   MRRVVVTGMGIVSSIGNTTQEVVASLREAKSGIVRAEKYAELGFRSQVHGMPTLDPSTVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF + G  W H+AM +AI D+ L   EI++ERTG+I GSGGPST+ IV AAD+TR
Sbjct: 61  DRRAMRFHATGTAWNHVAMDQAIRDAGLTEAEISNERTGIIMGSGGPSTRTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPK MSSTASATL+ WFKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 SK-GPKRVGPFAVPKCMSSTASATLAVWFKIKGVNYSISSACATSNHCIGNAYEMIQHGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L+W +S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDMIFAGGCEELEWELSVLFDAMGAMSSAYNDRPATASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQALS+V+  +DYIN H TA
Sbjct: 240 EYEHAKARGAKIYAEVAGYGATSDGYDMVAPSGEGAVRCMRQALSTVKCSIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD KE+EA+REVF      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI +S 
Sbjct: 300 TPVGDAKEIEALREVFGVGDKCPPIAATKSLTGHSLGATGVQEAIYSLLMMQNGFICKSA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +IEE+DP+F  +PI+ +R DN K+  VLSNSFGFGGTNATLVF+ 
Sbjct: 360 HIEELDPDFADMPILLERRDNVKLGAVLSNSFGFGGTNATLVFKH 404


>gi|86747738|ref|YP_484234.1| 3-oxoacyl-(acyl carrier protein) synthase I [Rhodopseudomonas
           palustris HaA2]
 gi|86570766|gb|ABD05323.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodopseudomonas
           palustris HaA2]
          Length = 408

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 266/406 (65%), Positives = 320/406 (78%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SL +A+SGIT +E  A+ GFR QV G P LN A+++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGITRAEKHAELGFRSQVQGLPSLNPADVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL +G  W H+AM++A+ DS L+  +I++ RTG++ GSGGPS + IV AAD TR
Sbjct: 61  DRRAMRFLGEGAAWNHVAMEQALADSGLEEKDISNPRTGIVMGSGGPSARTIVEAADTTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA ELIQ GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW++S LFDAMGAMSS +N  P +ASRPYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDVSRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCM+ AL++     +DYIN H T
Sbjct: 240 ELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMQMALATTGGIKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD  E++A+R VF      P I +TK+LTGHSLGA G QEAIY L+MMQ  FI ES
Sbjct: 300 STPAGDPPELQALRNVFGVGDKCPPISATKALTGHSLGATGVQEAIYSLLMMQNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI E+DP F  +PIVRKRIDNA++  VLSNSFGFGGTNATLVF+R
Sbjct: 360 ANITELDPAFADMPIVRKRIDNAQLGAVLSNSFGFGGTNATLVFKR 405


>gi|254472336|ref|ZP_05085736.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudovibrio sp.
           JE062]
 gi|211958619|gb|EEA93819.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudovibrio sp.
           JE062]
          Length = 405

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 263/405 (64%), Positives = 316/405 (78%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS +GNN  EV  SL E +SGI  +ED+ K GFRCQV G P L+  E +
Sbjct: 1   MRRVVVTGMGIVSPLGNNAEEVKQSLYEGKSGIVAAEDYKKLGFRCQVHGAPNLDPLEAL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            R+  RF+  G  W ++AM++AI D+ L    +T+ERTGLI GSGGPSTK IV AAD+TR
Sbjct: 61  GRRTARFMGAGAAWNYMAMEQAIEDAGLSEDLVTNERTGLIMGSGGPSTKAIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RRIGP AVPKAMSST SATL+T FKI G +YSIS+ACAT+  CIGNA ELIQ GK
Sbjct: 121 EK-GPRRIGPTAVPKAMSSTNSATLATPFKIHGVNYSISAACATTNICIGNAFELIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+SNLFDAMGAMSS +N  P +ASRPYD  RDGFVI+GG  V+VLE
Sbjct: 180 QDVVFAGGGEELDWTLSNLFDAMGAMSSKYNDTPSTASRPYDKNRDGFVIAGGGGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG T DG DMV+PSGEGA RCM+ AL  V+  VDYIN H T+
Sbjct: 240 ELEHAKARGAKIYAEIVGYGQTSDGHDMVAPSGEGAARCMKIALKDVDCDVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIR VF   +P I +TK+L+GHSLGAAG  EAIY L+MM+  FI  S +I
Sbjct: 300 TPVGDIKEIEAIRAVFGDKVPPISATKALSGHSLGAAGVHEAIYSLLMMEGNFIAASAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+DP+F+ +PIVR+R+DNA+++ VLSN FGFGGTNAT+VF+RYK
Sbjct: 360 EELDPDFEDMPIVRERVDNAELNCVLSNGFGFGGTNATVVFKRYK 404


>gi|312115316|ref|YP_004012912.1| beta-ketoacyl synthase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220445|gb|ADP71813.1| Beta-ketoacyl synthase [Rhodomicrobium vannielii ATCC 17100]
          Length = 405

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 260/404 (64%), Positives = 319/404 (78%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRVAVTGMGI+SSIGNN  EV  SLRE RSGI  ++D+A+ GFRCQV G+P ++    I
Sbjct: 1   MRRVAVTGMGIISSIGNNTQEVVASLREGRSGIVKAKDYAERGFRCQVHGEPTIDWEAAI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  W ++AMQ+AI D+ L+  ++++ERTGLI GSGGPST+ IV+AAD TR
Sbjct: 61  DRKVRRFMGAGAGWNYIAMQQAIADAGLEDKDVSNERTGLIMGSGGPSTRAIVAAADTTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    R++GPF VPKAMSST SATL+T F+I+G +YSISSAC+TSAHCIGNAAE+I  GK
Sbjct: 121 EK-GPRKVGPFEVPKAMSSTNSATLATPFRIKGINYSISSACSTSAHCIGNAAEMIAWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS+FN  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGGEELDWTLSVLFDAMGAMSSNFNDTPTKASRAYDANRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+ERAKARG+ IY EL G+ +  DG DMV+PSGEGA RCMR A+  ++  VDYIN H T+
Sbjct: 240 ELERAKARGSNIYGELVGFCANSDGYDMVAPSGEGAARCMRVAMKGLDRKVDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD KE+EA+REVF    P + +TKSLTGHSLGAAG QEAIY L+MM   F+ ES NI
Sbjct: 300 TVIGDLKEIEAVREVFGSKAPLLSATKSLTGHSLGAAGVQEAIYSLLMMNNGFVCESANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
            E+DP F  +PIVR+R+DN +++ V+SNSFGFGGTNATL+F RY
Sbjct: 360 VELDPAFSDMPIVRERLDNVELNCVMSNSFGFGGTNATLIFNRY 403


>gi|148251691|ref|YP_001236276.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bradyrhizobium sp.
           BTAi1]
 gi|146403864|gb|ABQ32370.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Bradyrhizobium sp.
           BTAi1]
          Length = 399

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 263/397 (66%), Positives = 315/397 (79%), Gaps = 3/397 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGIVSSIGNN  EV  SL EA+SGI+ +E +A+ GFR QV G P LN A+++DR+AMRFL
Sbjct: 1   MGIVSSIGNNTQEVLASLYEAKSGISRAEKYAELGFRSQVQGAPTLNPADVVDRRAMRFL 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
            +G  W H+AM++AI D+ L+P ++++ RTG+I GSGGPST+  V AAD+TR     +R+
Sbjct: 61  GEGAAWNHVAMEQAILDAGLEPSDVSNVRTGIIMGSGGPSTRTQVEAADITRTK-GPKRV 119

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GPFAVPK MSSTASATL+TWFKI+G +YSISSACATS HCIGNA E+IQ GKQD+MFAGG
Sbjct: 120 GPFAVPKCMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEMIQYGKQDMMFAGG 179

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+LDWT+S LFDAMGAMSS  N  P +ASRPYD  RDGFVI+GGA V+VLEE+E AKAR
Sbjct: 180 CEELDWTLSVLFDAMGAMSSKHNDTPATASRPYDVTRDGFVIAGGAGVLVLEELEHAKAR 239

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GAKIY E+ GYG+T DG DMV+PSGEGA RCM+ ALS+V   VDYIN H T+TP GD  E
Sbjct: 240 GAKIYGEIVGYGATSDGYDMVAPSGEGAERCMQMALSTVRTKVDYINPHATSTPAGDPPE 299

Query: 309 VEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPE 366
           +EAIR+VF      P I +TK+LTGHSLGA G  EAIY L+MM+  FI ES +I E+DP 
Sbjct: 300 IEAIRKVFGSGEKCPPIAATKALTGHSLGATGVHEAIYSLLMMKNGFICESAHITELDPM 359

Query: 367 FKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           F  +PIVRKRIDNAK+ TVLSNSFGFGGTNATLVF+ 
Sbjct: 360 FADMPIVRKRIDNAKLGTVLSNSFGFGGTNATLVFKH 396


>gi|182677329|ref|YP_001831475.1| Beta-ketoacyl synthase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633212|gb|ACB93986.1| Beta-ketoacyl synthase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 407

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 316/404 (78%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGN   EV  SLREA+SGI  +E +A+ GFR QV G P L+ + ++
Sbjct: 1   MRRVVVTGMGIVSSIGNTSQEVLASLREAKSGIVRAERYAELGFRSQVHGAPTLDPSAML 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF + G  W H+AM +AI D+ L+P ++++ RTG+I GSGGPST+ IV +AD+TR
Sbjct: 61  DRRAMRFHAGGTAWNHVAMDQAILDAGLEPSDVSNPRTGIIMGSGGPSTRTIVESADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +++GPFAVPKAMSSTASATL+TWFKI+G +YSISSACATS HCIGNA E+I+ GK
Sbjct: 121 DK-GPKKVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACATSNHCIGNAYEMIRYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAM++ +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEELDWTLSVLFDAMGAMAAAYNDRPAVASRAYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++ERAKARGAKIY E+ GYG T DG DMV+PSGEGA+RCMR AL  V  P+DYIN H T+
Sbjct: 240 DLERAKARGAKIYGEIVGYGLTSDGHDMVAPSGEGAVRCMRMALEDVNIPIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T  GD KE+EAIREVF      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES 
Sbjct: 300 TGVGDLKEIEAIREVFGAGDKSPPIAATKSLTGHSLGATGVQEAIYSLLMMQNGFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
           NIEE+DP F  + IVR R DN  +  VLSNSFGFGGTNATLVF+
Sbjct: 360 NIEELDPAFADMDIVRHRRDNVSLRAVLSNSFGFGGTNATLVFK 403


>gi|16127949|ref|NP_422513.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Caulobacter crescentus
           CB15]
 gi|221236771|ref|YP_002519208.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Caulobacter crescentus
           NA1000]
 gi|13425487|gb|AAK25681.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Caulobacter crescentus
           CB15]
 gi|220965944|gb|ACL97300.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Caulobacter crescentus
           NA1000]
          Length = 403

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 260/404 (64%), Positives = 315/404 (77%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SLREA+SG+  + ++A+ GFRCQV   P ++   ++
Sbjct: 1   MRRVVVTGLGIVSSIGNNAHEVLASLREAKSGVIAAPEYAELGFRCQVHAAPQIDWEAMV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A RFL+ G  + H+AM++AI DS L   E++HERTGLI GSGGPST+ I+ AA +TR
Sbjct: 61  DRRAARFLAPGTAYAHIAMEQAIADSGLSETELSHERTGLIVGSGGPSTRVIIDAAAITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGPFAVPKAMSS  SA LSTWFKIRG +YSISSACATSAHCIG AAE IQ GK
Sbjct: 121 EK-GPKRIGPFAVPKAMSSGPSAVLSTWFKIRGINYSISSACATSAHCIGAAAEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW++SNLFDAMGAMSS+FN  P  ASR YD  RDGFVI+GGA ++VLE
Sbjct: 180 QDVVFAGGCEELDWSLSNLFDAMGAMSSNFNDRPAVASRAYDKNRDGFVIAGGAGIVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E ERAKARGAKIY E+ GY +  DG DMV+PSGEGA RCMR A++      +DY+N HGT
Sbjct: 240 EYERAKARGAKIYGEVVGYAANSDGYDMVAPSGEGAARCMRLAMAEAGNRAIDYLNPHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ A+REVF    P I STKSLTGHSLGAAGAQEAIY ++M+   F  ES N
Sbjct: 300 STPVGDSKEMGAVREVFGDKAPMISSTKSLTGHSLGAAGAQEAIYSILMLNNDFAAESAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IEE+DPEF  +PI+R+R+D   ++TV+SNSFGFGGTN TL+F R
Sbjct: 360 IEELDPEFADLPILRQRVDK-PLETVMSNSFGFGGTNGTLIFSR 402


>gi|319403610|emb|CBI77195.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella rochalimae
           ATCC BAA-1498]
          Length = 406

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 318/406 (78%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M RV VTGMGI+S+IGN +  V  SL EA+SG+ ++   A+ GFR +V+ KP +N  E +
Sbjct: 1   MHRVVVTGMGIISAIGNELQTVLTSLYEAKSGVCYAPKHAELGFRSRVYAKPNINIEEFV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W  +AM  AI D+ L+P E+++E TG+I GSGGPST+ IV AADLTR
Sbjct: 61  DRRAMRFHGYGTAWNQIAMDRAIADAGLEPNEVSNEYTGIIMGSGGPSTRSIVEAADLTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPF VPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-GPKRVGPFVVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q+ +FAGG EDLDWT+S LFDAMGAMSS +N+ P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QNRIFAGGCEDLDWTLSVLFDAMGAMSSKYNNTPETASRAYDINRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMVSPSGEGA RCMR AL++++  +DYIN H TA
Sbjct: 240 ELELAKARGAKIYGEIVGYGATSDGHDMVSPSGEGAERCMRMALATIKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T  GD  E++AIR +F G    P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TIVGDSSEIDAIRRIFGGGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PIVRKR+DN K++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPAFSDMPIVRKRLDNQKLNTVLSNTFGFGGTNATLVFQRY 405


>gi|90420513|ref|ZP_01228420.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (FabB) [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335241|gb|EAS48994.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (FabB) [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 405

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 267/403 (66%), Positives = 323/403 (80%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTGMGIVSSIGNNV EV  SLR+ARSGI+F+E++ + GFR  V GKP L+   ++
Sbjct: 1   MKRVVVTGMGIVSSIGNNVDEVTASLRDARSGISFAEEYKELGFRSHVHGKPTLDPTTVL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  +I++ERTG+I GSGG ST+ IV AA+  R
Sbjct: 61  DRRAMRFHGGGTAWNHIAMDQAIADAGLEAADISNERTGIIMGSGGASTQTIVQAAETAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP AVPKAMSSTASATL+TWFKI+G +YSISSAC+TS+HCIGNA E IQ GK
Sbjct: 121 EK-GPKRIGPTAVPKAMSSTASATLATWFKIKGVNYSISSACSTSSHCIGNAYETIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG EDL WT+S LFDAMGA+SS FN  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDVMFAGGCEDLHWTLSVLFDAMGALSSDFNDRPEIASRAYDNARDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E ERAKARGA I AEL GYG+T DG DMV+PSGEGA+RCMRQA+  ++ P+DYIN H T+
Sbjct: 240 EYERAKARGANIVAELVGYGATSDGADMVAPSGEGAVRCMRQAIDHLDGPIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD+ EV+AIREVF  NIP I  TKSLTGHS GA G  EAIY L+MM+  F+ +S +I
Sbjct: 300 TPVGDRMEVQAIREVFGDNIPPISGTKSLTGHSQGATGVHEAIYSLLMMKHGFLAKSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DPEF+G+PI+R+R+DNAKID VLSNSFGFGGTNA L F+R
Sbjct: 360 DELDPEFEGMPILRERVDNAKIDRVLSNSFGFGGTNACLAFQR 402


>gi|319898318|ref|YP_004158411.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella
           clarridgeiae 73]
 gi|319402282|emb|CBI75821.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella
           clarridgeiae 73]
          Length = 406

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 317/406 (78%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M RV VTGMGI+S+IGN +  V  SL EARSG++++   A+ GFR +V+ KP +N  E +
Sbjct: 1   MHRVVVTGMGIISAIGNELQTVLTSLYEARSGVSYAPKHAELGFRSRVYAKPNINIEEFV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM  AI D+ L+P E+++E TG+I GSGGPST+ IV AADLTR
Sbjct: 61  DRRAMRFHGYGTAWNHIAMDRAIVDAGLEPNEVSNEYTGIIMGSGGPSTRSIVEAADLTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPF VPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-GPKRVGPFVVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q+ +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QNRIFAGGCEDLDWTLSVLFDAMGAMSSKYNDIPAVASRAYDINRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMVSPSGEGA RCMR AL++V+  +DYIN H TA
Sbjct: 240 ELELAKARGAKIYGEIVGYGATSDGHDMVSPSGEGAERCMRMALANVKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T  GD  E++AIR +F      P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TLVGDSSEIKAIRRIFGAGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP+F  +PI+RKR DN +++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPDFADMPIIRKRCDNQELNTVLSNTFGFGGTNATLVFQRY 405


>gi|319405037|emb|CBI78647.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella sp. AR
           15-3]
          Length = 406

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 262/406 (64%), Positives = 316/406 (77%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI+SSIGN +  V  SL EA+SGI+++   A+ GFR +V  KP +N  E +
Sbjct: 1   MRRVVVTGMGIISSIGNELQTVLTSLYEAKSGISYAPKHAELGFRSRVHAKPDINVEEFV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W  +AM  AI D+ L+P E+++E TG+I GSGGPST+ IV AADLTR
Sbjct: 61  DRRAMRFHGYGTAWNQIAMDRAIADAGLEPNEVSNEHTGIIMGSGGPSTRSIVEAADLTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPF VPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-GPKRVGPFVVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q  +FAGG EDLDWT+S LFDAMGAMSS +N+ P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QKRIFAGGCEDLDWTLSVLFDAMGAMSSKYNNTPETASRAYDINRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKAR AKIY E+ GYG+T DG DMVSPSGEGA RCMR AL++++  +DYIN H TA
Sbjct: 240 ELELAKARSAKIYGEIVGYGATSDGYDMVSPSGEGAERCMRMALATIKNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T  GD  E++AIR VF      P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TIVGDSSEIDAIRRVFGVGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEEIDP F  +PI+RKR+DN K++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEEIDPAFADMPIIRKRLDNQKLNTVLSNTFGFGGTNATLVFQRY 405


>gi|121602377|ref|YP_989518.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bartonella
           bacilliformis KC583]
 gi|120614554|gb|ABM45155.1| putative beta-ketoacyl synthase [Bartonella bacilliformis KC583]
          Length = 406

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/406 (63%), Positives = 318/406 (78%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M RV VTGMGIVS+IGN   +V  SLR A+SGI+++ + A+ GFR  V+ KP ++   L+
Sbjct: 1   MHRVVVTGMGIVSAIGNGTQDVLASLRAAKSGISYAPEHAELGFRSHVYAKPNVDIEALV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF  +G  W H+AM +AI D+ L+P E+++E TG+I GSGGPST+ IV AAD+TR
Sbjct: 61  DRRAMRFHGRGTAWNHIAMDQAIVDAGLEPHEVSNEHTGIIMGSGGPSTRSIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS+HCIGNA ELIQ GK
Sbjct: 121 QK-GPKRVGPFAVPKAMSSTASATLATFFKIKGVNYSISSACATSSHCIGNAYELIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q  +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V++LE
Sbjct: 180 QKRIFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPEKASRAYDMNRDGFVIAGGAGVLILE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+  AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR AL++V   +DYIN H TA
Sbjct: 240 ELAVAKARGAKIYGEIVGYGATSDGHDMVAPSGEGAERCMRMALATVNNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR +F      P I +TKSLTGHSLGAAG QEAIY L+MM   FI ES 
Sbjct: 300 TPVGDPPEIEAIRRIFGTGDQCPPISATKSLTGHSLGAAGVQEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PI+RKR D+ +++TVLSN+FGFGGTNATLVF+RY
Sbjct: 360 HIEELDPAFSDMPIIRKRSDHKELNTVLSNTFGFGGTNATLVFQRY 405


>gi|163867427|ref|YP_001608624.1| 3-oxoacyl-(acyl carrier protein) synthase I [Bartonella tribocorum
           CIP 105476]
 gi|161017071|emb|CAK00629.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Bartonella tribocorum
           CIP 105476]
          Length = 406

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/406 (63%), Positives = 319/406 (78%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS+IGN+   V  SLREA+SGI+++  +A+ GFR +V+GKP +N  EL+
Sbjct: 1   MRRVVVTGMGIVSAIGNDPQAVLTSLREAKSGISYAPQYAELGFRSRVYGKPDINIEELV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A+RF  +G  W H+AM +AI D+ L+P E+++E TG+I GSGG ST+ IV AAD+TR
Sbjct: 61  DRRALRFHGRGTAWNHIAMDQAIVDAGLEPHEVSNEHTGIIMGSGGASTQSIVEAADVTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GPF VPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 QK-GPKRVGPFVVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q  +FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QKRIFAGGCEDLDWTLSVLFDAMGAMSSRYNDIPHKASRAYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR AL++V   +DYIN H TA
Sbjct: 240 DLELAKARGAKIYGEIVGYGATSDGHDMVAPSGEGAERCMRMALATVNNKIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD  E+EAIR +F      P I +TKSLTGHSLGAAG  EAIY L+MM   FI ES 
Sbjct: 300 TPVGDPPEIEAIRRIFGAGDQCPPISATKSLTGHSLGAAGVHEAIYTLLMMNHNFICESA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +IEE+DP F  +PIVR+R D  +++TVLSN+FGFGGTNATL+F+RY
Sbjct: 360 HIEELDPAFADMPIVRERRDYQQLNTVLSNTFGFGGTNATLIFQRY 405


>gi|295691504|ref|YP_003595197.1| beta-ketoacyl synthase [Caulobacter segnis ATCC 21756]
 gi|295433407|gb|ADG12579.1| Beta-ketoacyl synthase [Caulobacter segnis ATCC 21756]
          Length = 403

 Score =  535 bits (1377), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/402 (64%), Positives = 313/402 (77%), Gaps = 3/402 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN +EV  SLREA+SG+  + ++A+ GFRCQV   P +    L+
Sbjct: 1   MRRVVVTGLGIVSSIGNNANEVLASLREAKSGVVAAPEYAELGFRCQVHAAPQIEWEPLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A RFL+ G  + H+AM++AI DS L   EI+HERTGLI GSGGPST+ IV AA  T+
Sbjct: 61  DRRAARFLAPGTAYAHIAMEQAIADSGLTEGEISHERTGLIVGSGGPSTRVIVEAAATTK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGPFAVPKAMSS  SA LSTWFKIRG +YSISSACATSAHCIG AAE IQ GK
Sbjct: 121 EK-GPKRIGPFAVPKAMSSGPSAVLSTWFKIRGINYSISSACATSAHCIGAAAEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+SNLFDAMGAMSS+FN  P  ASR YD  RDGFVI+GGA ++VLE
Sbjct: 180 QDVVFAGGCEELDWTLSNLFDAMGAMSSNFNDRPAVASRAYDKARDGFVIAGGAGIVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E ERAKARGAKIY EL GY +  DG DMV+PSGEGA RCM+ A++      +DY+N HGT
Sbjct: 240 EYERAKARGAKIYGELVGYAANSDGYDMVAPSGEGAARCMKLAMADAGNRAIDYLNPHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ A+REVF    P I STKSLTGHSLGAAGAQEAIY ++M+   F  ES +
Sbjct: 300 STPVGDSKEMGAVREVFGDKPPMISSTKSLTGHSLGAAGAQEAIYSILMLDNGFAAESAH 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVF 401
           IEE+DPEF  +PI+R+R+D   ++TV+SNSFGFGGTN TL+F
Sbjct: 360 IEELDPEFADLPILRQRVDK-PLETVMSNSFGFGGTNGTLIF 400


>gi|329847679|ref|ZP_08262707.1| beta-ketoacyl synthase [Asticcacaulis biprosthecum C19]
 gi|328842742|gb|EGF92311.1| beta-ketoacyl synthase [Asticcacaulis biprosthecum C19]
          Length = 407

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/405 (64%), Positives = 315/405 (77%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLL-NAAEL 59
           MRRV +TGMGIVSSIGN V +V  SLREARSGI  +ED+A+ GF+CQV   P + +  +L
Sbjct: 1   MRRVVITGMGIVSSIGNGVEDVTRSLREARSGIVAAEDYARLGFKCQVHAAPKIEDWTKL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           +DR+A RFL+ G  +GH+AM++AI  S L+  EI+HERTG+I GSGGPST+ IV AAD T
Sbjct: 61  VDRRAARFLAPGTAYGHIAMEQAIAASGLEKSEISHERTGIIFGSGGPSTRAIVEAADTT 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE  S +RIGPFAVPKAMSS  SATL+TWF+IRG +YSISSACATS HCIG AAE IQ G
Sbjct: 121 REKNSPKRIGPFAVPKAMSSGPSATLATWFEIRGINYSISSACATSVHCIGAAAEQIQMG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+LDWT+S++FDAMGAMSS+FN  P  ASR YD  RDGFVI+GGA ++V+
Sbjct: 181 KQDIIFAGGTEELDWTLSDMFDAMGAMSSNFNDRPAVASRAYDRDRDGFVIAGGAGLVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHG 298
           E  E AKARGA I AE+ GY +  DG DMV+PSGEGA RCMR AL+      +DY+N HG
Sbjct: 241 EAYEHAKARGANIVAEIVGYAANSDGYDMVAPSGEGAERCMRLALAEAGGRKIDYLNPHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ A+R VF  N P + STKSLTGHSLGAAGAQEAIYCL+MMQ  F  ES 
Sbjct: 301 TSTPVGDSKEMGAVRNVFGDNGPMVSSTKSLTGHSLGAAGAQEAIYCLLMMQNDFAAESA 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +IE +DPEF G+PI+R+R D  KI T +SNSFGFGGTN +++  R
Sbjct: 361 HIENLDPEFDGMPILRQRYD-GKIGTAMSNSFGFGGTNGSIILSR 404


>gi|170749091|ref|YP_001755351.1| 3-oxoacyl-(acyl carrier protein) synthase I [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655613|gb|ACB24668.1| Beta-ketoacyl synthase [Methylobacterium radiotolerans JCM 2831]
          Length = 408

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 263/405 (64%), Positives = 319/405 (78%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSSIGNN  EV  SLREARSGI     +A+ GFR QV G P L+   ++
Sbjct: 1   MRRVVITGMGIVSSIGNNTQEVLASLREARSGIARDASYAEHGFRSQVSGAPTLDPEGVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  ++++ERTG+I GSGGPST+ IV AA + R
Sbjct: 61  DRRAMRFHGGGTAWNHVAMDQAIQDAGLEQGDVSNERTGIIMGSGGPSTRVIVEAAAIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +RIGPFAVPKAMSSTASATL+TWFKIRG +YSISSACATS HCIGNAAE+IQ G+
Sbjct: 121 DK-GPKRIGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNAAEIIQGGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG EDLDWT+S LFDAMGAMSS +N  P  ASR YD+ RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSRASRAYDANRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP-VDYINTHGT 299
           E+E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQAL  ++   +DYIN H T
Sbjct: 240 ELEHAKARGARIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQALDGLKGARIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVF-KG-NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD KE+EAIREVF +G + P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDDKEIEAIREVFGRGEDCPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
            +I+ +DP F  +PI+++R DNA++  VL+NSFGFGGTNATLV +
Sbjct: 360 AHIDTLDPAFADMPILQQRRDNAQLGHVLTNSFGFGGTNATLVLK 404


>gi|298290262|ref|YP_003692201.1| beta-ketoacyl synthase [Starkeya novella DSM 506]
 gi|296926773|gb|ADH87582.1| Beta-ketoacyl synthase [Starkeya novella DSM 506]
          Length = 406

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 257/403 (63%), Positives = 316/403 (78%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGN+  EV  SLRE +SGI  ++ +A+ GFR QV G P L+A+ ++
Sbjct: 1   MRRVVVTGMGIVSSIGNSTQEVLASLREGKSGIVRADSYAELGFRSQVHGAPQLDASAIV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  EI++ERTG++ GSGG ST+ IV AAD+TR
Sbjct: 61  DRRAMRFHGGGTAWNHVAMDQAIRDAGLEENEISNERTGIVMGSGGTSTRTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ S +R+GPFAVPKAM STASATLSTWFKI+G ++SIS+ACAT+  CIG+AAE IQ GK
Sbjct: 121 KNNSPKRVGPFAVPKAMGSTASATLSTWFKIKGINHSISAACATTNICIGSAAEQIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG EDLDWT+S LFDAMGAMSS +N  P  ASRPYD  RDGFVISGGA V+VLE
Sbjct: 181 QDIVFAGGCEDLDWTLSCLFDAMGAMSSDYNDTPAVASRPYDKNRDGFVISGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IYAE+ GYGST DG DMV+PSGEGA R M+ A+  V+  +DYIN H T+
Sbjct: 241 ELEHAKARGARIYAEIIGYGSTSDGADMVAPSGEGAARAMQLAMKGVKGGIDYINPHATS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIR VF  + P I +TKSLTGHS GA G  EAIY ++MMQ  FI  S +I
Sbjct: 301 TPIGDLKEIEAIRAVFGAHAPPISATKSLTGHSQGATGVHEAIYSILMMQNGFIAASAHI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP F  +PIVR+R+DNA+++ VLSN FGFGG NA LVF+ 
Sbjct: 361 DELDPAFADMPIVRERVDNARLERVLSNGFGFGGANAVLVFQH 403


>gi|158426267|ref|YP_001527559.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Azorhizobium
           caulinodans ORS 571]
 gi|158333156|dbj|BAF90641.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Azorhizobium
           caulinodans ORS 571]
          Length = 405

 Score =  531 bits (1369), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/403 (65%), Positives = 311/403 (77%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGN+  EV  SL EA+SGITF++D+A+ GFR QV G P L A +++
Sbjct: 1   MRRVVVTGMGIVSSIGNSTQEVLGSLHEAKSGITFADDYARLGFRSQVQGAPTLVAEDVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+P EI+++RTGLI GSGG STK IV AAD+TR
Sbjct: 61  DRRAMRFHGGGTAWNHVAMDQAIRDAGLEPHEISNDRTGLIMGSGGSSTKTIVEAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAM+STASATLSTWFKI+G SYSIS+ACAT+  CIGNA E I  GK
Sbjct: 121 TK-GPKRVGPFAVPKAMASTASATLSTWFKIKGLSYSISAACATTNICIGNAYEQIVYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDLDWT+S LFD MGAMSS++N  P  ASR YD  RDGFVISGGA V+VLE
Sbjct: 180 QDRMFAGGCEDLDWTLSVLFDGMGAMSSNYNDRPAVASRAYDKDRDGFVISGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA+IYAE+ GYG + DG DMV+PSGEGA R MR A+S ++ P+DYIN H T+
Sbjct: 240 ELEVAKARGARIYAEVAGYGVSSDGADMVAPSGEGAERAMRMAISGLKAPIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIR VF    P I +TKSLTGHS GA G  EAIY ++MMQ  FI +S NI
Sbjct: 300 TPIGDLKEIEAIRAVFGDKCPPISATKSLTGHSQGATGVHEAIYSILMMQNGFIAKSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +EIDP F  +PIVR+R+DNA +  VLSN FGFGG NA LV + 
Sbjct: 360 DEIDPAFADMPIVRERVDNASLGHVLSNGFGFGGANACLVLKH 402


>gi|304392310|ref|ZP_07374251.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Ahrensia sp. R2A130]
 gi|303295414|gb|EFL89773.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Ahrensia sp. R2A130]
          Length = 405

 Score =  531 bits (1368), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 316/405 (78%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTGMGIVSSIGNN +EV  SLREA+SGI   E FA+  FR QV G+P L+  E++
Sbjct: 1   MKRVVVTGMGIVSSIGNNSNEVLASLREAKSGIRTEESFAEHNFRSQVSGRPDLDPFEVL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+ +RF+SQG  W ++AMQ+AI DS L+  E+ + RTG+I GSGGPSTK IV AA  T 
Sbjct: 61  DRRTVRFMSQGTAWNYIAMQQAIQDSGLEQNEVVNPRTGIIMGSGGPSTKTIVEAAAKTV 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  S +RIGP AVPKAMSSTASA L+T F+I+G +YSISSACATS HCIGNA E IQ GK
Sbjct: 121 DSGSPKRIGPTAVPKAMSSTASAVLATQFEIKGVNYSISSACATSNHCIGNAYETIQVGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG EDLDWTMSNLFDAMGAMSS +N +P  ASR +D  RDGFVI+GGA V+VLE
Sbjct: 181 QDVVFAGGSEDLDWTMSNLFDAMGAMSSGYNDNPSVASRAFDKNRDGFVIAGGAGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA+RC++ A   V + +DYIN H T+
Sbjct: 241 ELEHAKARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCIKMATEGVGK-IDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG-NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           T  GD KE+ A+RE++   N P I +TKSLTGHSLGA G QEAIY L+MMQ  FI +S +
Sbjct: 300 TGVGDAKEIAALREIYGADNCPKISATKSLTGHSLGATGVQEAIYSLLMMQNGFILKSAH 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           I EIDP+F  +PIV +R DN +++TVLSNSFGFGGTNA+L F RY
Sbjct: 360 INEIDPDFADMPIVTEREDNVELNTVLSNSFGFGGTNASLTFSRY 404


>gi|300025007|ref|YP_003757618.1| beta-ketoacyl synthase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526828|gb|ADJ25297.1| Beta-ketoacyl synthase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 410

 Score =  528 bits (1360), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/408 (63%), Positives = 310/408 (75%), Gaps = 4/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLREA+SGI+ +E +A  GF+CQV G P L    ++
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLREAKSGISRAEKYADLGFKCQVHGAPNLEWESVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            RK  RF++ G  W  +AM +AI DS L+P ++ +ERTG+I GSGGPST+ IV AA+ T 
Sbjct: 61  PRKPRRFMNPGVGWNWIAMDQAIRDSGLEPSDVVNERTGIIVGSGGPSTRAIVEAAETTI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    ++IGPF VPKAM S  SA L+T F+I+G +YSI+SACATS HCIGNA ELIQ GK
Sbjct: 121 ETGGPKKIGPFEVPKAMCSGPSAALATAFQIKGVNYSIASACATSTHCIGNATELIQWGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+SNLFDAMGAMSSHFN  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 181 QDVMFAGGCEELDWTLSNLFDAMGAMSSHFNATPEKASRAYDKDRDGFVIAGGAGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE----EPVDYINT 296
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA RCMR AL   +      +DYIN 
Sbjct: 241 ELEHAKARGAKIYGEVKGYGATSDGHDMVAPSGEGAERCMRLALKGFDGKAISKIDYINP 300

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE++AIR VF   IP I +TKSLTGHSLGA G QEAI+ L+MM   FI E
Sbjct: 301 HGTSTPVGDAKEIDAIRAVFGNAIPPISATKSLTGHSLGAIGVQEAIFSLLMMNNGFICE 360

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           S NIEE+DP F  +PI   RIDNA+++ V+SNSFGFGGTNATL+F R+
Sbjct: 361 SANIEELDPAFADVPIALSRIDNAELNCVMSNSFGFGGTNATLIFGRH 408


>gi|217978354|ref|YP_002362501.1| Beta-ketoacyl synthase [Methylocella silvestris BL2]
 gi|217503730|gb|ACK51139.1| Beta-ketoacyl synthase [Methylocella silvestris BL2]
          Length = 407

 Score =  528 bits (1359), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 263/404 (65%), Positives = 309/404 (76%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLRE RSGI  +E +A+ GFR QV G P L    +I
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVLASLREGRSGIVRAEKYAELGFRSQVHGMPTLEPDGMI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRFL++GG W H+AM +AI DS L   E+++ERTG+I GSGG S K IV  AD+ R
Sbjct: 61  DRRAMRFLARGGAWNHVAMDQAILDSGLGEDEVSNERTGIIMGSGGASLKTIVEGADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                ++IGPFAVPKAMSSTASATL+TWFKIRG +YSISSACATS HCIGNA E+IQ GK
Sbjct: 121 TK-GPKKIGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNAYEMIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+LDWT+S  FDAMGAMSS +N  P +ASR +D  RDGFVI+GGA V+VLE
Sbjct: 180 QDIMFAGGCEELDWTLSVFFDAMGAMSSAYNDRPKAASRAFDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E ERAKARGAKIY E+ GYG + DG DMV+PSGEGA+RCM+ AL  V+ P+DYIN H T+
Sbjct: 240 EYERAKARGAKIYGEIIGYGLSSDGYDMVAPSGEGAVRCMKMALQDVKIPIDYINPHATS 299

Query: 301 TPKGDKKEVEAIREVFKG--NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T  GD KE+EA+R VF      P I  TKSLTGHSLGA G QEAIY L+MMQ  FI  S 
Sbjct: 300 TGVGDVKEIEALRAVFGSGDKSPPIAGTKSLTGHSLGATGVQEAIYSLLMMQSGFICASA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
           NI+E+DP F  + IVR+R D+  +  VLSNSFGFGGTNA++VF+
Sbjct: 360 NIDELDPAFADMDIVRERRDDVSLRAVLSNSFGFGGTNASIVFK 403


>gi|154254066|ref|YP_001414890.1| beta-ketoacyl synthase [Parvibaculum lavamentivorans DS-1]
 gi|154158016|gb|ABS65233.1| Beta-ketoacyl synthase [Parvibaculum lavamentivorans DS-1]
          Length = 408

 Score =  525 bits (1352), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 254/408 (62%), Positives = 310/408 (75%), Gaps = 2/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIGNN  EV  SLRE +SGI  ++ +A+ GFR QV G   +N  E +
Sbjct: 1   MRRVVVTGMGIVSSIGNNTQEVVGSLREGKSGIVRADTYAEMGFRSQVHGSLKINLDEAV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A RF+  G  +  +AM++AI D+ L+  ++++ RTGLI GSGGPSTK IV+AAD+ R
Sbjct: 61  DRRARRFMGDGAAYAWIAMEQAIRDAGLEESDVSNPRTGLIVGSGGPSTKAIVAAADMAR 120

Query: 121 EHC--STRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
                  +++GPFAVPKAMSST SA LSTW+K +G +YSISSAC+TSA+CIGNAAE+IQ 
Sbjct: 121 TEPVKGPKKVGPFAVPKAMSSTCSANLSTWYKTKGVNYSISSACSTSANCIGNAAEMIQW 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD+MFAGG E+LDWT+S LFDAMGAMS+  N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVMFAGGGEELDWTLSVLFDAMGAMSAKRNDTPEKASRAYDKDRDGFVITGGGGILV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           LEE+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL +V+E VDYIN H 
Sbjct: 241 LEELEHAKARGAKIYAEIVGYGATADGADMVAPSGEGAVRCMKMALQNVKEKVDYINPHA 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD  E+ AIREVF  ++P I +TKSLTGH+ GAAG  EAIY L+MMQ  FI  S 
Sbjct: 301 TSTPVGDIPEINAIREVFGADMPPISATKSLTGHAQGAAGVHEAIYTLLMMQSGFIAASA 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           NI+EIDP      I R RIDNA I+  +SNSFGFGGTNATL  +RY G
Sbjct: 361 NIDEIDPAVADANIARTRIDNADINLAISNSFGFGGTNATLALQRYNG 408


>gi|218528506|ref|YP_002419322.1| 3-oxoacyl-(acyl carrier protein) synthase I [Methylobacterium
           chloromethanicum CM4]
 gi|218520809|gb|ACK81394.1| Beta-ketoacyl synthase [Methylobacterium chloromethanicum CM4]
          Length = 408

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 313/405 (77%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV ++GMGIVSSIGNN  EV  SLREARSGI  SE  A  GFR QV G P ++   ++
Sbjct: 1   MRRVVISGMGIVSSIGNNTGEVLDSLREARSGIARSEAQAAHGFRSQVAGAPTIDPEGVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  EI+++RTG+I GSGGPST+ IV +A + R
Sbjct: 61  DRRAMRFHGGGTAWNHIAMDQAIRDAGLEEREISNDRTGIIMGSGGPSTRTIVESAAIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+TWFKIRG +YSISSACATS HCIGNAAE+I+ G+
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNAAEIIRGGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWTLSVLFDAMGAMSSRYNETPSRASRAYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQA+  ++   +DYIN H T
Sbjct: 240 EYEHAKARGARIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQAMEDLKGVKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD KE+EAIR VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDDKEIEAIRTVFGAGDACPPISATKSLTGHSLGATGVQEAIYSLLMMNNSFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
            +IEE+DP F  +PI+R+R D A++  V+SNSFGFGGTNATLV +
Sbjct: 360 AHIEELDPAFADMPILRQRRDGAQLGHVMSNSFGFGGTNATLVLK 404


>gi|188579763|ref|YP_001923208.1| 3-oxoacyl-(acyl carrier protein) synthase I [Methylobacterium
           populi BJ001]
 gi|179343261|gb|ACB78673.1| Beta-ketoacyl synthase [Methylobacterium populi BJ001]
          Length = 408

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/405 (63%), Positives = 313/405 (77%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSSIGNN  EV  SLREARSGI  SE  A  GFR QV G P ++   ++
Sbjct: 1   MRRVVITGMGIVSSIGNNTQEVLASLREARSGIARSEAQAAHGFRSQVAGAPTIDPEGVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  EI+++RTG+I GSGGPST+ IV +A + R
Sbjct: 61  DRRAMRFHGGGTAWNHIAMDQAIRDAGLEEREISNDRTGIIMGSGGPSTRTIVESAAIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+TWFKIRG +YSISSACATS HCIGNA+E+I+ G+
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNASEIIRGGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVIFAGGCEELDWTLSVLFDAMGAMSSRYNETPARASRAYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP-VDYINTHGT 299
           E E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQA+  ++   +DYIN H T
Sbjct: 240 EYEHAKARGARIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQAMEDLKGARIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD KE+EAIREVF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDDKEIEAIREVFGAGEACPPISATKSLTGHSLGATGVQEAIYALLMMNNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
            +I+E+DP F  +PI+R+R D  ++  V+SNSFGFGGTNATLV +
Sbjct: 360 AHIDELDPAFADMPILRQRRDGVQLGHVMSNSFGFGGTNATLVLK 404


>gi|114706964|ref|ZP_01439863.1| 3-oxoacyl-(acyl carrier protein) synthase [Fulvimarina pelagi
           HTCC2506]
 gi|114537514|gb|EAU40639.1| 3-oxoacyl-(acyl carrier protein) synthase [Fulvimarina pelagi
           HTCC2506]
          Length = 404

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/403 (64%), Positives = 317/403 (78%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSSIG++V+EV  SLREA+SGI F+E++A+ GFR  V GKP LN  +++
Sbjct: 1   MRRVVVTGMGIVSSIGDDVAEVTQSLREAKSGIVFAEEYAELGFRSHVHGKPKLNPEDVL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A+RF   G  W H+AM +AI  +     +I++ERTG++ GSGGPST  I++AAD TR
Sbjct: 61  DRRALRFHGGGTAWNHVAMNQAIEAAGFDEKDISNERTGIVMGSGGPSTVTIMNAADTTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +RIGP AVPKAMSSTASATL+TWFKI+G +YSISSAC+TS+HCIGNA E+I  GK
Sbjct: 121 DK-GPKRIGPTAVPKAMSSTASATLATWFKIKGVNYSISSACSTSSHCIGNAYEMIAYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG EDL W++SNLFDAMGA+SS FN DP  AS+PYD  RDGFVI+GGA V+VLE
Sbjct: 180 QDAMFAGGCEDLHWSLSNLFDAMGALSSDFNDDPAHASKPYDKNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E ERAKARGA I  E+ GYG T DG DMV+PSGEGA+RCM+ A+  ++ P+DYIN H TA
Sbjct: 240 EYERAKARGANILGEIVGYGLTSDGADMVAPSGEGAVRCMKMAMQGLDGPIDYINPHATA 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GDK EV AIREVF  +IP + +TK+LTGHS GA G  EAIY LIMM+E FI +S +I
Sbjct: 300 TPVGDKSEVRAIREVFGESIPTVSATKALTGHSQGATGVHEAIYSLIMMKENFIAQSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+DPEF+G PI  +R D  K+D ++SNSFGFGGTNA LVF+R
Sbjct: 360 GELDPEFEGFPIAFERQDGVKLDRIMSNSFGFGGTNACLVFQR 402


>gi|163849875|ref|YP_001637918.1| 3-oxoacyl-(acyl carrier protein) synthase I [Methylobacterium
           extorquens PA1]
 gi|163661480|gb|ABY28847.1| Beta-ketoacyl synthase [Methylobacterium extorquens PA1]
          Length = 408

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 313/405 (77%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV ++GMGIVSSIGNN  EV  SLREARSGI  SE  A  GFR QV G P ++   ++
Sbjct: 1   MRRVVISGMGIVSSIGNNTGEVLDSLREARSGIARSEAQAAHGFRSQVAGAPTIDPEGVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  EI+++RTG+I GSGGPST+ IV +A + R
Sbjct: 61  DRRAMRFHGGGTAWNHIAMDQAIRDAGLEEREISNDRTGIIMGSGGPSTRTIVESAAIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+TWFKIRG +YSISSACATS HCIGNAAE+I+ G+
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNAAEIIRGGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWTLSVLFDAMGAMSSRYNETPSRASRAYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQA+  ++   +DYIN H T
Sbjct: 240 EYEHAKARGAQIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQAMEDLKGVKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD KE+EAIR VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDDKEIEAIRTVFGAGDACPPISATKSLTGHSLGATGVQEAIYALLMMNNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
            +IEE+DP F  +PI+R+R D A++  V+SNSFGFGGTNATLV +
Sbjct: 360 AHIEELDPAFADMPILRQRRDGAQLGHVMSNSFGFGGTNATLVLK 404


>gi|240137100|ref|YP_002961569.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Methylobacterium
           extorquens AM1]
 gi|254559112|ref|YP_003066207.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Methylobacterium
           extorquens DM4]
 gi|240007066|gb|ACS38292.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Methylobacterium
           extorquens AM1]
 gi|254266390|emb|CAX22154.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Methylobacterium
           extorquens DM4]
          Length = 408

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 313/405 (77%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV ++GMGIVSSIGNN  EV  SLREARSGI  SE  A  GFR QV G P ++   ++
Sbjct: 1   MRRVVISGMGIVSSIGNNTGEVLDSLREARSGIARSEAQAAHGFRSQVAGAPTIDPEGVV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+AMRF   G  W H+AM +AI D+ L+  EI+++RTG+I GSGGPST+ IV +A + R
Sbjct: 61  DRRAMRFHGGGTAWNHIAMDQAIRDAGLEEREISNDRTGIIMGSGGPSTRTIVESAAIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GPFAVPKAMSSTASATL+TWFKIRG +YSISSACATS HCIGNAAE+I+ G+
Sbjct: 121 EK-GPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNAAEIIRGGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P  ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDIIFAGGCEELDWTLSVLFDAMGAMSSRYNETPSRASRAYDVNRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E E AKARGA+IY E+ GYG+T DG DMV+PSGEGA+RCMRQA+  ++   +DYIN H T
Sbjct: 240 EYEHAKARGARIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQAMEDLKGVKIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           +TP GD KE+EAIR VF      P I +TKSLTGHSLGA G QEAIY L+MM   FI ES
Sbjct: 300 STPVGDDKEIEAIRTVFGAGDACPPISATKSLTGHSLGATGVQEAIYSLLMMNNGFICES 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
            +IEE+DP F  +PI+R+R D A++  V+SNSFGFGGTNATLV +
Sbjct: 360 AHIEELDPAFADMPILRQRRDGAQLGHVMSNSFGFGGTNATLVLK 404


>gi|307822365|ref|ZP_07652597.1| Beta-ketoacyl synthase [Methylobacter tundripaludum SV96]
 gi|307736931|gb|EFO07776.1| Beta-ketoacyl synthase [Methylobacter tundripaludum SV96]
          Length = 407

 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/408 (60%), Positives = 321/408 (78%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVSSIGNN +EV  SL+E RSGI F++ + + GFR  V G   ++    I
Sbjct: 1   MKRVVVTGLGIVSSIGNNRTEVVDSLKEGRSGIAFADVYQEMGFRSHVHGPINIDLDAFI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  + ++AMQ+AI DS L   E+++ RTGL+ GSGGPST  IV AAD+ R
Sbjct: 61  DRKIKRFMGDGAAFNYIAMQQAIDDSGLGESEVSNFRTGLVMGSGGPSTSNIVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +++GP+ VP++MSST +A L+T +KI+G +Y+ISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GIKKVGPYMVPRSMSSTNTACLATPYKIKGVNYTISSACATSAHCIGHAMELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++ WTMS LFDAMGA+SS +N  P +ASRPYD  RDGFVISGG  V+V+E
Sbjct: 180 QDVVFAGGGEEVHWTMSMLFDAMGALSSKYNDTPTTASRPYDETRDGFVISGGGGVLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E AKARGAKIYAELTGYG+T DG DMV PSGEGA+RCM+QA++++++  +DYIN HGT
Sbjct: 240 ELEHAKARGAKIYAELTGYGATSDGYDMVQPSGEGAVRCMQQAMATIKDCKIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           +TP GD KE+EA+R VF + ++P + STKSLTGH+LGAAG  EAIY L+MM+E F+  S 
Sbjct: 300 STPVGDTKELEALRNVFGQDDVPLVSSTKSLTGHALGAAGVNEAIYSLLMMEENFLSASA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           NI ++DP  +GIPIVR+R DN  ++T++SNSFGFGGTNATL+F+RY G
Sbjct: 360 NITQLDPGAEGIPIVRERKDNITLNTIMSNSFGFGGTNATLIFQRYNG 407


>gi|254420225|ref|ZP_05033949.1| Beta-ketoacyl synthase, N-terminal domain protein [Brevundimonas
           sp. BAL3]
 gi|196186402|gb|EDX81378.1| Beta-ketoacyl synthase, N-terminal domain protein [Brevundimonas
           sp. BAL3]
          Length = 405

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/405 (62%), Positives = 305/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA-AEL 59
           MRRV VTG+GIVSSIG+   EV  SLREARSG+  + D AK+GFR QVW  P +    EL
Sbjct: 1   MRRVVVTGLGIVSSIGHGAEEVTQSLREARSGVVHAPDHAKYGFRSQVWAPPKIGPWEEL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDR+A RFL+ G  W H+A +EA+  S +   EI  +R GLI G GGPST+ I+ AA  T
Sbjct: 61  IDRRAARFLANGTAWAHIAFEEALKSSGMTAEEIRDDRIGLIVGEGGPSTQVILQAAATT 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
            E  S +RIGPFAVPKAM+S  SA LSTWF++RG +YSISSACATSAHCIG   E IQ G
Sbjct: 121 IEKTSPKRIGPFAVPKAMASGPSAVLSTWFQMRGVNYSISSACATSAHCIGAGVEQIQWG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG ED+DW+MSN+FDAMGAMSS FN  P  ASR YD  RDGFVI+GGA V+VL
Sbjct: 181 KQDVVFAGGCEDIDWSMSNMFDAMGAMSSDFNETPSVASRAYDVNRDGFVIAGGAGVVVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP-VDYINTHG 298
           EE ERAKARGA IYAE+TGYG+  DG DMV+PSGEGA RCM+ AL     P +DY+N HG
Sbjct: 241 EEYERAKARGATIYAEVTGYGANSDGYDMVAPSGEGAQRCMKIALEQAGNPKIDYLNPHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+EA+R +F   +P I STKSLTGHSLGAAGAQEAIYCL+MMQ  F  ES 
Sbjct: 301 TSTPVGDSKEMEAVRAIFGDQMPMISSTKSLTGHSLGAAGAQEAIYCLLMMQNGFAAESA 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +IE +DP F+G+PI+R+R    ++  V+SNSFGFGGTN TL+  +
Sbjct: 361 HIETLDPAFEGMPILRQR-HEGELTHVMSNSFGFGGTNGTLILSK 404


>gi|197103494|ref|YP_002128871.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Phenylobacterium
           zucineum HLK1]
 gi|196476914|gb|ACG76442.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Phenylobacterium
           zucineum HLK1]
          Length = 404

 Score =  519 bits (1337), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/404 (62%), Positives = 312/404 (77%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSSIGNN  EV  SLREA+SG+T + ++A+ GFRCQV   P ++   ++
Sbjct: 1   MRRVVITGMGIVSSIGNNPDEVLASLREAKSGVTAAPEYAELGFRCQVHAPPRIDWEAMV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A RFL+QG  +GH+AM++AI DS L   E++HE+TGLI G+GGPST+ IV +A++ R
Sbjct: 61  DRRAARFLAQGTAFGHIAMEQAIADSGLTEAEVSHEKTGLIVGAGGPSTRAIVESAEIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GPFAVPKAMSS  SATL+TWFKIRG ++SISSACATS HCIG+A E I  GK
Sbjct: 121 TK-GPKRVGPFAVPKAMSSGPSATLATWFKIRGLNFSISSACATSTHCIGSAYEQILMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+S LFDAMGAMSS FN  P  ASR YD  RDGFVI+GGA ++VLE
Sbjct: 180 QDVVFAGGTEELDWTLSVLFDAMGAMSSKFNDRPAVASRAYDVDRDGFVIAGGAGILVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E ERAKARGAKIY E+ GY +  DG DMV+PSGEGA RCM+ A+  +    +DY+N HGT
Sbjct: 240 EYERAKARGAKIYGEIVGYAANSDGFDMVAPSGEGAARCMKLAMQDLGGRRIDYLNPHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
            TP GD KE+EA+R VF    P I STKSLTGHSLGAAGAQEAIY L+M+   F+ ES +
Sbjct: 300 GTPVGDVKEMEAVRAVFGETAPLISSTKSLTGHSLGAAGAQEAIYSLLMLNNGFVAESAH 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +DP F+G+PIVRKR D  +++TV+SNSFGFGGTN  LV  +
Sbjct: 360 IENLDPAFEGMPIVRKREDR-ELETVMSNSFGFGGTNGCLVMAK 402


>gi|329891076|ref|ZP_08269419.1| beta-ketoacyl synthase, C-terminal domain protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328846377|gb|EGF95941.1| beta-ketoacyl synthase, C-terminal domain protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 409

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 254/409 (62%), Positives = 310/409 (75%), Gaps = 7/409 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLL-----N 55
           MRRV VTG+GIVSSIG    +VA SLR+A+SG+  + D AK+GFR QVW  P L     +
Sbjct: 1   MRRVVVTGLGIVSSIGTGQDQVAASLRDAKSGVQHAADHAKYGFRSQVWAPPALGHTAED 60

Query: 56  AAELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSA 115
            A L+DR+A RFL+ G  W H+A +EA+ DS L   EI   R GLI G GGPST+ I+ A
Sbjct: 61  WAPLVDRRAARFLANGTAWAHIAFEEALKDSGLTAEEIKDPRIGLIVGEGGPSTQVILQA 120

Query: 116 ADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAEL 175
           A  T E  S +R+GPFAVPKAM+S  SA L+TWF+++G +YSISSACATSAHCIG AAE 
Sbjct: 121 AQTTVEKGSPKRVGPFAVPKAMASGPSAVLATWFELKGVNYSISSACATSAHCIGAAAEQ 180

Query: 176 IQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAA 235
           I  GKQD++FAGG ED+DW+MSN+FDAMGAMSS+FN  P  ASR YDS RDGFVI+GGA 
Sbjct: 181 IAWGKQDVVFAGGCEDIDWSMSNMFDAMGAMSSNFNDTPDKASRAYDSARDGFVIAGGAG 240

Query: 236 VIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP-VDYI 294
           ++VLEE ERA ARGA IYAE+TGYG+  DG DMV+PSGEGA RCM+ AL     P +DY+
Sbjct: 241 IVVLEEYERAVARGATIYAEVTGYGANSDGYDMVAPSGEGAERCMKIALEMAGNPKIDYL 300

Query: 295 NTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFI 354
           N HGT+TP GD KE+ A+R VF   +P I STKSLTGHSLGAAGAQEAIYCL+MM+  F 
Sbjct: 301 NPHGTSTPVGDSKEMSAVRNVFGDAMPMISSTKSLTGHSLGAAGAQEAIYCLLMMKHGFA 360

Query: 355 GESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            ES +IE +DPEF+G+PI+R+R D  ++  V+SNSFGFGGTNATL+  +
Sbjct: 361 AESAHIETLDPEFEGMPILRQRHDG-ELKHVMSNSFGFGGTNATLILSK 408


>gi|53803009|ref|YP_115272.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Methylococcus
           capsulatus str. Bath]
 gi|53756770|gb|AAU91061.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Methylococcus
           capsulatus str. Bath]
          Length = 406

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/407 (61%), Positives = 317/407 (77%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SLR  RSG+  SE++ + GFR QV+    LN  ELI
Sbjct: 1   MRRVVVTGIGIVSSIGNNKGEVVESLRLGRSGVCRSEEYGELGFRSQVYAPIRLNPDELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  + +LAMQEAI D+ L+P E+++ RTGLI GSGGPST  +++A    R
Sbjct: 61  DRKIRRFMGDGAAFNYLAMQEAIADAGLEPGEVSNPRTGLIMGSGGPSTSNMLAAWSTFR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +++GP+ VP++MS+T SA L+T F+I+G +YSISSACATSAHCIGNAAE IQ GK
Sbjct: 121 EK-GVKKVGPYMVPRSMSNTNSACLATPFQIKGVNYSISSACATSAHCIGNAAEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ WTMS LFDAMGA+S+ +N  P  ASRPYD  RDGFVISGG  V+V+E
Sbjct: 180 QDIVFAGGGEEVHWTMSVLFDAMGALSAKYNDTPECASRPYDVDRDGFVISGGGGVLVME 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE-EPVDYINTHGT 299
           E+E AKARGA+IYAELTGYG+T DG DMV PSGEGA+RCMRQA++++    VDY+N HGT
Sbjct: 240 ELEHAKARGARIYAELTGYGATSDGYDMVQPSGEGAVRCMRQAMATMSGAKVDYVNAHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD +E+EA++ VF  ++P + STKSLTGH+LGAAG  EAIY L+M++  FI  S N
Sbjct: 300 STPVGDIRELEAMKTVFGEDVPPVSSTKSLTGHALGAAGVHEAIYSLLMLEHGFICASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I  +DP   G+PI R+RID+A++DTV+SNSFGFGGTNATL+F+RY G
Sbjct: 360 IRNLDPGAAGVPIARERIDDARLDTVMSNSFGFGGTNATLIFQRYAG 406


>gi|167649016|ref|YP_001686679.1| beta-ketoacyl synthase [Caulobacter sp. K31]
 gi|167351446|gb|ABZ74181.1| Beta-ketoacyl synthase [Caulobacter sp. K31]
          Length = 404

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/404 (62%), Positives = 307/404 (75%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN +EV  SLREA+SG+  + D+A+ GFRCQV     +    L+
Sbjct: 1   MRRVVVTGLGIVSSIGNNANEVLASLREAKSGVVSAPDYAELGFRCQVHATAKIEWEPLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+A RFL+ G  + H+AM++AI DS L+  E+++ERTGLI GSGGPST+ IV AA  TR
Sbjct: 61  DRRAARFLAPGTAYAHIAMEQAIADSGLEESEVSNERTGLIVGSGGPSTRVIVEAAATTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGPFAVPKAMSS  SA LSTWFKIRG +YSISSACATSAHCIG  AE IQ GK
Sbjct: 121 EK-GPKRIGPFAVPKAMSSGPSAVLSTWFKIRGINYSISSACATSAHCIGAGAEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+SNLFDAMGAMSS+FN  P  ASR YD  RDGFVI+GGA ++VLE
Sbjct: 180 QDIVFAGGCEELDWTLSNLFDAMGAMSSNFNDRPAVASRAYDKDRDGFVIAGGAGIVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E E AKARGAKIY E+ GY +  DG DMV+PSGEGA RCM+ A++      +DY+N HGT
Sbjct: 240 EYEHAKARGAKIYGEIVGYAANSDGFDMVAPSGEGAARCMKIAMAQAGGRTIDYLNPHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD +E+ A+R+VF   +P I STKSLTGHSLGAAGAQEAIY ++M+   F  ES N
Sbjct: 300 STPVGDSREMGAVRDVFGDKVPMISSTKSLTGHSLGAAGAQEAIYSILMLNNDFAAESAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +DPEF  +PI+R R D   + TV+SNSFGFGGTN  L+  +
Sbjct: 360 IETLDPEFADLPILRTRKD-GPLTTVMSNSFGFGGTNGCLIVSK 402


>gi|304320328|ref|YP_003853971.1| 3-oxoacyl-(acyl carrier protein) synthase [Parvularcula bermudensis
           HTCC2503]
 gi|303299230|gb|ADM08829.1| 3-oxoacyl-(acyl carrier protein) synthase [Parvularcula bermudensis
           HTCC2503]
          Length = 406

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 247/406 (60%), Positives = 314/406 (77%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG+ VSEV  SLR  +SG++F+ + A+ GF+ QV G+P ++  +L+
Sbjct: 1   MRRVVVTGVGIVSSIGSTVSEVLDSLRNGKSGLSFAPEMAEHGFKSQVHGRPQIDVNDLL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            RK  RF+ +G  W ++AM++AI DS L+P E++HE TG++ GSGGPSTK IVSAA+ T 
Sbjct: 61  GRKTRRFMGEGAAWNYIAMRDAIEDSGLRPEEVSHEMTGIVMGSGGPSTKTIVSAANTTL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S R+IGPFAVP AMSST SATL+  F+I+G +YSISSACATS HC+G+A E +  GK
Sbjct: 121 ETGSPRKIGPFAVPSAMSSTNSATLAVPFEIKGLNYSISSACATSVHCVGHAYEQVAMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG EDLDWT+SN+FDAMGAMSS FN  P  ASR YD+ RDGFVI+GGAA +V+E
Sbjct: 181 QDVVFAGGGEDLDWTLSNMFDAMGAMSSKFNDVPEMASRAYDAARDGFVIAGGAATLVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            ++RA ARGAKI+ E+TGY +  DG DMV PSGEGA RC+ +A+S+V++ + YINTHGTA
Sbjct: 241 ALDRALARGAKIWGEITGYAANSDGVDMVMPSGEGASRCIAKAISTVKQRIGYINTHGTA 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD +EV AI++VF  +IP   STKSLTGHSLGA GAQE IY LIMM+ RF+  S  I
Sbjct: 301 TKIGDSREVGAIKDVFGDDIPPFGSTKSLTGHSLGAVGAQELIYGLIMMKNRFLAASAAI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +DPEF+G+PI+R+R DN  +   LSNSFGFGGTNA L   R+ G
Sbjct: 361 ETLDPEFEGLPILRERQDNVDLRAFLSNSFGFGGTNACLAIERFDG 406


>gi|315497814|ref|YP_004086618.1| beta-ketoacyl synthase [Asticcacaulis excentricus CB 48]
 gi|315415826|gb|ADU12467.1| Beta-ketoacyl synthase [Asticcacaulis excentricus CB 48]
          Length = 407

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 249/403 (61%), Positives = 312/403 (77%), Gaps = 3/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLL-NAAEL 59
           MRRV +TG+GIVSSIG    EVA SLR+A+SGI  + ++A+ GF+CQV  KP + +   L
Sbjct: 1   MRRVVITGLGIVSSIGTGADEVAASLRDAKSGIVAAPEYAELGFKCQVHAKPTIGDWTPL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           +DR+A RFLS G  +GH+++++AI  + L+  +I++ERTG+I G+GGPST+ IV AAD +
Sbjct: 61  VDRRAARFLSDGLAYGHVSLEQAIKSAGLEEHDISNERTGIIFGAGGPSTRTIVEAADTS 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE  S +RIGPFAVPKAMSS  SA L+TWFKIRG +YSISSACATS HCIG AAE I  G
Sbjct: 121 REKKSPKRIGPFAVPKAMSSGPSAVLATWFKIRGINYSISSACATSVHCIGAAAEQIMLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           +QD+MFAGG E+LDWT+SNLFDAMGAMSS+FN  P  ASR YD  RDGFVI+GGA  +VL
Sbjct: 181 RQDVMFAGGTEELDWTLSNLFDAMGAMSSNFNDTPSVASRAYDKNRDGFVIAGGAGAVVL 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHG 298
           E+ ERAKARGA I AE+ GY +  DG DMV+PSGEGA RCMR+AL       +DY+N HG
Sbjct: 241 EDYERAKARGANILAEIVGYCANSDGYDMVAPSGEGAERCMREALRQAGGRKIDYLNPHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD++E+ A+R VF    P I STKSLTGHSLGAAGAQE IYCL+MMQ  F  +S 
Sbjct: 301 TSTPVGDEREMGAVRNVFGEASPLISSTKSLTGHSLGAAGAQEVIYCLLMMQHGFAAKSA 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVF 401
           +IEE+DP F G+PI+R+R D A ++TV+SNSFGFGGTN +++ 
Sbjct: 361 HIEELDPAFDGMPILRERRDGA-LETVMSNSFGFGGTNGSIIL 402


>gi|302381695|ref|YP_003817518.1| beta-ketoacyl synthase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192323|gb|ADK99894.1| Beta-ketoacyl synthase [Brevundimonas subvibrioides ATCC 15264]
          Length = 409

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/409 (60%), Positives = 307/409 (75%), Gaps = 7/409 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA---- 56
           MRRV VTG+GIVSSIG    EV  SLR A+SG+  + D  + GFR QVW  P L      
Sbjct: 1   MRRVVVTGLGIVSSIGTGRDEVTASLRSAKSGVVAAPDHIQHGFRSQVWAPPSLGVTAED 60

Query: 57  -AELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSA 115
            A L+DR+A RFL+ G  WGH+A +EA+ DS + P EI  +R G+I G GGPST+ I+ A
Sbjct: 61  WAPLVDRRAARFLANGTAWGHIAFEEALKDSGMTPEEIRDDRIGVIVGEGGPSTQVILQA 120

Query: 116 ADLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAEL 175
           A  T E  + +RIGPFAVPKAM+S  SA L+TWF++RG +YSISSACATSAHCIG  AE 
Sbjct: 121 AQTTIEKGAPKRIGPFAVPKAMASGPSAVLATWFQMRGVNYSISSACATSAHCIGAGAEQ 180

Query: 176 IQSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAA 235
           IQ GKQD++FAGG ED+DW+MSN+FDAMGAMSS FN  P  ASR YD  RDGFVI+GGA 
Sbjct: 181 IQWGKQDVVFAGGVEDIDWSMSNMFDAMGAMSSDFNATPSVASRAYDVARDGFVIAGGAG 240

Query: 236 VIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYI 294
           ++VLEE ERA ARGAKIYAE+ GYG+  DG DMV+PSGEGA RCM+ A++      +DY+
Sbjct: 241 IVVLEEYERAMARGAKIYAEVVGYGANSDGYDMVAPSGEGAERCMKIAMAQAGGRKIDYL 300

Query: 295 NTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFI 354
           N HGT+TP GD KE+ A+R VF  ++P I STKSLTGHSLGAAGAQEAIY L+M++  F 
Sbjct: 301 NPHGTSTPVGDSKEMGAVRNVFGADMPLISSTKSLTGHSLGAAGAQEAIYSLLMLENGFA 360

Query: 355 GESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            ES +IE +DPEF+G+PI+R+R D  ++ TV+SNSFGFGGTN T++F +
Sbjct: 361 AESAHIENLDPEFEGMPILRERRD-VELTTVMSNSFGFGGTNGTVIFSK 408


>gi|192360198|ref|YP_001981258.1| beta-ketoacyl-ACP synthase I [Cellvibrio japonicus Ueda107]
 gi|190686363|gb|ACE84041.1| beta-ketoacyl-ACP synthase I [Cellvibrio japonicus Ueda107]
          Length = 403

 Score =  508 bits (1308), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/402 (60%), Positives = 307/402 (76%), Gaps = 1/402 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI+S +GNN++ V  +LR  RSGI F E + + GFR QV G   +N +ELI
Sbjct: 1   MRRVVVTGMGIISCLGNNLAAVLDALRNGRSGIKFQETYQQMGFRSQVAGSIDINLSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +L+MQ+AI D+ L   ++++ERTG+I GSGG S+  +V AAD+ R
Sbjct: 61  DRKILRFMGDAAAFAYLSMQQAIADAGLSEDKVSNERTGIIMGSGGASSMNLVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHC+GNA ELIQ GK
Sbjct: 121 EK-GLKRVGPYRVTQTMGSTTSACLATPFKIKGVNYSISSACATSAHCVGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  WT++ LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG   +VLE
Sbjct: 180 QDIVFAGGGEEEHWTLTALFDAMGALSTKYNETPDKASRAYDANRDGFVIAGGGGCLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA+IYAE+ GYG+T DG DMV+PSGEGA+RCM+QAL++V+ P+DYIN+HGT+
Sbjct: 240 EYEHAKARGARIYAEVVGYGATSDGYDMVAPSGEGAVRCMKQALATVDGPIDYINSHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++AI+E F   IP I STKSLTGHSLGA G QEAIY L+MM   FI  S NI
Sbjct: 300 TPVGDLAELKAIKETFGDQIPAISSTKSLTGHSLGATGVQEAIYSLLMMANDFICASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
           E +DPE +GIPIV KR DN K+  V+SNSFGFGGTNATLVF+
Sbjct: 360 ESVDPEAEGIPIVLKRQDNVKLKRVMSNSFGFGGTNATLVFQ 401


>gi|114562568|ref|YP_750081.1| beta-ketoacyl synthase [Shewanella frigidimarina NCIMB 400]
 gi|114333861|gb|ABI71243.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella
           frigidimarina NCIMB 400]
          Length = 412

 Score =  508 bits (1308), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/405 (60%), Positives = 314/405 (77%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R +VWG   +N A+ I
Sbjct: 9   MKRVVITGMGVVSSIGNNKLEVTESLKAGRSGITHSAQFEEMQLRSKVWGDIKMNPADHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEAI D+ L   + ++ R GLIAG+GG S+K  V AAD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAIADANLTEEQYSNFRVGLIAGTGGASSKNQVQAADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+GTSYSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGTSYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGIVVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL+ V+ PVDYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMQMALADVDTPVDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVF  N+P I STKS+TGH+LGAAG  EAIY LIMM++ FI  S NI
Sbjct: 308 TPVGDMRELEALREVFGDNMPPIASTKSMTGHALGAAGVHEAIYSLIMMEDSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+P+VR+ +  A+++T++SNSFGFGGTNATLV R++K
Sbjct: 368 DNLDEKAAGMPVVRQ-MREAELNTIMSNSFGFGGTNATLVMRKFK 411


>gi|157961432|ref|YP_001501466.1| beta-ketoacyl synthase [Shewanella pealeana ATCC 700345]
 gi|157846432|gb|ABV86931.1| Beta-ketoacyl synthase [Shewanella pealeana ATCC 700345]
          Length = 424

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/405 (60%), Positives = 310/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S+ F +   R  VWG   ++ +E I
Sbjct: 22  MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSDQFEEMKLRSHVWGDIKIDPSEYI 81

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + H+AMQEAI D+ L   + +  R G+I GSGG S+   V AAD  R
Sbjct: 82  DRKALRFMGNAAAYAHIAMQEAIKDAGLVEEQYSDPRVGIIVGSGGASSANQVQAADTLR 141

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 142 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAAELIQMGK 200

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ FN DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 201 QDMVFAGGAEEVDWTLTMGFDAMGALSTKFNDDPTKASRTYDADRDGFVISGGGGIVVVE 260

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 261 ELEHALARGAKIYAEIIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 320

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+RE F  N+P I STKSLTGH+LGAAGA EAIY LIMM+  FI  S NI
Sbjct: 321 TPVGDMRELEALRETFGDNLPAIASTKSLTGHALGAAGAHEAIYSLIMMESSFIAPSINI 380

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D + +G+PIV K  +  +++TV+SNSFGFGGTNATLV R+YK
Sbjct: 381 DTVDEKAEGMPIVTKMTEK-ELNTVMSNSFGFGGTNATLVMRKYK 424


>gi|237808330|ref|YP_002892770.1| Beta-ketoacyl synthase [Tolumonas auensis DSM 9187]
 gi|237500591|gb|ACQ93184.1| Beta-ketoacyl synthase [Tolumonas auensis DSM 9187]
          Length = 404

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/406 (58%), Positives = 312/406 (76%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSS+GNN +EV  SL+  +SGIT+S+ F +   R +VWG   L+ AELI
Sbjct: 1   MRRAVITGIGIVSSLGNNAAEVLASLKAGKSGITYSDQFEQHSLRSRVWGNIKLDVAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +L+MQ+AI D++L    +++ RTGL+AGSGG S+K  + A D  R
Sbjct: 61  DRKVLRFMGDAAAYAYLSMQQAIADAKLTEDMVSNPRTGLVAGSGGASSKNQIEACDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ MSST SA L+T FKI+G +YSISSACATS+HCIGNA E IQ GK
Sbjct: 121 EK-GVRRVGPYMVPRTMSSTTSACLATPFKIKGINYSISSACATSSHCIGNALEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++DWT++  FDAMGA+SS +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEEVDWTLAMQFDAMGALSSKYNDTPEKASRTYDAGRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+TGYG+T DG DMV+PSGEGA+RCM+QA+S+V  P+DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEITGYGATSDGYDMVAPSGEGAVRCMQQAMSTVAAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI  VF    P I +TK+++GH+LGAAG  EAIY L+MM+  FI  S NI
Sbjct: 300 TPVGDVKELEAIHNVFGDKAPKISATKAMSGHALGAAGVHEAIYSLLMMENGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +DP+ +G+PIV +  + A+++TV+SNSFGFGGTNATLVF +YKG
Sbjct: 360 ETLDPKAEGLPIVTE-YEEAELNTVMSNSFGFGGTNATLVFSKYKG 404


>gi|83944894|ref|ZP_00957260.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Oceanicaulis
           alexandrii HTCC2633]
 gi|83851676|gb|EAP89531.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Oceanicaulis
           alexandrii HTCC2633]
          Length = 404

 Score =  503 bits (1296), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/404 (59%), Positives = 309/404 (76%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG+N  EVA SL+  +SG+  + ++A+ GF+CQV  +P  + AE +
Sbjct: 1   MRRVVVTGIGIVSSIGDNAQEVAASLKAGKSGVIAAPEYAELGFKCQVHARPKADPAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A RF+ +G  W +++MQ+AI D+ L+  ++++ERTGLI G+GGPS + IV AAD+TR
Sbjct: 61  DKRAYRFMGEGAGWAYMSMQQAIADAGLEESDVSNERTGLIVGTGGPSVEAIVKAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGPFAVPKAM ST SATL+T FKI+G +YSISSAC TS HC+G AAE IQ GK
Sbjct: 121 EK-GPKRIGPFAVPKAMCSTGSATLATPFKIKGLNYSISSACTTSLHCMGAAAEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L W +SNLFDAMGAMSS++N  P  ASR +D  RDGFVI+GGA ++VLE
Sbjct: 180 QDVMFAGGGEELHWALSNLFDAMGAMSSNYNDSPSVASRAFDKNRDGFVIAGGAGIVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE-EPVDYINTHGT 299
           E ERAKARGA IYAE+ GYG+T DG DMV PSGEGA RCM+ AL   +   +DYIN H T
Sbjct: 240 EYERAKARGATIYAEVLGYGATSDGHDMVQPSGEGAARCMQIALKEAKGRTIDYINPHAT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE E +R VF  ++P + +TKS++GHSLGAAG QEAIY L+MM+E FI  S N
Sbjct: 300 STPVGDVKEAEGLRAVFGKDVPALSATKSMSGHSLGAAGVQEAIYSLLMMKEGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I+E+DPE   +PIV +    A+++TVLSNSFGFGGTN T++  R
Sbjct: 360 IDEMDPELADLPIVTE-TKQAELNTVLSNSFGFGGTNGTIILGR 402


>gi|24374593|ref|NP_718636.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella oneidensis
           MR-1]
 gi|24349207|gb|AAN56080.1|AE015744_1 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella oneidensis
           MR-1]
          Length = 403

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 242/405 (59%), Positives = 310/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   L+ +ELI
Sbjct: 1   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGNIKLDPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEAI D++L   + ++ R GLI G+GG S+   V AAD+ R
Sbjct: 61  DRKALRFMGDAAAYAYIAMQEAIKDAQLTEEQYSNPRVGLIVGTGGASSSNQVQAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+STASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMASTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++++E
Sbjct: 180 QDMVFAGGAEELDWTLTMGFDAMGALSTKYNATPDKASRTYDADRDGFVISGGGGILIVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCMR AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMRLALADVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P + STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDVRELEALREVFKDKCPPVASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R+YK
Sbjct: 360 DNLDEAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKYK 403


>gi|330721972|gb|EGG99909.1| 3-oxoacyl-[acyl-carrier-protein] synthase2C KASI [gamma
           proteobacterium IMCC2047]
          Length = 404

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 238/405 (58%), Positives = 313/405 (77%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVS +GN+ + V  SL+  +SGITFS ++ + G R  V G   L+  ELI
Sbjct: 1   MKRVVVTGIGIVSCLGNDQASVLESLKNGKSGITFSPEYEELGLRSHVSGSIDLDLDELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+  RF+S    + ++AMQ++I D+ L   ++++ RTGL+AGSGG S   +V AAD+ R
Sbjct: 61  DRRPRRFMSDAAAYAYVAMQQSIDDAGLTKDQVSNVRTGLVAGSGGASMSSMVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VPK MSST SA L+T F+I+G +YSI+SAC+TSAHCIGNA ELIQ GK
Sbjct: 121 AK-GVKRVGPYRVPKVMSSTVSACLATPFEIKGVNYSITSACSTSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+++ LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG A++VLE
Sbjct: 180 QDIVFAGGGEEEHWSLTCLFDAMGALSTKYNETPDKASRAYDADRDGFVIAGGGAMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+QA+++V+ P+DYIN HGT+
Sbjct: 240 EREHALARGAKIYAEVVGYGATSDGFDMVAPSGEGAVRCMQQAMATVDTPIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ A+REVF   +P I STKSL+GHSLGAAGA EAIY ++MMQ  FI  S N+
Sbjct: 300 TPVGDVKELAAVREVFGDKLPNITSTKSLSGHSLGAAGAHEAIYSILMMQNNFIAASANV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D E +G+PIV +R+DNAKIDT++SNSFGFGGTNA+LVF+R+K
Sbjct: 360 NNLDDEAQGMPIVTERLDNAKIDTIMSNSFGFGGTNASLVFQRHK 404


>gi|167624573|ref|YP_001674867.1| beta-ketoacyl synthase [Shewanella halifaxensis HAW-EB4]
 gi|167354595|gb|ABZ77208.1| Beta-ketoacyl synthase [Shewanella halifaxensis HAW-EB4]
          Length = 424

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/405 (59%), Positives = 309/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S+ F +   R  VWG   ++ +E I
Sbjct: 22  MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSDQFEEMKLRSHVWGDIKIDPSEYI 81

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + H+AMQEAI D+ L   + +  R G+I GSGG S+   V AAD  R
Sbjct: 82  DRKALRFMGNAAAYAHIAMQEAIKDAGLVEEQYSDPRVGIIVGSGGASSANQVQAADTLR 141

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 142 AK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAAELIQMGK 200

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+SS +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 201 QDMVFAGGAEEVDWTLTMGFDAMGALSSKYNDDPTKASRTYDADRDGFVISGGGGIVVVE 260

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 261 ELEHALARGAKIYAEIIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 320

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+RE F  N+P I STKSLTGH+LGAAGA EAIY LIMM+  FI  S NI
Sbjct: 321 TPVGDTRELEALRETFGDNLPAIASTKSLTGHALGAAGAHEAIYSLIMMESSFIAPSINI 380

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D + +G+PIV +  +  +++TV+SNSFGFGGTNATLV R+YK
Sbjct: 381 DTLDEKAEGMPIVTEMTEK-ELNTVMSNSFGFGGTNATLVMRKYK 424


>gi|113969764|ref|YP_733557.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp. MR-4]
 gi|113884448|gb|ABI38500.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp. MR-4]
          Length = 411

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/405 (59%), Positives = 310/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   L+ +ELI
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGNIKLDPSELI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEAI D++L   + ++ R GLI G+GG S+   V AAD+ R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAIKDAQLTEEQYSNPRVGLIVGTGGASSSNQVQAADILR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++++E
Sbjct: 188 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGILIVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P + STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPVASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R+YK
Sbjct: 368 DNLDEAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKYK 411


>gi|114046993|ref|YP_737543.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp. MR-7]
 gi|113888435|gb|ABI42486.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp. MR-7]
          Length = 411

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/405 (59%), Positives = 309/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   L+ +ELI
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGNIKLDPSELI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEAI D++L   + +  R GLI G+GG S+   V AAD+ R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAIKDAQLTEEQYSDPRVGLIVGTGGASSSNQVQAADILR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++++E
Sbjct: 188 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGILIVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P + STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPVASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R+YK
Sbjct: 368 DNLDEAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKYK 411


>gi|88812257|ref|ZP_01127508.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrococcus mobilis
           Nb-231]
 gi|88790508|gb|EAR21624.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrococcus mobilis
           Nb-231]
          Length = 405

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 244/404 (60%), Positives = 306/404 (75%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  SLR  RSGI + ED+A+ G R +V G   L+ +ELI
Sbjct: 1   MRRVVITGIGIVSCLGNDKETVTESLRSGRSGIRYREDYAELGLRSRVAGVVELDTSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            RKA RF++ GG + ++AM  AI D+ L   ++++ RTGLIAGSG  ST  +V A D  R
Sbjct: 61  PRKARRFMAAGGEYAYIAMDRAIADAALDDTQVSNPRTGLIAGSGVGSTSSLVEATDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R+IG FAVPK MSST SA L+T F IRG +YSI+SACATSAHCIGNA E IQ G+
Sbjct: 121 AR-GVRKIGAFAVPKVMSSTVSALLATPFGIRGLNYSITSACATSAHCIGNAMEQIQLGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG ++  W+M+ LFDAMGA+S  FN  P  ASRPYD+ RDGFVI+GGA ++VLE
Sbjct: 180 QDIIFAGGADEEHWSMTMLFDAMGALSMKFNDTPAKASRPYDTTRDGFVIAGGAGILVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGA IYAEL GYG+T DG DMV+PSGEGA+RCMR+A+S+++  VDYIN HGT+
Sbjct: 240 ELEHAITRGAHIYAELVGYGATSDGHDMVAPSGEGAVRCMREAISNIDCAVDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++AI EVF   +P + STKSLTGHSLGAAG QE IY L+M+++ FI  S NI
Sbjct: 300 TPAGDITELKAIAEVFAERMPPVSSTKSLTGHSLGAAGVQEVIYSLLMLEQDFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           EE+DPE +G+PIVR+R D A + TV+SNSFGFGGTNA+LVFRR+
Sbjct: 360 EELDPEAQGMPIVRERQDAAGLHTVMSNSFGFGGTNASLVFRRF 403


>gi|119775289|ref|YP_928029.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella amazonensis
           SB2B]
 gi|119767789|gb|ABM00360.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella amazonensis
           SB2B]
          Length = 403

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 242/405 (59%), Positives = 309/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   L+ AE I
Sbjct: 1   MKRVVITGIGIVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGDIKLDPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + +LAMQEAI+D+ L   + ++ R GL+ G+GG S+   V AAD  R
Sbjct: 61  DRKALRFMGDAAAYAYLAMQEAISDANLTEEQYSNPRVGLVVGTGGASSSNQVQAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+STASA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMASTASACLATPFKIKGFNYSISSACATSAHCIGHAAELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++++E
Sbjct: 180 QDMVFAGGAEELDWTLTMGFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGIVIVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAMRCMQMALTDVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EAIREVFK  +P I STKSLTGH+LGAAG  EAIY L+MM+  FI  S N+
Sbjct: 300 TPVGDVRELEAIREVFKDQVPPIASTKSLTGHALGAAGVHEAIYSLLMMENGFIAASANV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +DP+   +PIV +  D A++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 360 ENVDPQAADMPIVTQCRD-AELTTVMSNSFGFGGTNATLVMRKYR 403


>gi|300114004|ref|YP_003760579.1| beta-ketoacyl synthase [Nitrosococcus watsonii C-113]
 gi|299539941|gb|ADJ28258.1| Beta-ketoacyl synthase [Nitrosococcus watsonii C-113]
          Length = 412

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 249/406 (61%), Positives = 309/406 (76%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV +TG+GI+SSIGNN  EV  +L+  RSGI F +++A  G R Q+ G   ++   LI
Sbjct: 5   LRRVVITGLGIISSIGNNKEEVLAALKSGRSGIEFHQEYADLGLRSQIHGSVDIDIEALI 64

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  + +LAM++AI DS L P  ++  R+GLI GSGGPSTK +V AAD  R
Sbjct: 65  DRKIRRFMGDGAAYNYLAMEQAIADSGLTPNLVSQPRSGLIMGSGGPSTKNLVDAADTLR 124

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ M ST SA L+T FKI+G +YSISSAC+TSAHCIGN  E IQ GK
Sbjct: 125 EK-GIRRVGPYMVPRTMCSTNSACLATPFKIKGINYSISSACSTSAHCIGNGMEQIQLGK 183

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT+++LFDAMGA+SS+FN  P  ASRPYD  RDGFVI+GG  V+VLE
Sbjct: 184 QDIIFAGGGEELHWTLTHLFDAMGALSSNFNETPHRASRPYDKNRDGFVIAGGGGVVVLE 243

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGAKIYAE+TGYG+T DG DMV+PSGEGA+RCM+QAL++VE PVDYIN HGT+
Sbjct: 244 ALEHAEARGAKIYAEVTGYGATSDGYDMVAPSGEGAVRCMQQALATVETPVDYINAHGTS 303

Query: 301 TPKGDKKEVEAIREVF---KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           TP GD KE+EAI+EVF   K  IP I +TKSLTGH+LGAAG  E IY L+MM+E FI  S
Sbjct: 304 TPTGDIKELEAIQEVFAERKEGIPPISATKSLTGHALGAAGVNEIIYSLLMMEEGFIAAS 363

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI+EIDP  +G PIV+KR+D  ++  V+SNSFGFGGTNA LV  R
Sbjct: 364 ANIDEIDPGAEGFPIVKKRMDGIELGAVMSNSFGFGGTNACLVLER 409


>gi|117919923|ref|YP_869115.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp. ANA-3]
 gi|117612255|gb|ABK47709.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp. ANA-3]
          Length = 411

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 310/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   L+ +ELI
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGNIKLDPSELI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEAI D++L   + ++ R GLI G+GG S+   V AAD+ R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAIKDAQLTEEQYSNPRVGLIVGTGGASSSNQVQAADILR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++++E
Sbjct: 188 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGILIVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+D+INTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDFINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P + STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPVASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R+YK
Sbjct: 368 DNLDEAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKYK 411


>gi|77165254|ref|YP_343779.1| Beta-ketoacyl synthase [Nitrosococcus oceani ATCC 19707]
 gi|76883568|gb|ABA58249.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Nitrosococcus oceani
           ATCC 19707]
          Length = 412

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 248/406 (61%), Positives = 310/406 (76%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV +TG+GI+SSIGNN  EV  +L+  RSGI F +++A  G R Q+ G   ++   LI
Sbjct: 5   LRRVVITGLGIISSIGNNKEEVLAALKTGRSGIEFHQEYADLGLRSQIHGSVDIDIEALI 64

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  + +LAM++AI DS L P  ++H R+GLI GSGGPSTK +VSAAD  R
Sbjct: 65  DRKIRRFMGDGAAYNYLAMEQAIADSGLTPNLVSHPRSGLIMGSGGPSTKNLVSAADTLR 124

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ M ST SA L+T FKI+G +YSISSAC+TSAHCIGN  E IQ GK
Sbjct: 125 EK-GIRRVGPYMVPRTMCSTNSACLATPFKIKGINYSISSACSTSAHCIGNGMEQIQLGK 183

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT+++LFDAMGA+SS+FN  P  ASRPYD  RDGFVI+GG  V+VLE
Sbjct: 184 QDIIFAGGGEELHWTLTHLFDAMGALSSNFNETPHRASRPYDKNRDGFVIAGGGGVVVLE 243

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGAKIYAE+TGYG+T DG DMV+PSGEGA+RCM+QAL++VE PV YIN HGT+
Sbjct: 244 ALEHAEARGAKIYAEVTGYGATSDGYDMVAPSGEGAVRCMQQALATVETPVGYINAHGTS 303

Query: 301 TPKGDKKEVEAIREVF---KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           TP GD KE+EAI+E F   K  IP I +TKSLTGH+LGAAG  E IY L+MM+E FI  S
Sbjct: 304 TPTGDIKELEAIQEAFAERKEGIPPISATKSLTGHALGAAGVNEIIYSLLMMEEGFIAAS 363

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI+EIDP  +G PIV++R+D  +++ V+SNSFGFGGTNA LV  R
Sbjct: 364 ANIDEIDPGAEGFPIVKERMDGVELEAVMSNSFGFGGTNACLVLER 409


>gi|254434251|ref|ZP_05047759.1| Beta-ketoacyl synthase, N-terminal domain protein [Nitrosococcus
           oceani AFC27]
 gi|207090584|gb|EDZ67855.1| Beta-ketoacyl synthase, N-terminal domain protein [Nitrosococcus
           oceani AFC27]
          Length = 434

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 248/406 (61%), Positives = 310/406 (76%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV +TG+GI+SSIGNN  EV  +L+  RSGI F +++A  G R Q+ G   ++   LI
Sbjct: 27  LRRVVITGLGIISSIGNNKEEVLAALKTGRSGIEFHQEYADLGLRSQIHGSVDIDIEALI 86

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  + +LAM++AI DS L P  ++H R+GLI GSGGPSTK +VSAAD  R
Sbjct: 87  DRKIRRFMGDGAAYNYLAMEQAIADSGLTPNLVSHPRSGLIMGSGGPSTKNLVSAADTLR 146

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ M ST SA L+T FKI+G +YSISSAC+TSAHCIGN  E IQ GK
Sbjct: 147 EK-GIRRVGPYMVPRTMCSTNSACLATPFKIKGINYSISSACSTSAHCIGNGMEQIQLGK 205

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT+++LFDAMGA+SS+FN  P  ASRPYD  RDGFVI+GG  V+VLE
Sbjct: 206 QDIIFAGGGEELHWTLTHLFDAMGALSSNFNETPHRASRPYDKNRDGFVIAGGGGVVVLE 265

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGAKIYAE+TGYG+T DG DMV+PSGEGA+RCM+QAL++VE PV YIN HGT+
Sbjct: 266 ALEHAEARGAKIYAEVTGYGATSDGYDMVAPSGEGAVRCMQQALATVETPVGYINAHGTS 325

Query: 301 TPKGDKKEVEAIREVF---KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           TP GD KE+EAI+E F   K  IP I +TKSLTGH+LGAAG  E IY L+MM+E FI  S
Sbjct: 326 TPTGDIKELEAIQEAFAERKEGIPPISATKSLTGHALGAAGVNEIIYSLLMMEEGFIAAS 385

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NI+EIDP  +G PIV++R+D  +++ V+SNSFGFGGTNA LV  R
Sbjct: 386 ANIDEIDPGAEGFPIVKERMDGVELEAVMSNSFGFGGTNACLVLER 431


>gi|262277752|ref|ZP_06055545.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [alpha proteobacterium
           HIMB114]
 gi|262224855|gb|EEY75314.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [alpha proteobacterium
           HIMB114]
          Length = 403

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 242/404 (59%), Positives = 312/404 (77%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG GIVSSIGNN  EV  SL   +SGI FSE++ ++GFR QV G   LN  E +
Sbjct: 1   MRRVVITGFGIVSSIGNNNEEVLDSLLNTKSGIVFSEEYKEYGFRSQVCGSIKLNLDEAL 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +RK  RF+  G  + ++AM+EAI +S L+  +I++ +TG++ GSGGPS K ++ A D TR
Sbjct: 61  ERKEKRFMGDGSAYAYIAMKEAIKNSGLEEKDISNVKTGIVIGSGGPSIKNVIHAVDTTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  S +++GP  VP+ MSST SATL+  FKI+G +YSISSACATSAHCIGN  ELIQSGK
Sbjct: 121 KS-SPKKMGPLIVPRTMSSTCSATLAVPFKIKGINYSISSACATSAHCIGNGMELIQSGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L+W MS +FDAM A+SS  N  P  ASR YD+ RDGFVI+GGAAV+VLE
Sbjct: 180 QDIIFAGGGEELEWGMSAMFDAMPALSSKRNDTPQKASRAYDADRDGFVIAGGAAVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           EMERAK+RGAKIYAE+TGYG+T DG DMV PSGEGA+RCM+ ALS+   + VDYINTHGT
Sbjct: 240 EMERAKSRGAKIYAEITGYGATSDGYDMVQPSGEGAVRCMKMALSTKRNKKVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+EAI+E F  ++P + STKS+TGHSLGA  AQEA++CL+MM+  F+ ES N
Sbjct: 300 STPIGDVKELEAIKETFGNDVPSMSSTKSITGHSLGAVSAQEAVFCLLMMEHGFMAESAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +D + K +PI+RK ++   ++ V+SNSFGFGGTN+TL+F +
Sbjct: 360 IENLDEKAKDLPILRK-VEKKDLNCVMSNSFGFGGTNSTLIFEK 402


>gi|91792839|ref|YP_562490.1| beta-ketoacyl synthase [Shewanella denitrificans OS217]
 gi|91714841|gb|ABE54767.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella
           denitrificans OS217]
          Length = 403

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 308/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   LN AE I
Sbjct: 1   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMKLRSHVWGDIKLNPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM+EAI D+ L   + +  R GL+ GSGG S+K  V +AD  R
Sbjct: 61  DRKALRFMGDAAAYAYIAMKEAIEDANLTEEQYSDFRVGLVVGSGGASSKNQVESADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGVNYSISSACATSAHCIGHAAELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YDS RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDSDRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEIIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+ +VFK  +P + STKSLTGH+LGAAG  EAIY L+MM+  FI  S NI
Sbjct: 300 TPVGDVRELEALTQVFKDKVPPVASTKSLTGHALGAAGVHEAIYSLLMMENSFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  GIP+V +++  A++ TV+SNSFGFGGTNATLV R+YK
Sbjct: 360 DNLDEKAAGIPVV-QQMRAAELTTVMSNSFGFGGTNATLVMRKYK 403


>gi|153869446|ref|ZP_01999041.1| beta-ketoacyl synthase [Beggiatoa sp. PS]
 gi|152074057|gb|EDN70956.1| beta-ketoacyl synthase [Beggiatoa sp. PS]
          Length = 405

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 239/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIV SIGNN  EV  SLR+ RSGI F +++A  GFR  V G   L+   LI
Sbjct: 1   MKRVVITGLGIVCSIGNNKQEVLESLRQGRSGIEFHQEYADLGFRTHVHGAVHLDINALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + ++AM+EAI D+ L    I++ +TGLI GSGG S +  V AAD+ R
Sbjct: 61  DRKVRRFMGDAAAFSYVAMREAIADANLSEANISNPKTGLIIGSGGASPENQVLAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    R++GP+ VP+ M ST SA LST FKI+G +YSISSAC+TSAHCIGN  E IQ GK
Sbjct: 121 KR-GLRKVGPYMVPRTMGSTTSACLSTAFKIKGINYSISSACSTSAHCIGNGYEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W M+ LFDAMGA+SS +N  P +ASRPYD+ RDGFVISGG  ++VLE
Sbjct: 180 QDIVFAGGGEEVHWAMTVLFDAMGALSSKYNDTPKTASRPYDATRDGFVISGGGGIVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAEL GYG+  DG DMV PSGEGA+RC++Q+L +V  P+DYIN HGT+
Sbjct: 240 ELEHAKARGAKIYAELVGYGANSDGFDMVQPSGEGAVRCIQQSLETVNTPIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EAI+ VF   IP I +TKSLTGH+LGAAG  E+IY L+MM+  FI  S NI
Sbjct: 300 TPVGDMRELEAIKHVFGDQIPSISATKSLTGHALGAAGVNESIYSLLMMEANFISASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            E+DP  +G+PIVR+  +N  ++TV+SNSFGFGGTNA LVF+R+ G
Sbjct: 360 TELDPGAEGMPIVREMQENVTLNTVMSNSFGFGGTNACLVFQRFSG 405


>gi|152998237|ref|YP_001343072.1| beta-ketoacyl synthase [Marinomonas sp. MWYL1]
 gi|150839161|gb|ABR73137.1| Beta-ketoacyl synthase [Marinomonas sp. MWYL1]
          Length = 404

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 238/404 (58%), Positives = 307/404 (75%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVS +GN+   V  SLRE +SGI F+ED+ + GFR  V G+  L+A E I
Sbjct: 1   MRRVVVTGLGIVSCLGNDKESVLNSLREGQSGIRFAEDYKEHGFRSHVCGRIDLDA-ESI 59

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+    T+ +++MQ+AI DS L   ++++ RTGL+AGSGG S K +V +AD  R
Sbjct: 60  DRKIRRFMGDAATYAYVSMQQAILDSGLTEDQVSNIRTGLVAGSGGASAKNLVDSADTLR 119

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSI+SAC+TSAHCIGNA ELIQ GK
Sbjct: 120 EK-GVKRVGPYRVTQTMGSTVSACLATPFKIKGVNYSITSACSTSAHCIGNAMELIQLGK 178

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  WT + +FDAMGA+SS +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 179 QDIVFAGGGEEESWTQTCMFDAMGALSSKYNDTPEKASRAYDANRDGFVIAGGGGMLVIE 238

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAEL GYG+T DG DMV+PSGEGA+RCM+ A+S+++  +DYINTHGT+
Sbjct: 239 ELEHAKARGAKIYAELVGYGATSDGYDMVAPSGEGAVRCMQMAMSTIDGDIDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE++A+ E F  NIP I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 299 TPAGDMKELQAVNETFGDNIPLISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAASANI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +E+DP    IP+V  R DN  ++ ++SNSFGFGGTNA+LVF++Y
Sbjct: 359 DELDPAAGNIPVVTTRKDNVDLNMIMSNSFGFGGTNASLVFKKY 402


>gi|319426841|gb|ADV54915.1| Beta-ketoacyl synthase [Shewanella putrefaciens 200]
          Length = 411

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 306/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT+S  F +   R  VWG   LN AE I
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITYSAQFEEMQLRSHVWGDIKLNPAEHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEA+ D+ L   + +  R GLI G+GG S+   V +AD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAVADANLTEEQYSDPRVGLIVGTGGASSSNQVQSADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNATPEKASRTYDADRDGFVISGGGGILVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ A+  V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMAMMDVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P I STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPIASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R++K
Sbjct: 368 DNLDEAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKFK 411


>gi|292492740|ref|YP_003528179.1| beta-ketoacyl synthase [Nitrosococcus halophilus Nc4]
 gi|291581335|gb|ADE15792.1| Beta-ketoacyl synthase [Nitrosococcus halophilus Nc4]
          Length = 412

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 247/408 (60%), Positives = 307/408 (75%), Gaps = 4/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV +TG+GIVSSIGNN +EV  SL+  RSGI F +++A  G R Q+ G   ++   LI
Sbjct: 5   LRRVVITGLGIVSSIGNNKAEVVKSLKTGRSGIEFHQEYADLGLRSQIHGSVDIDIEALI 64

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+  G  + +LAM++AI D+ L    ++H RTGLI GSGGPSTK +V AAD  R
Sbjct: 65  DRKIRRFMGDGAAYNYLAMEQAIADAELASNRVSHPRTGLIMGSGGPSTKNLVLAADTLR 124

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ M ST SA L+T FKI+G +YSISSAC+TSAHCIGN  E IQ GK
Sbjct: 125 EK-GIRRVGPYMVPRTMCSTNSACLATPFKIKGINYSISSACSTSAHCIGNGVEQIQLGK 183

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT++ LFDAMGA+SS FN  P  ASRPYD  RDGFVI+GG  V+VLE
Sbjct: 184 QDIIFAGGGEELHWTLTMLFDAMGALSSKFNETPHQASRPYDRHRDGFVIAGGGGVVVLE 243

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           ++E A+ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM QAL++++ PVDYIN HGT+
Sbjct: 244 DLEHAQARGAKIYAEVVGYGATSDGYDMVAPSGEGAVRCMEQALATIDGPVDYINAHGTS 303

Query: 301 TPKGDKKEVEAIREVF---KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           TP GD KE+EAI+EVF   +G IP I STKSLTGH+LGAAG  E IY L+MM+  FI  S
Sbjct: 304 TPAGDIKELEAIQEVFADREGGIPTISSTKSLTGHALGAAGVNEVIYSLLMMEHGFIAAS 363

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N++EIDP     PI R+RID  + +TV+SNSFGFGGTNA LV  R++
Sbjct: 364 ANLDEIDPGAGEFPIARERIDRVQPETVMSNSFGFGGTNACLVLGRFR 411


>gi|153001279|ref|YP_001366960.1| beta-ketoacyl synthase [Shewanella baltica OS185]
 gi|151365897|gb|ABS08897.1| Beta-ketoacyl synthase [Shewanella baltica OS185]
          Length = 411

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 305/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   LN AE I
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGDIKLNPAEHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEA+ D+ L   + +H R GLI G+GG S+   V +AD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAVADANLTEEQYSHHRVGLIVGTGGASSSNQVQSADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNATPEKASRTYDADRDGFVISGGGGILVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ A+  V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMAMMDVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P I STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPIASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+    A+++TV+SNSFGFGGTNATLV R++K
Sbjct: 368 DNLDEAAKDMPIVRE-YRAAELNTVMSNSFGFGGTNATLVMRKFK 411


>gi|126174953|ref|YP_001051102.1| beta-ketoacyl synthase [Shewanella baltica OS155]
 gi|160875950|ref|YP_001555266.1| beta-ketoacyl synthase [Shewanella baltica OS195]
 gi|217972790|ref|YP_002357541.1| beta-ketoacyl synthase [Shewanella baltica OS223]
 gi|125998158|gb|ABN62233.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella baltica
           OS155]
 gi|160861472|gb|ABX50006.1| Beta-ketoacyl synthase [Shewanella baltica OS195]
 gi|217497925|gb|ACK46118.1| Beta-ketoacyl synthase [Shewanella baltica OS223]
 gi|315268145|gb|ADT94998.1| Beta-ketoacyl synthase [Shewanella baltica OS678]
          Length = 411

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/405 (59%), Positives = 306/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   LN AE I
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGDIKLNPAEHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEA++D+ L   + +  R GLI G+GG S+   V +AD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAVSDANLTEEQYSDPRVGLIVGTGGASSSNQVQSADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNATPEKASRTYDADRDGFVISGGGGILVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ A+  V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMAMMDVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P I STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPIASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R++K
Sbjct: 368 ENLDDAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKFK 411


>gi|120598381|ref|YP_962955.1| beta-ketoacyl synthase [Shewanella sp. W3-18-1]
 gi|120558474|gb|ABM24401.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella sp.
           W3-18-1]
          Length = 411

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/405 (59%), Positives = 305/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   LN AE I
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGDIKLNPAEHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEA+ D+ L   + +  R GLI G+GG S+   V +AD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAVADANLTEEQYSDPRVGLIVGTGGASSSNQVQSADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNATPEKASRTYDADRDGFVISGGGGILVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ A+  V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMAMMDVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P I STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPIASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R++K
Sbjct: 368 ENLDEAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKFK 411


>gi|119945679|ref|YP_943359.1| beta-ketoacyl synthase [Psychromonas ingrahamii 37]
 gi|119864283|gb|ABM03760.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Psychromonas
           ingrahamii 37]
          Length = 404

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/404 (59%), Positives = 305/404 (75%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+  +SGI+FSE FA+   R QVWG   +   + I
Sbjct: 1   MKRAVITGIGIVSSIGNNKEEVLASLKSGKSGISFSEQFAEMKMRSQVWGDLKIEPKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D++L    +++ERTGL+AGSGG S+K  V A  L  
Sbjct: 61  DRKIMRFMGDAAAYAYLSMEQAIADAQLTDDLVSNERTGLVAGSGGGSSKNQVEACKLMV 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ M+ST SA L+T FKI+G +YS+SSACATS+HCIGNA E IQ GK
Sbjct: 121 EK-GVRRVGPYMVPRTMASTTSACLATPFKIKGINYSMSSACATSSHCIGNALEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWTM+  FDAMGA+SS FN  P SASR YD++RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWTMACEFDAMGALSSKFNDTPSSASRTYDAKRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V+  VDY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVDGEVDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI  VF    P I +TKS TGHSLGAAG  E IY L+MM+  FI  S NI
Sbjct: 300 TPVGDTKELEAINIVFPDKAPKISATKSQTGHSLGAAGVHETIYSLLMMENDFISPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +EID +   +PIV  +  +AK++ V+SNSFGFGGTNATLVF+R+
Sbjct: 360 DEIDEKAVNLPIVANKAVDAKLNIVMSNSFGFGGTNATLVFKRF 403


>gi|146307493|ref|YP_001187958.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas mendocina
           ymp]
 gi|145575694|gb|ABP85226.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudomonas mendocina
           ymp]
          Length = 406

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 306/406 (75%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +G +   VA SLR  +SGI F+  +A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGTDKEAVAASLRAGKSGIRFNPSYAEMGLRSQVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M++AI D+ L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVYRFMGDAAAFAYLSMEQAIKDAGLSEEQVSNPRTGLIAGSGGASTFNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M ST SA L+T FKI+G +YSISSACATSAHCIG+A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVPRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGHAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDMVFAGGGEEEHWSQSFLFDAMGALSTQYNETPDKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMQQALATVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E  A+REVF   +P I STKSL+GHSLGAAG QEAIYC++MM+  FI  S NI
Sbjct: 300 TPVGDVAESRAVREVFGDKMPAISSTKSLSGHSLGAAGVQEAIYCMLMMEGDFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DP+   +PI  K ++NAK+DTV+SNSFGFGGTNATLV +R+ G
Sbjct: 360 DEVDPDVADLPIQLKTVENAKLDTVMSNSFGFGGTNATLVLKRWTG 405


>gi|304411869|ref|ZP_07393480.1| Beta-ketoacyl synthase [Shewanella baltica OS183]
 gi|307303363|ref|ZP_07583118.1| Beta-ketoacyl synthase [Shewanella baltica BA175]
 gi|304349729|gb|EFM14136.1| Beta-ketoacyl synthase [Shewanella baltica OS183]
 gi|306913723|gb|EFN44145.1| Beta-ketoacyl synthase [Shewanella baltica BA175]
          Length = 411

 Score =  495 bits (1274), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 306/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   LN AE I
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGDIKLNPAEHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEA++D+ L   + +  R GLI G+GG S+   V +AD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAVSDANLTEEQYSDPRVGLIVGTGGASSSNQVQSADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q+++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QNMVFAGGAEEVDWTLTMGFDAMGALSTKYNATPEKASRTYDADRDGFVISGGGGILVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ A+  V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMAMMDVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P I STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPIASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D   K +PIVR+  D A+++TV+SNSFGFGGTNATLV R++K
Sbjct: 368 ENLDDAAKDMPIVREYRD-AELNTVMSNSFGFGGTNATLVMRKFK 411


>gi|146293541|ref|YP_001183965.1| beta-ketoacyl synthase [Shewanella putrefaciens CN-32]
 gi|145565231|gb|ABP76166.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella
           putrefaciens CN-32]
          Length = 411

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 239/405 (59%), Positives = 304/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMG+VSSIGNN  EV  SL+  RSGIT S  F +   R  VWG   LN AE I
Sbjct: 9   MKRVVITGMGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMQLRSHVWGDIKLNPAEHI 68

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQEA+ D+ L   + +  R GLI G+GG S+   V +AD  R
Sbjct: 69  DRKALRFMGDAAAYAYIAMQEAVADANLTEEQYSDPRVGLIVGTGGASSSNQVQSADTLR 128

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 129 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 187

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 188 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNATPEKASRTYDADRDGFVISGGGGILVVE 247

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ A+  V+ P+DYINTHGT+
Sbjct: 248 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMAMMDVDTPIDYINTHGTS 307

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+REVFK   P I STKS+TGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 308 TPVGDVRELEALREVFKDKCPPIASTKSMTGHALGAAGVHEAIYSLIMMENSFIAPSINI 367

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   K +PIVR+  D  +++TV+SNSFGFGGTNATLV R++K
Sbjct: 368 DNLDEAAKDMPIVREYRDT-ELNTVMSNSFGFGGTNATLVMRKFK 411


>gi|269102110|ref|ZP_06154807.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162008|gb|EEZ40504.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 404

 Score =  494 bits (1271), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 307/406 (75%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGI+SSIGNNV EV  SL+  +SGI FSE FA+   R QVWG   +N AE I
Sbjct: 1   MKRAVITGMGIISSIGNNVEEVLESLKAGKSGINFSEQFAEMKLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     +  L+M++AI DS L   ++++ERTGL+AGSGG S+   V+A D+ R
Sbjct: 61  DRKQMRFMGNAAAYAFLSMEQAIADSGLTEDQVSNERTGLVAGSGGASSMNQVAAVDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDDPSKASRTYDADRDGFVISGGGGMVVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ PVDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEVVGYGATSDGYDMVAPSGEGAVRCMKMAMQDLDAPVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFSENCPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++++G
Sbjct: 360 ENLDEAAQGLDIVTE-MREQELKTVMSNSFGFGGTNATLVIKKFEG 404


>gi|254503464|ref|ZP_05115615.1| Beta-ketoacyl synthase, N-terminal domain protein [Labrenzia
           alexandrii DFL-11]
 gi|222439535|gb|EEE46214.1| Beta-ketoacyl synthase, N-terminal domain protein [Labrenzia
           alexandrii DFL-11]
          Length = 407

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 251/407 (61%), Positives = 310/407 (76%), Gaps = 1/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG+N  EV  SLRE +SGI+F+ D+A+ GFR QV G P ++  ELI
Sbjct: 1   MRRVVVTGIGIVSSIGSNAQEVLASLREGKSGISFAPDYAEHGFRSQVHGMPNIDIPELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + +++MQ+AI DS L+  ++++ER+GLI GSGGPSTK +  A  +  
Sbjct: 61  DKRQLRFMGDGAAYNYISMQQAIADSGLEESDVSNERSGLIMGSGGPSTKNLFQAHKIVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIG A E IQ GK
Sbjct: 121 EKGSPKRMGPFMVTRGMSSTNSACLATPFKIKGINYSITSACSTSAHCIGAATEQIQFGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P +ASR YD+ RDGFVI+GG  V+VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPQTASRAYDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E+E AKARGAKIYAE+TGY +  DG DMV+PSGEG  RCMR A S++ +  VDYIN+HGT
Sbjct: 241 ELEHAKARGAKIYAEVTGYAANSDGYDMVAPSGEGGERCMRIATSTLGDRKVDYINSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD  E+EAIR VF  N P + STKSLTGHSLGA G QEAIYCL+MMQ  FI  S N
Sbjct: 301 STPVGDVGEIEAIRRVFGENQPPVSSTKSLTGHSLGATGVQEAIYCLLMMQNDFITASAN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + E+DP  K   IV  R+DNA +DTVLSNSFGFGGTNA+L   RY G
Sbjct: 361 VNELDPALKPEEIVTTRVDNAGLDTVLSNSFGFGGTNASLAMSRYHG 407


>gi|116049554|ref|YP_791642.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892434|ref|YP_002441301.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas aeruginosa
           LESB58]
 gi|296390017|ref|ZP_06879492.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas aeruginosa
           PAb1]
 gi|313106623|ref|ZP_07792848.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa 39016]
 gi|115584775|gb|ABJ10790.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218772660|emb|CAW28445.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa LESB58]
 gi|310879350|gb|EFQ37944.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa 39016]
          Length = 405

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L P +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+R+  +NAK+DTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRETRENAKLDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|330503210|ref|YP_004380079.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas mendocina
           NK-01]
 gi|328917496|gb|AEB58327.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas mendocina
           NK-01]
          Length = 406

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 239/406 (58%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   VA SLR  +SGI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKEAVADSLRAGKSGIRFNPSYAEMGLRSHVSGSVNLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKLFRFMGDAAAYAYLAMEQAIKDSGLSEEQISNPRTGLIAGSGGASTVNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T FKI+G ++SISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFKIKGVNFSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNDTPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG QEAIYC++MM+  FI  S NI
Sbjct: 300 TPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVQEAIYCMLMMEGNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI    ++NAK+DTV+SNSFGFGGTNATLV +R+ G
Sbjct: 360 DELDPEVADMPIQLTTVENAKLDTVMSNSFGFGGTNATLVLKRWAG 405


>gi|87122770|ref|ZP_01078643.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Marinomonas sp.
           MED121]
 gi|86161935|gb|EAQ63227.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Marinomonas sp.
           MED121]
          Length = 405

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 306/405 (75%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVS +GN+   V  SL E +SGI F++D+ + GFR  V G+  L++ E+I
Sbjct: 1   MRRVVVTGLGIVSCLGNDKESVLNSLLEGKSGIRFADDYKEMGFRSHVCGRIDLDSDEMI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+    T+ +++MQ+AITDS L   ++++ RTGLIAGSGG S   +V +AD  R
Sbjct: 61  DRKTRRFMGPAATYAYVSMQQAITDSGLTEEQVSNVRTGLIAGSGGASAGNLVDSADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ V + M ST SA L+T FKI+G +YSI+SAC+TSAHCIGNA ELIQ GK
Sbjct: 121 NK-GVKRVGPYRVTQTMGSTVSACLATPFKIKGVNYSITSACSTSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  WT + +FDAMGA+SS +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEESWTQTCMFDAMGALSSKYNETPEIASRAYDANRDGFVIAGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY EL GYG+T DG DMV+PSGEGA+RCM+ A+S+ E  +DYINTHGT+
Sbjct: 240 ELEHAKARGAKIYGELVGYGATSDGYDMVAPSGEGAVRCMQMAMSTTEGDIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE++A+ E F G+IP I STKSL+GHSLGAAG  EAIY L+MM+  FI  S N+
Sbjct: 300 TPAGDMKELQAVNETFGGDIPKISSTKSLSGHSLGAAGVHEAIYSLLMMENDFIVASANV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E+D     IP+V KRIDNA +  ++SNSFGFGGTNA+LVF++Y+
Sbjct: 360 DELDEAAGDIPVVTKRIDNANLKQIMSNSFGFGGTNASLVFKKYE 404


>gi|260772343|ref|ZP_05881259.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio
           metschnikovii CIP 69.14]
 gi|260611482|gb|EEX36685.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio
           metschnikovii CIP 69.14]
          Length = 403

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/405 (58%), Positives = 307/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIISSIGNNVQEVLASLKAGKSGITASEQFKEQGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L P +++++RTG+IAGSGG S+     A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMEQAIADAGLTPEQVSNDRTGIIAGSGGASSLNQSIAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRIGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT++ +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWTLTMMFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY EL GYG+T DG DMV+PSGEGA RCMR A+ +V+  VDY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGELVGYGATSDGYDMVAPSGEGAARCMRMAMQNVDS-VDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQEIFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +DP  +G+ IV +  +  ++++V+SNSFGFGGTNATLV ++Y+
Sbjct: 359 DTLDPAAEGLDIVTQPREQ-ELNSVMSNSFGFGGTNATLVIKKYQ 402


>gi|332141786|ref|YP_004427524.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327551808|gb|AEA98526.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 404

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 239/407 (58%), Positives = 312/407 (76%), Gaps = 4/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIG N  +V  SL+  +SGITFSE FA+ G R QVWG   ++  E I
Sbjct: 1   MRRAVITGLGIVSSIGVNKEDVLASLKAGKSGITFSEQFAEMGLRSQVWGDIEIDLKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + ++AMQ+AI DS L+  +I++ERTG+IAGSGG S++  V +AD+ R
Sbjct: 61  DRKAMRFMGDAAGYAYVAMQQAIADSGLEESDISNERTGIIAGSGGASSENQVLSADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKIRG +YSI+SACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRCMASTVSACLATPFKIRGVNYSIASACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W++S+ FDAMGA+SS +N +P  ASR YD+ RDGFV SGG  ++V+E
Sbjct: 180 QDVVFAGGGEELHWSLSSQFDAMGALSSKYNDNPAVASRTYDAARDGFVSSGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+ +++ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEVVGYGATSDGFDMVAPSGEGAIRCMKMAMQNIDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD KE+ AI+EVF +  +P I +TKSLTGH+LGAAG  EAIY L+MM+  FI  S N
Sbjct: 300 TPVGDVKELAAIQEVFGQAGVP-ISATKSLTGHALGAAGVNEAIYSLLMMENNFIAPSIN 358

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+ +D   +G+ IV +  + A ++TV+SNSFGFGGTNATLV +RY G
Sbjct: 359 IDTLDDAAQGLDIVTQARE-ATLNTVMSNSFGFGGTNATLVMQRYNG 404


>gi|107101041|ref|ZP_01364959.1| hypothetical protein PaerPA_01002071 [Pseudomonas aeruginosa PACS2]
          Length = 405

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L P +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNDTPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+R+  +NAK+DTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRETRENAKLDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|294085140|ref|YP_003551900.1| beta-ketoacyl synthase [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664715|gb|ADE39816.1| Beta-ketoacyl synthase [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 432

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 243/410 (59%), Positives = 307/410 (74%), Gaps = 8/410 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRVA+TG+GIVSSIGNNV+EV  SLR   SGI  + ++ + GFR QV G   ++ AE I
Sbjct: 23  MRRVAITGIGIVSSIGNNVAEVTESLRAGTSGIVAAPEYTELGFRSQVHGTVKMDVAEHI 82

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+ +G  +  LAM++AI DS L   ++++ RTGLIAGSGGPST  +++A D TR
Sbjct: 83  DRKQMRFMGEGAAYAVLAMEQAIADSGLGEDDVSNPRTGLIAGSGGPSTANMLTAFDTTR 142

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA ++T+FKI+G +YSI+SAC+TSAHCI + A+ I+SG 
Sbjct: 143 EK-GPKRVGPYMVPRCMSSTVSACIATFFKIKGLNYSITSACSTSAHCITSGADAIRSGS 201

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT+S LFDAMGAMSS +N  P  ASR YDS RDGFVI+GG  ++VLE
Sbjct: 202 QDIVFAGGGEELHWTLSVLFDAMGAMSSKYNDAPEKASRAYDSDRDGFVIAGGGGMVVLE 261

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQAL-----SSVEEPVDYIN 295
           +M+RA ARGAKIYAEL GYG+  DG DMV+PSGEGA+RCM+ AL     + +++ VDYIN
Sbjct: 262 DMDRAIARGAKIYAELVGYGANSDGHDMVAPSGEGAVRCMQLALDGFDGNKLDDKVDYIN 321

Query: 296 THGTATPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERF 353
            HGT+TP GD KE++A+REVF  +G +P + STKSLTGHSLGA G QEAIY +IMMQ  F
Sbjct: 322 AHGTSTPVGDAKELDAVREVFGPRGYLPVVTSTKSLTGHSLGATGVQEAIYTMIMMQNGF 381

Query: 354 IGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I  S NI+  DP    IP+   R+DN  I   LSNSFGFGGTNATL  R+
Sbjct: 382 IAASANIDNPDPAIGDIPVPSTRMDNVDITLALSNSFGFGGTNATLALRK 431


>gi|126730921|ref|ZP_01746730.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Sagittula stellata E-37]
 gi|126708637|gb|EBA07694.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Sagittula stellata E-37]
          Length = 409

 Score =  491 bits (1264), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 238/408 (58%), Positives = 305/408 (74%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  RSGI+ SE+  + GFR Q+ G+  ++ +E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVTASLKAGRSGISASEEMKEHGFRSQISGQLKIDVSEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AMQ+AI DS L+  ++ + RTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMQQAIADSGLEETDVVNPRTGLVAGSGGPSTSALLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +   T+R+GPFAVPKAM ST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KSGGTKRVGPFAVPKAMCSTISANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVISGG  ++VLE
Sbjct: 181 QDIMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDAGRDGFVISGGGGILVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           ++E AKARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR ALS+V E   V YIN HG
Sbjct: 241 DLEHAKARGAKIYAEVTGYGATSDGADMVAPSGEGGERAMRVALSTVPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF  G+ P + STKS+TGHS GA GAQEAIYCL+ +++ FI  S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGDGSTPPVSSTKSMTGHSQGATGAQEAIYCLLALKDDFIIPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+E +DP  K   I    ++NA +D+V++NSFGFGGTN ++V  R+ 
Sbjct: 361 INVETLDPALKPEEIATSLVENAGLDSVMTNSFGFGGTNGSMVLSRFN 408


>gi|260767684|ref|ZP_05876619.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio furnissii
           CIP 102972]
 gi|260617193|gb|EEX42377.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio furnissii
           CIP 102972]
 gi|315179484|gb|ADT86398.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio furnissii NCTC
           11218]
          Length = 403

 Score =  491 bits (1264), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 308/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGI  SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGINASEQFKENGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI DS L P +++++RTG+IAGSGG S+   V+A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADSGLSPEQVSNDRTGIIAGSGGASSMNQVTAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+++ +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSLTMMFDAMGALSTKYNDTPQKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V + VDY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQNV-DAVDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+++F GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQQIFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV +  +  ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDEAAQGLDIVTETREQ-ELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|326793604|ref|YP_004311424.1| beta-ketoacyl-acyl-carrier-protein synthase I [Marinomonas
           mediterranea MMB-1]
 gi|326544368|gb|ADZ89588.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Marinomonas
           mediterranea MMB-1]
          Length = 404

 Score =  491 bits (1264), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 308/406 (75%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+G+VS +GN+   V  SL+E +SGI F++D+ + GFR  + G+  ++A  +I
Sbjct: 1   MRRVVVTGLGVVSCLGNDKESVLDSLKEGKSGIRFADDYKEHGFRSHICGRIDVDAT-VI 59

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+    T+ +L+MQ+AI DS L   ++++ RTGLIAGSGG S + +V +AD  R
Sbjct: 60  DRKVRRFMGDAATYAYLSMQQAIADSGLSEDQVSNVRTGLIAGSGGASAQNLVDSADTLR 119

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 120 EK-GVKRVGPYRVTQTMGSTVSACLATPFKIKGVNYSITSACSTSAHCIGNGMELIQLGK 178

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  WT + +FDAMGA+SS  N  P  ASR YD+ RDGFVI+GG  ++VLE
Sbjct: 179 QDIVFAGGGEEESWTQTCMFDAMGALSSKRNDTPEQASRAYDATRDGFVIAGGGGMLVLE 238

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+S+++  +DYINTHGT+
Sbjct: 239 ELEHAKARGAKIYAEVVGYGATSDGYDMVAPSGEGAMRCMQMAMSTIDGDIDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE++A++E F   IP I STKSL+GHSLGAAG  EA+Y L+MM+  FI  S N+
Sbjct: 299 TPAGDMKELQAVKETFGDKIPSISSTKSLSGHSLGAAGVHEAVYSLLMMENNFIAASANV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EE+DPE  GIP+V +R DN  +  V+SNSFGFGGTNA+LVF++Y+G
Sbjct: 359 EELDPEADGIPVVTERQDNVDLKHVMSNSFGFGGTNASLVFKKYEG 404


>gi|127513338|ref|YP_001094535.1| beta-ketoacyl synthase [Shewanella loihica PV-4]
 gi|126638633|gb|ABO24276.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shewanella loihica
           PV-4]
          Length = 403

 Score =  491 bits (1264), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/405 (58%), Positives = 307/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SL+  RSGIT S+ F +   R  VWG   L+  E I
Sbjct: 1   MKRVVITGLGIVSSIGNNKQEVTESLKAGRSGITHSDQFEEMKLRSHVWGDIKLDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM++AI D+ L   + ++ R G+IAG+GG S+   V AAD  R
Sbjct: 61  DRKALRFMGDAAAYAYIAMEQAIADAGLTEEQYSNHRVGIIAGTGGASSANQVQAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGAEEVDWTLTMGFDAMGALSTKYNDCPEKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL  V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMKMALEGVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+ E F  N+P I STKSLTGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDMRELEALAETFGDNLPAIASTKSLTGHALGAAGVHEAIYSLIMMENSFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D + +G+PIV +  D A+++T++SNSFGFGGTNATLV R+YK
Sbjct: 360 DTLDEKAQGMPIVTEYRD-AELNTIMSNSFGFGGTNATLVMRKYK 403


>gi|126727634|ref|ZP_01743466.1| 3-oxoacyl-(Acyl-carrier-protein) synthase [Rhodobacterales
           bacterium HTCC2150]
 gi|126703050|gb|EBA02151.1| 3-oxoacyl-(Acyl-carrier-protein) synthase [Rhodobacterales
           bacterium HTCC2150]
          Length = 408

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 240/408 (58%), Positives = 302/408 (74%), Gaps = 2/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSSIGNNV+EV  SLRE+RSGIT S D  + GFR +V G P ++  E +
Sbjct: 1   MRRVVITGMGIVSSIGNNVAEVTKSLRESRSGITASSDMTENGFRSRVHGMPSIDVTEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AM++AI DS L+  ++++ERTGL+ GSGGPST  + +A ++ +
Sbjct: 61  DKRNLRFMGTGAAYNFIAMEQAIADSGLEESDVSNERTGLVMGSGGPSTMNLFAAHNIVK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  + +R+GPF V + MSST SA L+T FKI+G +YSI+SAC TS HCIGN  E IQ GK
Sbjct: 121 EKGAPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACTTSLHCIGNGVEQIQFGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N DP  ASR +D+ RDGFVISGG  V+VLE
Sbjct: 181 QDIVFAGGGEELDWTLSCLFDAMGAMSSKYNDDPTKASRAFDANRDGFVISGGGGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E+E AKARGAKIYAE+TGYG+T DG DMV+PSGEGA R M+ A++++ +  V YIN HGT
Sbjct: 241 ELEHAKARGAKIYAEVTGYGATSDGHDMVAPSGEGAERSMKLAMATLGDRKVGYINAHGT 300

Query: 300 ATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           +TP GD  EV A+R  F +GN P I STKSLTGH LG AG  EAIY LIM+   FI  S 
Sbjct: 301 STPAGDVTEVHAVRRAFGEGNTPKITSTKSLTGHCLGGAGVHEAIYSLIMLGGNFIAPSA 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           NIE +DPE     I    I+NA +DTV+SNSFGFGGTN T+   +Y G
Sbjct: 361 NIETLDPEIHADEIATTMIENAGLDTVMSNSFGFGGTNGTIAMSKYLG 408


>gi|325273500|ref|ZP_08139738.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas sp.
           TJI-51]
 gi|324101376|gb|EGB98984.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas sp.
           TJI-51]
          Length = 406

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 240/406 (59%), Positives = 304/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+ + V  +LR +R GI ++ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRYNPEYKEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI DS L   ++++ RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDSGLTEEQVSNPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGINYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QALS+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +REVFK   P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEMKGVREVFKDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+D E   +PI+RK  +NAKIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDAEVADLPILRKTEENAKIDTVMSNSFGFGGTNATLVLKRWEG 405


>gi|152987591|ref|YP_001349019.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas aeruginosa
           PA7]
 gi|150962749|gb|ABR84774.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa PA7]
          Length = 405

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L P +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNDTPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+R+  +NA++DTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRETRENARLDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|294678190|ref|YP_003578805.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodobacter capsulatus
           SB 1003]
 gi|294477010|gb|ADE86398.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodobacter capsulatus
           SB 1003]
          Length = 409

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 242/409 (59%), Positives = 304/409 (74%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGN+  EV+ SLR  RSGI F+ ++A+ GFR Q+ G P +   + I
Sbjct: 1   MRRVVITGLGIVSPIGNSAEEVSASLRAGRSGIVFAPEYAERGFRSQIHGAPQIVLEDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+ +G  +  L+M++AI DS L+  +I++ RTGLI GSGGPST     A     
Sbjct: 61  DKRNLRFMGRGAAYNFLSMEQAIRDSGLEESDISNPRTGLIMGSGGPSTSNFFEAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  + +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGNAAELIQ GK
Sbjct: 121 QKGAPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNAAELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +A+R +D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIIFAGGGEELDWTLSCLFDAMGAMSSKYNDTPTTAARAFDATRDGFVIAGGGGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E AKARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR AL ++ E   + YIN HG
Sbjct: 241 ELEHAKARGAKIYAEVTGYGATSDGYDMVAPSGEGGERSMRLALGTLPEGRQITYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF  G +P I STKSLTGHSLGA G  EAIYCL+MMQ +FI  S
Sbjct: 301 TSTPAGDVTEVEAVRRVFGAGKVPPISSTKSLTGHSLGATGVHEAIYCLLMMQGKFITAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+ E+DP  K   I  K ++N + D+VLSNSFGFGGTNATLV   YKG
Sbjct: 361 ANVTELDPAIKPEEIATKLVENVEFDSVLSNSFGFGGTNATLVMSAYKG 409


>gi|27365331|ref|NP_760859.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio vulnificus
           CMCP6]
 gi|37680613|ref|NP_935222.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Vibrio vulnificus YJ016]
 gi|320155716|ref|YP_004188095.1| 3-oxoacyl-(acyl-carrier-protein) synthase KASI [Vibrio vulnificus
           MO6-24/O]
 gi|27361478|gb|AAO10386.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Vibrio vulnificus
           CMCP6]
 gi|37199361|dbj|BAC95193.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Vibrio vulnificus YJ016]
 gi|319931028|gb|ADV85892.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Vibrio vulnificus
           MO6-24/O]
          Length = 403

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 309/406 (76%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +  A+ I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITSSEQFKEKGLRSQVWGDLKITPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L   +++++RTG++AGSGG S+    +A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMEQAIADAGLTEDQVSNDRTGIVAGSGGASSLNQAAAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+AAELIQ GK
Sbjct: 121 EK-GVKRIGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT++ +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWTLTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  VE+ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDVEK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQEVFAGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV + +  A+++TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDAAAEGLDIVTE-MREAELNTVMSNSFGFGGTNATLVIKKYQG 403


>gi|307543858|ref|YP_003896337.1| 3-oxoacyl-(acyl carrier protein) synthase I [Halomonas elongata DSM
           2581]
 gi|307215882|emb|CBV41152.1| 3-oxoacyl-(acyl carrier protein) synthase I [Halomonas elongata DSM
           2581]
          Length = 404

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/405 (59%), Positives = 303/405 (74%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVS +GN+  +V  +LR  RSGI F +D+A+ GFR Q+ G   ++   L+
Sbjct: 1   MRRVVVTGLGIVSCLGNDAQQVLEALRLGRSGIRFKDDYAERGFRSQIAGVVDIDLEALV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +++M +AI DS L P ++++ERTGLIAGSGG S+   V AAD+ R
Sbjct: 61  DRKLRRFMGDAAAYAYVSMAQAIEDSGLAPDQVSNERTGLIAGSGGASSANQVEAADVMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GLRRVGPYRVTRTMGSTVSACLATPFEIKGVNYSISSACATSAHCIGNAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  WT+S LFDAMGA+S+H+N  P  ASRPYD  RDGFVI+GG  ++VLE
Sbjct: 180 QDVVFAGGGEEEHWTLSCLFDAMGALSTHYNESPEQASRPYDQSRDGFVIAGGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAEL GYG+T DG DMV+PSGEGA+RCMRQAL++V+  +DYINTHGT+
Sbjct: 240 ELEHAKARGAKIYAELVGYGATSDGHDMVAPSGEGAVRCMRQALATVDGDIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A+REVF    P + STKSLTGHSLGA G QE IY L+MM+  FI  S N+
Sbjct: 300 TPVGDVAELKAVREVFGDTTPAMSSTKSLTGHSLGATGVQETIYSLLMMEHDFIAASANV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D +  G  IV +R D A ++ VLSNSFGFGGTNA LV +RY+
Sbjct: 360 ENLDEQAAGFDIVTERRD-ASLERVLSNSFGFGGTNACLVLQRYR 403


>gi|229589352|ref|YP_002871471.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas
           fluorescens SBW25]
 gi|229361218|emb|CAY48082.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudomonas
           fluorescens SBW25]
          Length = 406

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR +R GI F+ ++A+ G R QV G   L   ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRASRPGIRFNPEYAEMGLRSQVSGSIDLPLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAIADSGLSEDQVSNVRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T F I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFAIKGVNYSISSACATSAHCIGTAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ A+S+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMAMSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+E +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  F+  S NI
Sbjct: 300 TPVGDAKEMEGVRAVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGNFMAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +EIDP    +PI+ K ++NAKIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DEIDPVVADMPILTKTVENAKIDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|83949583|ref|ZP_00958316.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius nubinhibens
           ISM]
 gi|83837482|gb|EAP76778.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius nubinhibens
           ISM]
          Length = 409

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 240/409 (58%), Positives = 303/409 (74%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  RSGIT +ED  + GFR QV G   L+ +E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLASLKAGRSGITANEDMKEHGFRSQVAGAVNLDVSEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L+  +I + RTGLIAGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMSQAIADAGLEESDIVNPRTGLIAGSGGPSTSAMLAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  ST+RIGPFAVPK M ST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGSTKRIGPFAVPKTMCSTISANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS FN  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKFNDTPERASRAFDVDRDGFVISGGGGILVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E++ A+ARGAKIYAE+TG+G+T DG DMV+PSGEG  R MR AL  + E   V YIN HG
Sbjct: 241 ELDHARARGAKIYAEVTGFGATSDGADMVAPSGEGGERAMRLALDGLPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G+ P I STKS+TGHS GA GAQEA+YCL+ ++  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGSTPPISSTKSMTGHSQGATGAQEAVYCLLALEHDFIIPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +DP  K   I   R+DNA +DTV++NSFGFGGTN +++  +++G
Sbjct: 361 INVDTLDPALKPEEIATARVDNAGLDTVMTNSFGFGGTNGSMLLSKFQG 409


>gi|254455895|ref|ZP_05069324.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082897|gb|EDZ60323.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 403

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/403 (57%), Positives = 303/403 (75%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+G+VS +GNN  EV  SL  ++SGI+++E++ +   +  V GKP +   + I
Sbjct: 1   MRRVVITGLGVVSCLGNNQEEVHKSLLNSKSGISYAEEYKEHNLKSHVHGKPNIKLEDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+  G  + ++AM+EAI DS L+  E+++ +TG+I GSGGPS + ++ AAD TR
Sbjct: 61  DRKTIRFMGSGSAYNYIAMKEAIEDSGLEETEVSNFKTGIIMGSGGPSIENVILAADKTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              + + +GPF VP+ M+STASATL+  FKI+GT+Y++SSACATS HCIGN+ ELIQ GK
Sbjct: 121 AK-TPKLMGPFIVPRTMASTASATLAVPFKIKGTNYTMSSACATSGHCIGNSMELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++F+GG E++ W M+ +FDAM A+SS +N  P +ASR YD  RDGFVI+GGA V+VLE
Sbjct: 180 QDVVFSGGSEEVHWAMTAMFDAMTALSSKYNDAPETASRAYDKTRDGFVIAGGAGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGAKIYAELTGYG+T DG DMV+PSGEGA+RCM+ A+S+ +  +DYINTHGT+
Sbjct: 240 EYEHAKARGAKIYAELTGYGATSDGYDMVAPSGEGAVRCMQMAMSTAKNKIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A++  F  NIP I STKSL+GH LGAA   EAIYCLIMM+  FI  S NI
Sbjct: 300 TPVGDITELNAVKNTFGDNIPKISSTKSLSGHPLGAASVHEAIYCLIMMKNNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+D E K  PIV K   NA ++TV+SNSFGFGGTNA L+F +
Sbjct: 360 NEMDEEAKKFPIVAKTETNATLNTVMSNSFGFGGTNAALIFEK 402


>gi|330980741|gb|EGH78844.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. aptata str. DSM 50252]
          Length = 407

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 240/407 (58%), Positives = 301/407 (73%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMKDAITDSGLTEEQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPDKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  ++   +DYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMKMALGDIDSGAIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGANAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           IEE+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IEELDPVVADMPILLKTKEDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|312959861|ref|ZP_07774376.1| beta-ketoacyl-ACP synthase I [Pseudomonas fluorescens WH6]
 gi|311285808|gb|EFQ64374.1| beta-ketoacyl-ACP synthase I [Pseudomonas fluorescens WH6]
          Length = 406

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR +R GI F+ ++A+ G R QV G   L   ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRASRPGIRFNPEYAEMGLRSQVSGSIDLPLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAIADSGLSEDQVSNVRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGTAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ A+S+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMAMSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+E +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  F+  S NI
Sbjct: 300 TPVGDAKEMEGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMEGNFMAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +EIDP    +PI+ K ++N KIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DEIDPVVADMPILTKTVENVKIDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|28869412|ref|NP_792031.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213968173|ref|ZP_03396318.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudomonas syringae
           pv. tomato T1]
 gi|301383821|ref|ZP_07232239.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. tomato Max13]
 gi|302058500|ref|ZP_07250041.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. tomato K40]
 gi|302133388|ref|ZP_07259378.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|28852653|gb|AAO55726.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213927153|gb|EEB60703.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudomonas syringae
           pv. tomato T1]
 gi|331018587|gb|EGH98643.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 407

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 241/407 (59%), Positives = 303/407 (74%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAITDSGLSDDQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL+ V++  VDYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALADVDKNDVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGTNAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPAIADMPILLKTREDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|59712307|ref|YP_205083.1| 3-oxoacyl-(acyl-carrier-protein)-synthase [Vibrio fischeri ES114]
 gi|197335268|ref|YP_002156521.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Vibrio fischeri MJ11]
 gi|59480408|gb|AAW86195.1| 3-oxoacyl-(acyl-carrier-protein)-synthase [Vibrio fischeri ES114]
 gi|197316758|gb|ACH66205.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Vibrio fischeri MJ11]
          Length = 403

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 309/405 (76%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNN  EV  SL+  +SGI FSE FA+ G R  VWG   +N A+ I
Sbjct: 1   MKRAVITGMGIVSSIGNNAEEVLESLKAGKSGINFSEQFAEKGLRSNVWGDLKMNPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +++M++A+ DS L   ++++ERTG++AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYISMEQAVADSGLTEDQVSNERTGIVAGSGGASSLNQVNAVDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKI+G +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTVSACLATPFKIKGVNYSMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW+++ +FDAMGA+SS +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVMFAGGGEELDWSLTMMFDAMGALSSKYNDTPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V+  VDY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQNVDS-VDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF  N P I +TK++TGH+LGAAG  EAIY  +M++  FI  S N+
Sbjct: 299 TPVGDAKELGAIQEVFGANSPAISATKAMTGHALGAAGVHEAIYSTLMLEHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +DP  +G+ IV ++ D A ++TV+SNSFGFGGTNATLV ++Y+
Sbjct: 359 ETLDPAAEGLDIVTEKRDQA-LNTVMSNSFGFGGTNATLVIKKYE 402


>gi|89093575|ref|ZP_01166523.1| 3-oxoacyl-(acyl carrier protein) synthase [Oceanospirillum sp.
           MED92]
 gi|89082265|gb|EAR61489.1| 3-oxoacyl-(acyl carrier protein) synthase [Oceanospirillum sp.
           MED92]
          Length = 405

 Score =  489 bits (1258), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 233/403 (57%), Positives = 302/403 (74%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS +G +   V  SL++ RSGI F ED+ + GFR QV G   ++ +E I
Sbjct: 1   MRRVVVTGMGIVSCLGTDKEAVLESLQQGRSGIKFQEDYKERGFRSQVAGSIDIDFSEKI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQEAI DS L   ++++ERTGLI GSGG S   IV  AD+TR
Sbjct: 61  DRKLLRFMGDAAAYTYIAMQEAIADSGLGEDQVSNERTGLIVGSGGASADNIVETADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSI+SACATSAHCIGNAAE IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSITSACATSAHCIGNAAEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  + +FDAMGA+SS +N  P  ASR YD+ RDGFVISGGA ++V+E
Sbjct: 180 QDVVFAGGGEELHWVQTAMFDAMGALSSKYNETPEKASRAYDANRDGFVISGGAGILVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGAKIYAEL GYG+T DG DMV+PSGEGA RCM+QA+++V+  +DYIN HGT+
Sbjct: 240 EYEHAKARGAKIYAELVGYGATSDGYDMVAPSGEGAARCMKQAMATVDGKIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E++A++E F  ++P + STKSL+GHSLGAAG QEA+Y L+M +  FI  S NI
Sbjct: 300 TPAGDMQELKAMKEAFGDDMPTVTSTKSLSGHSLGAAGVQEAVYSLLMQENNFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+D + +G+PI  ++ DN  +  V+SNSFGFGGTN TLVF +
Sbjct: 360 DELDADAEGMPIAVEKQDNVDLKRVMSNSFGFGGTNCTLVFEK 402


>gi|90579297|ref|ZP_01235107.1| putative 3-oxoacyl- synthase I [Vibrio angustum S14]
 gi|90440130|gb|EAS65311.1| putative 3-oxoacyl- synthase I [Vibrio angustum S14]
          Length = 404

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 306/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNNV+EV  SL+  +SGI FSE FA+   R  VWG   +N AE I
Sbjct: 1   MKRAVITGMGIVSSIGNNVAEVLESLKTGKSGINFSEQFAEMKLRSNVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++A+ DS L   ++++ERTGL+AGSGG S+     A D  R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAVADSGLAEEQVSNERTGLVAGSGGASSHNQYVAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDDPSKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ PVDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDLDAPVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M++  F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFGENSPAISATKAMTGHALGAAGVHEAIYSTLMLEHGFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   +G+ IV ++ D  ++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 360 DNLDEAAQGLDIVTEKRD-VELKTVMSNSFGFGGTNATLVIKKYE 403


>gi|313497978|gb|ADR59344.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas putida
           BIRD-1]
          Length = 406

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/406 (58%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+ + V  +LR +R GI F+ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI D+ L   ++++ RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQVSNPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGINYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QALS+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+RK  +NAKIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRKTEENAKIDTVMSNSFGFGGTNATLVLKRWEG 405


>gi|302187410|ref|ZP_07264083.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. syringae 642]
          Length = 407

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 240/407 (58%), Positives = 301/407 (73%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMKDAITDSGLTDEQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  ++   +DYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMKMALGDIDSGAIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGANAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AKID V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPVVADMPILLKTKEDAKIDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|114766599|ref|ZP_01445555.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Pelagibaca bermudensis
           HTCC2601]
 gi|114541215|gb|EAU44267.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius sp.
           HTCC2601]
          Length = 413

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 235/408 (57%), Positives = 301/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG N  EV  SL+  RSGIT +E   + GFR Q+ G   ++ +E +
Sbjct: 5   MRRVVVTGLGIVSSIGTNAEEVLASLKAGRSGITANEQMKEHGFRSQIAGAVDIDVSEHV 64

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AMQ+AI DS L+  ++ + RTGLIAGSGGPST  +++A     
Sbjct: 65  DKRTLRFMGPGAAYAHIAMQQAIADSGLEESDVVNPRTGLIAGSGGPSTSALLTAHQTVL 124

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +   T+R+GPFAVPKAM ST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 125 KSGGTKRVGPFAVPKAMCSTVSANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 184

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVISGG  ++VLE
Sbjct: 185 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDSPDKASRAFDAGRDGFVISGGGGILVLE 244

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E AKARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++ E   V YIN HG
Sbjct: 245 ELEHAKARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALQTLPEDRKVGYINAHG 304

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G  P + STKS+TGHS GA GAQEA+YCL+ +Q  FI  S
Sbjct: 305 TSTPVGDVGEIEAVRRVFGEGQTPPVSSTKSMTGHSQGATGAQEAVYCLLALQHDFIIPS 364

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N++E+DP      I   R+D+A +DTV++NSFGFGGTN +++  RY+
Sbjct: 365 INVDELDPALAPAEIATARVDDAGLDTVMTNSFGFGGTNGSMLLSRYR 412


>gi|89072762|ref|ZP_01159327.1| putative 3-oxoacyl- synthase I [Photobacterium sp. SKA34]
 gi|89051582|gb|EAR57036.1| putative 3-oxoacyl- synthase I [Photobacterium sp. SKA34]
          Length = 404

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 305/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNNV+EV  SL+  +SGI FSE FA+   R  VWG   +N AE I
Sbjct: 1   MKRAVITGMGIVSSIGNNVAEVLESLKTGKSGINFSEQFAEMKLRSNVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++A+ DS L   ++++ERTGL+AGSGG S+     A D  R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAVADSGLAEDQVSNERTGLVAGSGGASSHNQYLAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDDPSKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ PVDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDLDAPVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M++  F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFSDNCPAISATKAMTGHALGAAGVHEAIYSTLMLEHGFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   +G+ IV  + D  ++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 360 DNLDEAAQGLDIVTDKRD-VELKTVMSNSFGFGGTNATLVIKKYE 403


>gi|327480503|gb|AEA83813.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas stutzeri
           DSM 4166]
          Length = 405

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 305/405 (75%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F++ +A  G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVSGNLRAGRPGIRFNQSYADMGLRSQVSGSVNLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +LAM++A+ D+     +I++ R GL+AGSGG ST   + A D+ R
Sbjct: 61  DRKVLRFMGDAAAYAYLAMEQAVKDAGFSLDDISNPRIGLVAGSGGASTINQMEAIDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +RIGP+ VP+ MSST SA L+T F+I+G +YSI+SACATSAHCIG+A E IQ GK
Sbjct: 121 DK-GVKRIGPYRVPRTMSSTVSACLATPFRIKGINYSIASACATSAHCIGHAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+SS +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSSQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+QA+S+VE  +DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGALRCMQQAMSTVEGSIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A+R +F   IP I STKSL+GHSLGAAG  EAIY ++MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKAVRNMFGDKIPTISSTKSLSGHSLGAAGVHEAIYSMLMMEGNFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E+DPE   +PI+R+  +NA+IDT++SNSFGFGGTNATLV RRYK
Sbjct: 360 DELDPEVADMPILRETRENAQIDTIMSNSFGFGGTNATLVLRRYK 404


>gi|330811071|ref|YP_004355533.1| beta-ketoacyl-acyl-carrier-protein synthase I [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379179|gb|AEA70529.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 406

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 306/406 (75%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR +R GI F+ ++A+ G R QV G   L   ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVSANLRASRPGIRFNPEYAEMGLRSQVSGSIDLPLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAIADSGLTEEQVSNPRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + MSST SA L+T FKI+G +YSI+SACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMSSTVSACLATPFKIKGLNYSIASACATSAHCIGNAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+SS  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSFLFDAMGALSSKRNDTPEKASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ A+S+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMAMSTVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +REVF GN P I STKSL+GHSLGAAG  EAIYC++MM+  F+  S NI
Sbjct: 300 TPVGDVAEMKGVREVFGGNAPAISSTKSLSGHSLGAAGVHEAIYCMLMMEGNFMAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+ K  +NA I+TV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILTKTRENATINTVMSNSFGFGGTNATLVLKRWQG 405


>gi|148546931|ref|YP_001267033.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas putida F1]
 gi|148510989|gb|ABQ77849.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudomonas putida F1]
          Length = 406

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/406 (58%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+ + V  +LR +R GI F+ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI D+ L   +++  RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQVSSPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGINYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QALS+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+RK  +NAKIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRKTEENAKIDTVMSNSFGFGGTNATLVLKRWEG 405


>gi|237803506|ref|ZP_04591091.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. oryzae str. 1_6]
 gi|331025488|gb|EGI05544.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. oryzae str. 1_6]
          Length = 407

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 239/407 (58%), Positives = 303/407 (74%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAIVDSGLSDDQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL+ V++  +DY+NTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALADVDKNDIDYLNTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGANAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AKID V+SNSFGFGGTNATLV +R++G
Sbjct: 360 IDELDPAIADMPILLKTREDAKIDLVMSNSFGFGGTNATLVLKRWQG 406


>gi|253998584|ref|YP_003050647.1| beta-ketoacyl synthase [Methylovorus sp. SIP3-4]
 gi|253985263|gb|ACT50120.1| Beta-ketoacyl synthase [Methylovorus sp. SIP3-4]
          Length = 406

 Score =  488 bits (1255), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 250/404 (61%), Positives = 295/404 (73%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV VTGMGIVSS+GNN SEV  SL   RSGITF +++A  G R  V G    LN  EL
Sbjct: 1   MRRVVVTGMGIVSSLGNNKSEVLDSLHAGRSGITFQQEYADQGLRSHVAGSIKNLNVEEL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK MRF+++G  +  LAMQEAI D+ L    +++ RTGLI G GG S + I++  D  
Sbjct: 61  IDRKLMRFMAKGHAYAWLAMQEAIADAGLPKELVSNIRTGLIVGQGGASHESIMNGIDTL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    RR+GP+ V KAM+S  SA L+T  +I+G +Y+ISSACATSAHCIG   E IQ G
Sbjct: 121 REK-GVRRVGPYMVTKAMASGVSACLATGAEIKGINYAISSACATSAHCIGAGLEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+  WT+S +FD MGA+SS +N  P  ASR YD+ RDGFVISGG  ++VL
Sbjct: 180 KQDIVFAGGGEEEHWTLSFMFDGMGALSSKYNDTPEKASRTYDANRDGFVISGGGGIVVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMR AL  VE  VDYINTHGT
Sbjct: 240 EEYEHAKARGAKIYAEVVGYGATSDGYDMVAPSGEGAERCMRLALQGVEGGVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+EAIR VF  +   I STKSL+GH+LGAAG  EAIY L+MM+  FI  S N
Sbjct: 300 STPVGDLKELEAIRAVFGDSNTAIASTKSLSGHALGAAGVNEAIYTLLMMENNFIAASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +DP  +G+ IVRKRIDNA I T LSNSFGFGGTNATL F R
Sbjct: 360 IETLDPAAEGLNIVRKRIDNANIQTALSNSFGFGGTNATLTFSR 403


>gi|330446614|ref|ZP_08310266.1| putative 3-oxoacyl-synthase I [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490805|dbj|GAA04763.1| putative 3-oxoacyl-synthase I [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 404

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 306/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNNV+EV  SL+  +SGI FSE FA+   R  VWG   +N AE I
Sbjct: 1   MKRAVITGMGIVSSIGNNVAEVLESLKTGKSGINFSEQFAEMKLRSNVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI DS L   ++++ERTGL+AGSGG S+     A D  R
Sbjct: 61  DRKKMRFMGDAAAYAYLSMEQAIADSGLAEEQVSNERTGLVAGSGGASSHNQYVAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N +P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDEPTKASRTYDADRDGFVISGGGGMVVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ PVDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDLDGPVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M++  F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFGENSPAISATKAMTGHALGAAGVHEAIYSTLMLEHGFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   +G+ IV ++ D A + TV+SNSFGFGGTNATLV ++Y+
Sbjct: 360 DNLDEVAQGLDIVTEKRDVA-LKTVMSNSFGFGGTNATLVIKKYE 403


>gi|77460434|ref|YP_349941.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas
           fluorescens Pf0-1]
 gi|77384437|gb|ABA75950.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudomonas
           fluorescens Pf0-1]
          Length = 406

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/406 (58%), Positives = 305/406 (75%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR +R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVSANLRASRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAIADSGLTEEQVSNPRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + MSST SA L+T FKI+G +YSI+SACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMSSTVSACLATPFKIKGLNYSIASACATSAHCIGTAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+SS  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSSKRNDTPEQASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QALS+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +REVF    P I STKSL+GHSLGAAG  EAIYC++MM+  FI  S NI
Sbjct: 300 TPVGDVAEMKGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCMLMMEGNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +P++ K  +NA I+TV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPVLTKTRENATINTVMSNSFGFGGTNATLVLKRWEG 405


>gi|66045259|ref|YP_235100.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. syringae B728a]
 gi|63255966|gb|AAY37062.1| Beta-ketoacyl synthase:Beta-ketoacyl synthase [Pseudomonas syringae
           pv. syringae B728a]
 gi|330973457|gb|EGH73523.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. aceris str. M302273PT]
          Length = 407

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 239/407 (58%), Positives = 301/407 (73%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMKDAITDSGLTDEQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  ++   +DYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMKMALGDIDSGAIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGANAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPVVADMPILLKTQEDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|92112589|ref|YP_572517.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Chromohalobacter
           salexigens DSM 3043]
 gi|91795679|gb|ABE57818.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Chromohalobacter
           salexigens DSM 3043]
          Length = 405

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 239/405 (59%), Positives = 304/405 (75%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVS +GN+  +V  +LR  RSGI F +++A+ GFR  V G   ++   LI
Sbjct: 1   MRRVVVTGLGIVSCLGNDQQQVLDALRNGRSGIRFKDEYAERGFRSHVAGVVDIDLDTLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +++M +AI D+ L+  +I+ ERTGLIAGSGG S+   V AAD+ R
Sbjct: 61  DRKLRRFMGDAAAFAYVSMDQAIRDAGLEESDISSERTGLIAGSGGASSANQVEAADVLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG+A E IQ GK
Sbjct: 121 EK-GLRRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGSAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  WT+S LFDAMGA+S+ +N  P +ASRPYD+ RDGFVI+GG  ++VLE
Sbjct: 180 QDVVFAGGGEEEHWTLSCLFDAMGALSTSYNDSPETASRPYDASRDGFVIAGGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQA+++V+ P+DYINTHGT+
Sbjct: 240 ELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAARCMRQAMATVDGPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++AIREVF    P + STKSLTGHSLGA G QE IY L+MM+  FI  S NI
Sbjct: 300 TPVGDIAELKAIREVFGDTTPAMSSTKSLTGHSLGATGVQETIYSLLMMEHAFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E+D   +G  IV+ R D+A I+ VLSNSFGFGGTNA LV +RY+
Sbjct: 360 DELDDAAQGFDIVKTRRDDAAIERVLSNSFGFGGTNACLVLQRYR 404


>gi|70729126|ref|YP_258862.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas
           fluorescens Pf-5]
 gi|68343425|gb|AAY91031.1| beta-ketoacyl-ACP synthase I [Pseudomonas fluorescens Pf-5]
          Length = 406

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 305/406 (75%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR +R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVSANLRASRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAIADSGLSEEQVSNPRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + MSST SA L+T FKI+G +YSI+SACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMSSTVSACLATPFKIKGLNYSIASACATSAHCIGTAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  WT S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWTQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM  A+S+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMEMAMSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +REVF    P I STKSL+GHSLGAAG  EAIYC++MM+  F+  S NI
Sbjct: 300 TPVGDVAEMKGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCMLMMEGNFMAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+ K  ++A I+TV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADMPILTKTREDATINTVMSNSFGFGGTNATLVLKRWQG 405


>gi|119384387|ref|YP_915443.1| beta-ketoacyl synthase [Paracoccus denitrificans PD1222]
 gi|119374154|gb|ABL69747.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Paracoccus
           denitrificans PD1222]
          Length = 409

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/408 (58%), Positives = 305/408 (74%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  SLR  RSGI F+ ++A+ GFR QV G P +   + +
Sbjct: 1   MRRVVITGLGIVSPIGNNAAEVTESLRAGRSGIVFAPEYAERGFRSQVHGMPQIVLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AMQ+AI D+ L P ++++ER+GL+ GSGGPST  +  A     
Sbjct: 61  DKRNLRFMGAGAAYNFIAMQQAIEDAGLAPEDVSNERSGLVMGSGGPSTANLFEAHRTVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  + +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGAPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGTELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +ASRP+D+ RDGFVI+GGA V+VLE
Sbjct: 181 QDIVFAGGGEELDWTLSCLFDAMGAMSSKYNDTPQTASRPFDATRDGFVIAGGAGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E A ARGA+IYAE+TGYG+T DG DMV+PSGEG  R MR ALS++ E   + Y+N HG
Sbjct: 241 ELEHALARGARIYAEVTGYGATSDGYDMVAPSGEGGERSMRLALSTLPEGRRISYVNAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E++A+R VF +G +P + STKSLTGHSLGA GA EAIY L+MMQ  FI  S
Sbjct: 301 TSTPVGDVGEIKALRRVFGEGEVPPVSSTKSLTGHSLGATGAHEAIYSLLMMQNGFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ E+DPE +   I   R+D+   D+VLSNSFGFGGTNATLV  +Y+
Sbjct: 361 ANVTELDPEIRPEEIALARVDDVDFDSVLSNSFGFGGTNATLVLSKYR 408


>gi|330875682|gb|EGH09831.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 407

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 241/407 (59%), Positives = 303/407 (74%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAITDSGLSDDQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG+A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGSAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL+ V++  VDYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALADVDKNDVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGTNAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AKID V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPAIADMPILLKTREDAKIDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|209694630|ref|YP_002262558.1| 3-ketoacyl-ACP synthase FabB [Aliivibrio salmonicida LFI1238]
 gi|208008581|emb|CAQ78756.1| 3-ketoacyl-ACP synthase FabB [Aliivibrio salmonicida LFI1238]
          Length = 403

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 309/405 (76%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNNV EV  SL+  +SGI FSE FA+ G R  VWG   +N A+ I
Sbjct: 1   MKRAVITGMGIVSSIGNNVEEVLESLKAGKSGINFSEQFAEKGLRSNVWGNLKMNPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +++M++A+ DS L   +++++RTG++AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYISMEQAVADSGLTEDQVSNDRTGIVAGSGGASSLNQVNAVDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTVSACLATPFKIRGVNYSMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW+++ +FDAMGA+SS +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVMFAGGGEELDWSLTMMFDAMGALSSKYNDTPDKASRTYDTDRDGFVISGGGGMVVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V+  VDY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEVVGYGATSDGYDMVAPSGEGAVRCMKMAMQNVDS-VDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF  N P I +TK++TGH+LGAAG  EAIY  +M++  FI  S NI
Sbjct: 299 TPVGDAKELGAIQEVFGTNSPAISATKAMTGHALGAAGVHEAIYSTLMLEHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +DP  +G+ IV ++ D  ++ TV+SNSFGFGGTNATLV ++++
Sbjct: 359 ETLDPAAEGLDIVTEKRDQ-ELTTVMSNSFGFGGTNATLVIKKFE 402


>gi|149202114|ref|ZP_01879087.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius sp. TM1035]
 gi|149144212|gb|EDM32243.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius sp. TM1035]
          Length = 409

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/409 (57%), Positives = 306/409 (74%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SLRE RSGIT +E  A+ GFR +V G   L+  E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAQEVLASLREGRSGITANEAMAEHGFRSRVAGAIKLDVTEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + H+AM +AI D+ L+  ++ + RTG++AGSGGPST  +++A  +  
Sbjct: 61  DKRALRFMGGGAAYAHIAMAQAIADAGLEEKDVINPRTGVVAGSGGPSTSAMLAAHQVAL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  ST+RIGPFAVPK M ST SA L+T +KI+G +YSI+SAC+TS HCIG+AAE I  GK
Sbjct: 121 DTGSTKRIGPFAVPKTMCSTISANLATSYKIKGLNYSITSACSTSLHCIGHAAEQIMFGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++S LFDAMGAMSS +N  P +ASR +D  RDGFVIS G  ++VLE
Sbjct: 181 QDVMFAGGGEELDWSLSCLFDAMGAMSSKYNDTPETASRAFDVGRDGFVISAGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+ERAKARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR A++++ E   V YIN HG
Sbjct: 241 ELERAKARGAKIYAEVTGYGATSDGADMVAPSGEGGERAMRLAVATLPEGRRVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G+ P I STKS+TGHS GA GAQEAIYCL+M++  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGQGSTPPISSTKSMTGHSQGATGAQEAIYCLLMLENDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      I   R+D A +DTV++NSFGFGGTN +++  ++ G
Sbjct: 361 INVETLDPALDPAEIATVRVDKAGLDTVMTNSFGFGGTNGSMLLSKFHG 409


>gi|262166213|ref|ZP_06033950.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio mimicus
           VM223]
 gi|262025929|gb|EEY44597.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio mimicus
           VM223]
          Length = 403

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 307/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A+ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHARARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFAGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ETLDEAAQGLDIVTE-MREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|146282255|ref|YP_001172408.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas stutzeri
           A1501]
 gi|145570460|gb|ABP79566.1| beta-ketoacyl-ACP synthase I [Pseudomonas stutzeri A1501]
          Length = 405

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 305/405 (75%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F++ +A  G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVSGNLRAGRPGIRFNQSYADMGLRSQVSGSVNLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +LAM++A+ D+     +I++ R GL+AGSGG ST   + A D+ R
Sbjct: 61  DRKVLRFMGDAAAYAYLAMEQAVKDAGFSLDDISNPRIGLVAGSGGASTINQMEAIDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +RIGP+ VP+ MSST SA L+T F+I+G +YSI+SACATSAHCIG+A E IQ GK
Sbjct: 121 DK-GVKRIGPYRVPRTMSSTVSACLATPFRIKGINYSIASACATSAHCIGHAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+SS +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSSQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+QA+S+VE  +DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGALRCMQQAMSTVEGSIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A+R +F   +P I STKSL+GHSLGAAG  EAIY ++MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKAVRNMFGDKVPTISSTKSLSGHSLGAAGVHEAIYSMLMMEGNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E+DPE   +PI+R+  +NA+IDT++SNSFGFGGTNATLV RRYK
Sbjct: 360 DELDPEVADMPILRETRENAQIDTIMSNSFGFGGTNATLVLRRYK 404


>gi|153825566|ref|ZP_01978233.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae MZO-2]
 gi|149740717|gb|EDM54816.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae MZO-2]
          Length = 403

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDAERDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 DTLDEAAQGLDIVTE-LREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|159043558|ref|YP_001532352.1| beta-ketoacyl synthase [Dinoroseobacter shibae DFL 12]
 gi|157911318|gb|ABV92751.1| beta-ketoacyl synthase [Dinoroseobacter shibae DFL 12]
          Length = 409

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 243/407 (59%), Positives = 301/407 (73%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVS IGN VSEV  SLR  RSGITF+E +A+ GFR QV G P +   + I
Sbjct: 1   MRRVVITGMGIVSPIGNTVSEVEASLRAGRSGITFAETYAENGFRSQVHGVPDIVLEDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AMQ+AI DS L+   +++ER+GLI GSGGPST     A    +
Sbjct: 61  DKRNLRFMGPGAAFNFIAMQQAIADSGLEDSNVSNERSGLIMGSGGPSTSNFFQAFKTVK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  + +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGAPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGVELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++DWT+S LFDAMGAMSS +N  P +ASR +D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIVFAGGGEEIDWTLSCLFDAMGAMSSKYNDTPTTASRTFDATRDGFVIAGGGGVLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E AKARGAKIYAE+TGYG+T DG DMV+PSGEG  R MRQA++++ E   VDYIN HG
Sbjct: 241 ELEHAKARGAKIYAEVTGYGATSDGYDMVAPSGEGGERSMRQAIATLPEGRSVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G  P + STKSLTGHSLGA G  EAIY LIMM + FI  S
Sbjct: 301 TSTPVGDVTEIEAVRRVFGEGTTPPVASTKSLTGHSLGATGVHEAIYSLIMMNKGFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
            NI E+DP      IV +  +   +D+VLSNSFGFGGTNATL+  RY
Sbjct: 361 ANITELDPAIHPEEIVTELREGVTLDSVLSNSFGFGGTNATLLMSRY 407


>gi|313200656|ref|YP_004039314.1| beta-ketoacyl synthase [Methylovorus sp. MP688]
 gi|312439972|gb|ADQ84078.1| Beta-ketoacyl synthase [Methylovorus sp. MP688]
          Length = 406

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 249/404 (61%), Positives = 295/404 (73%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV VTGMGIVSS+GNN SEV  SL   RSGITF +++A  G R  V G    LN  EL
Sbjct: 1   MRRVVVTGMGIVSSLGNNKSEVLDSLHAGRSGITFQQEYADQGLRSHVAGSIKNLNVEEL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK MRF+++G  +  LAMQEAI D+ L    +++ RTGLI G GG S + I++  D  
Sbjct: 61  IDRKLMRFMAKGHAYAWLAMQEAIADAGLPKELVSNIRTGLIVGQGGASHESIMNGIDTL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    RR+GP+ V KAM+S  SA L+T  +I+G +Y+ISSACATSAHCIG   E IQ G
Sbjct: 121 REK-GVRRVGPYMVTKAMASGVSACLATGAEIKGINYAISSACATSAHCIGAGLEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+  WT+S +FD MGA+SS +N  P  ASR YD+ RDGFVISGG  ++VL
Sbjct: 180 KQDIVFAGGGEEEHWTLSFMFDGMGALSSKYNDTPEKASRTYDANRDGFVISGGGGIVVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMR AL  VE  VDYINTHGT
Sbjct: 240 EEYEHAKARGAKIYAEVVGYGATSDGYDMVAPSGEGAERCMRLALQGVEGGVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+EAIR VF  +   I STKSL+GH+LGAAG  EAIY L+MM+  FI  S N
Sbjct: 300 STPVGDLKELEAIRAVFGDSNTAIASTKSLSGHALGAAGVNEAIYTLLMMENNFIAASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +DP  +G+ IVR+RIDNA I T LSNSFGFGGTNATL F R
Sbjct: 360 IETLDPAAEGLNIVRQRIDNANIQTALSNSFGFGGTNATLTFSR 403


>gi|90410763|ref|ZP_01218778.1| putative 3-oxoacyl-synthase I [Photobacterium profundum 3TCK]
 gi|90328394|gb|EAS44692.1| putative 3-oxoacyl-synthase I [Photobacterium profundum 3TCK]
          Length = 404

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 306/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGN+V EV  SL+  +SGI FSE FA+   R  VWG   +N AE I
Sbjct: 1   MKRAVITGMGIVSSIGNDVKEVLASLKSGKSGINFSEQFAENKLRSNVWGDLKMNPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI DS L   +++++RTGL+AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAIEDSGLSDDQVSNDRTGLVAGSGGASSYNQVAAVDIIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 NK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDDPSKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEVVGYGATSDGYDMVAPSGEGAVRCMKMAMQDLDVPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFGENSPAISATKAMTGHALGAAGVHEAIYSTLMLNNNFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +DP  +G+ IV +  +  ++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 360 DNLDPAAEGLDIVTETRET-ELKTVMSNSFGFGGTNATLVIKKYE 403


>gi|330959046|gb|EGH59306.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 407

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/407 (58%), Positives = 303/407 (74%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AITDS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMQDAITDSGLTDEQVSNVRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGTAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP-VDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL+ +++  VDYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALAGLDKKDVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  + P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGFDAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AKID V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPAIADMPILLKTREDAKIDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|262404457|ref|ZP_06081012.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio sp. RC586]
 gi|262349489|gb|EEY98627.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio sp. RC586]
          Length = 403

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 305/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI DS L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADSGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFAGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D    G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ETLDEAAHGLDIVTE-MREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|149189282|ref|ZP_01867568.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Vibrio shilonii AK1]
 gi|148836841|gb|EDL53792.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Vibrio shilonii AK1]
          Length = 403

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  RSGI  SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGRSGINASEQFKEMGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKKMRFMGDAAAYAYLSMEQAIADAGLTEDQVSNDRTGIVAGSGGASALNQTLAVDTIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWTQTMMFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V E +DY+NTHGT+
Sbjct: 240 ELEHALARGATIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDV-EVIDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSALMLHHSFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EE+D   +G+ IV +  +  +++TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 EELDEAAQGLDIVTETREQ-ELNTVMSNSFGFGGTNATLVLKKYQG 403


>gi|330965365|gb|EGH65625.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 407

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 239/407 (58%), Positives = 303/407 (74%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAITDSGLSDDQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG+A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGSAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL+ V++  VDYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALADVDKNDVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF  N P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGTNAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPAIADMPILLKTREDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|26990867|ref|NP_746292.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas putida
           KT2440]
 gi|24985879|gb|AAN69756.1|AE016612_2 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudomonas putida
           KT2440]
          Length = 406

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/406 (58%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+ + V  +LR +R GI F+ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI D+ L   ++++ RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQVSNPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGINYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QALS+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+D E   +PI+RK  +NAKIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDAEVADLPILRKTEENAKIDTVMSNSFGFGGTNATLVLKRWEG 405


>gi|163796753|ref|ZP_02190711.1| Beta-ketoacyl synthase [alpha proteobacterium BAL199]
 gi|159178007|gb|EDP62554.1| Beta-ketoacyl synthase [alpha proteobacterium BAL199]
          Length = 412

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 244/406 (60%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV VTG+GIVSSIG +  +VA SL+  RSGI F+E++ + GFR  V G   ++ AE I
Sbjct: 6   LRRVVVTGIGIVSSIGTDKEQVAASLKTGRSGIVFAEEYKEMGFRSHVHGAVDIDLAERI 65

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+  G  + +LAMQEAI D+ L+  E+++ RTGLI GSGGPST  +++A D  R
Sbjct: 66  DRKLLRFMGDGAAYNYLAMQEAIADAGLEANEVSNPRTGLIMGSGGPSTSNMMTAFDTAR 125

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA LST+F I+G +YSISSAC+TSAHCIGNA E IQ GK
Sbjct: 126 EK-GPKRVGPYMVPRTMSSTNSACLSTFFGIKGHNYSISSACSTSAHCIGNAMEAIQLGK 184

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD +FAGG E+L WTMS LFDAMGA+SS +N  P  ASR YD  RDGFVI+GG  V+VLE
Sbjct: 185 QDTVFAGGGEELHWTMSVLFDAMGALSSKYNDTPERASRAYDRDRDGFVIAGGGGVVVLE 244

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGAKIY E+ GYG+T DG DMV PSGEGA+RCM+ AL  + EPVDYINTHGT+
Sbjct: 245 ALEHAQARGAKIYGEIVGYGATSDGVDMVQPSGEGAVRCMQMALEGLNEPVDYINTHGTS 304

Query: 301 TPKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           TP GD KE+EAIR+VF  +  +P I STKSLTGHSLGA G QEAIY L+MM++ FI  S 
Sbjct: 305 TPVGDLKELEAIRQVFGNRNQLPAISSTKSLTGHSLGATGVQEAIYTLLMMRDGFIAASA 364

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           NI+ ++PE   +PIVR      +I+  LSNSFGFGGTNA L  RR+
Sbjct: 365 NIDNLEPEAGDLPIVRGAALEQQINLALSNSFGFGGTNAVLAMRRF 410


>gi|121586817|ref|ZP_01676599.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae
           2740-80]
 gi|121727179|ref|ZP_01680346.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae V52]
 gi|147674185|ref|YP_001217632.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae O395]
 gi|153213233|ref|ZP_01948645.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae 1587]
 gi|153818967|ref|ZP_01971634.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae NCTC
           8457]
 gi|153822899|ref|ZP_01975566.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae B33]
 gi|153831368|ref|ZP_01984035.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae
           623-39]
 gi|227082234|ref|YP_002810785.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae M66-2]
 gi|229507804|ref|ZP_04397309.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae BX
           330286]
 gi|229511959|ref|ZP_04401438.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           B33]
 gi|229513762|ref|ZP_04403224.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae TMA
           21]
 gi|229519095|ref|ZP_04408538.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           RC9]
 gi|229524113|ref|ZP_04413518.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae bv.
           albensis VL426]
 gi|229528877|ref|ZP_04418267.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           12129(1)]
 gi|229607349|ref|YP_002877997.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           MJ-1236]
 gi|254291347|ref|ZP_04962140.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae
           AM-19226]
 gi|254849195|ref|ZP_05238545.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio cholerae MO10]
 gi|255745150|ref|ZP_05419099.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholera CIRS
           101]
 gi|262153460|ref|ZP_06028590.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           INDRE 91/1]
 gi|297582009|ref|ZP_06943928.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae RC385]
 gi|298497867|ref|ZP_07007674.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae MAK
           757]
 gi|31075805|gb|AAP42274.1| FabB [Vibrio cholerae]
 gi|121548984|gb|EAX59023.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae
           2740-80]
 gi|121630424|gb|EAX62817.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae V52]
 gi|124116033|gb|EAY34853.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae 1587]
 gi|126510462|gb|EAZ73056.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae NCTC
           8457]
 gi|126519595|gb|EAZ76818.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae B33]
 gi|146316068|gb|ABQ20607.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae O395]
 gi|148873151|gb|EDL71286.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae
           623-39]
 gi|150422677|gb|EDN14631.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae
           AM-19226]
 gi|227010122|gb|ACP06334.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae M66-2]
 gi|227014005|gb|ACP10215.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae O395]
 gi|229332651|gb|EEN98137.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           12129(1)]
 gi|229337694|gb|EEO02711.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae bv.
           albensis VL426]
 gi|229343784|gb|EEO08759.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           RC9]
 gi|229348943|gb|EEO13900.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae TMA
           21]
 gi|229351924|gb|EEO16865.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           B33]
 gi|229355309|gb|EEO20230.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae BX
           330286]
 gi|229370004|gb|ACQ60427.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           MJ-1236]
 gi|254844900|gb|EET23314.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio cholerae MO10]
 gi|255736980|gb|EET92376.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholera CIRS
           101]
 gi|262030697|gb|EEY49331.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae
           INDRE 91/1]
 gi|297533704|gb|EFH72546.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae RC385]
 gi|297542200|gb|EFH78250.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae MAK
           757]
 gi|327484639|gb|AEA79046.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Vibrio cholerae
           LMA3894-4]
          Length = 403

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 DTLDEAAQGLDIVTE-LREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|88798063|ref|ZP_01113650.1| 3-oxoacyl-(acyl carrier protein) synthase [Reinekea sp. MED297]
 gi|88779260|gb|EAR10448.1| 3-oxoacyl-(acyl carrier protein) synthase [Reinekea sp. MED297]
          Length = 405

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 304/405 (75%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTGMGIVS IGN+V  V  SL+  +SGI+ +  +A+ G R  + G P ++ +E I
Sbjct: 1   MKRVVVTGMGIVSCIGNDVKAVTDSLKNGKSGISHNAKYAELGMRSHISGTPDIDLSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + +++MQ+AI D+ L   ++++ RTG++AGSGG  +     AA++  
Sbjct: 61  DRKAIRFMGDAAGYAYVSMQQAIADAGLTEDQVSNIRTGIVAGSGGADSGSQTEAANILL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GLKRVGPYRVTQTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E   WTMS+LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG A++VLE
Sbjct: 180 QDVMFAGGGEAEHWTMSSLFDAMGALSTKYNDTPEKASRAYDADRDGFVIAGGGAMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY EL GYG+T DG +MV+PSGEGA+RCM+ A+ +V   +DYIN HGT+
Sbjct: 240 ELEHAKARGAKIYGELVGYGATSDGYNMVAPSGEGAVRCMQMAMENVNGDIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A++EVF   +P I STKSLTGHSLGA GAQEAIY LIMMQE FI  SKN+
Sbjct: 300 TPAGDVTELKAVKEVFGEKMPPIASTKSLTGHSLGATGAQEAIYSLIMMQENFIAASKNV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +DPE     +V +R+D+ +++ V+SNSFGFGGTN+TLVF RY+
Sbjct: 360 DNLDPEAGEANVVTERVDDVQLNNVMSNSFGFGGTNSTLVFARYQ 404


>gi|85705221|ref|ZP_01036320.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius sp. 217]
 gi|85670094|gb|EAQ24956.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseovarius sp. 217]
          Length = 409

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 236/409 (57%), Positives = 307/409 (75%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN SEV  +LRE RSGIT +E  A+ GFR +V G   L+  E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNASEVLAALREGRSGITANEAMAEHGFRSRVAGAIKLDVTEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +++A+RF+  G  + ++AM +AI D+ L+  ++ + RTG++AGSGGPST  +++A  +  
Sbjct: 61  EKRALRFMGGGAAYAYIAMGQAIADAGLEEKDVINPRTGVVAGSGGPSTSAMLTAHQVAL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  ST+RIGPFAVPK M ST SA L+T +KI+G +YSI+SAC+TS HCIG+AAE I  GK
Sbjct: 121 ETGSTKRIGPFAVPKTMCSTISANLATSYKIKGLNYSITSACSTSLHCIGHAAEQIMFGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDW++S LFDAMGAMSS +N  P +ASR +D  RDGFVIS G  ++VLE
Sbjct: 181 QDVMFAGGGEELDWSLSCLFDAMGAMSSKYNDTPATASRAFDVGRDGFVISAGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+ERAKARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR A++++ E   V YIN HG
Sbjct: 241 ELERAKARGAKIYAEVTGYGATSDGADMVAPSGEGGERAMRLAVATLPEGRRVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G+ P I STKS+TGHS GA GAQEAIYCL+M++  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGQGSTPPISSTKSMTGHSQGATGAQEAIYCLLMLENDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +DP      I   R+D A +DTV++NSFGFGGTN +++  +Y G
Sbjct: 361 INVQTLDPALDPKEIATVRVDKAGLDTVMTNSFGFGGTNGSMLLSKYHG 409


>gi|254226351|ref|ZP_04919940.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae V51]
 gi|125621101|gb|EAZ49446.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae V51]
          Length = 403

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 DTLDEAAQGLDIVTE-LREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|167034741|ref|YP_001669972.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas putida
           GB-1]
 gi|166861229|gb|ABY99636.1| Beta-ketoacyl synthase [Pseudomonas putida GB-1]
          Length = 406

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 301/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR +R GI F+ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTENLRNSRPGIRFNPEYKEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI D+ L   ++++ RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQVSNPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGLNYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+R   +NAKIDTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRNTEENAKIDTVMSNSFGFGGTNATLVLKRWEG 405


>gi|229522064|ref|ZP_04411481.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae TM
           11079-80]
 gi|229340989|gb|EEO05994.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio cholerae TM
           11079-80]
          Length = 403

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 DTLDEAAQGLDIVTE-LREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|330813309|ref|YP_004357548.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486404|gb|AEA80809.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 405

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/403 (57%), Positives = 297/403 (73%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV ++G+GIVS +GNN  EV  SL   +SGI+F E++ ++  +  + GKP +   + I
Sbjct: 1   MKRVVISGLGIVSCLGNNQEEVYQSLLNGKSGISFCEEYKEYNLKSHIHGKPNIKLEDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+  G  + ++AMQEAI DS L+  E+++  TG+I GSGGPS + +V + D TR
Sbjct: 61  DRKTIRFMGAGSAYNYIAMQEAIKDSGLEDKEVSNINTGIIMGSGGPSIENVVLSVDKTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              + + +GPF VP+ M+STASATL+  FKI+GT+Y+ISSACATS H IGNA ELIQ GK
Sbjct: 121 AK-TPKLMGPFIVPRTMASTASATLAVPFKIKGTNYTISSACATSGHAIGNAMELIQYGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q IMFAGG E+L W M+ +FDAM A+SS +N  P  ASR YD  RDGFVI+GG  V+VLE
Sbjct: 180 QKIMFAGGSEELHWAMTAMFDAMTALSSKYNDTPDKASRAYDKTRDGFVIAGGGGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIYAELTGYG+T DG DMV+PSGEGA+RCM  ALS+ +  +DYINTHGT+
Sbjct: 240 ELEHAKARGAKIYAELTGYGATSDGYDMVAPSGEGAVRCMNMALSTTKNKIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ ++ EVFK  IP I STKSL+GH LGAA   EAIYCLIMM+ +FI  S NI
Sbjct: 300 TPVGDVTELRSVAEVFKDKIPKISSTKSLSGHPLGAASVHEAIYCLIMMKNKFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+D E K  PIV +   N +++ V+SNSFGFGGTNA LVF +
Sbjct: 360 GEMDDETKKFPIVTEVQKNVELNAVMSNSFGFGGTNAALVFEK 402


>gi|262170902|ref|ZP_06038580.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio mimicus
           MB-451]
 gi|261891978|gb|EEY37964.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio mimicus
           MB-451]
          Length = 403

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELFWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFAGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ETLDEAAQGLDIVTE-MREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|258621126|ref|ZP_05716160.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio mimicus VM573]
 gi|258626200|ref|ZP_05721048.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio mimicus VM603]
 gi|258581555|gb|EEW06456.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio mimicus VM603]
 gi|258586514|gb|EEW11229.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio mimicus VM573]
          Length = 403

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELFWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQHVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFAGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV + +   ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ETLDEAAQGLDIVTE-MREQELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|170722662|ref|YP_001750350.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas putida
           W619]
 gi|169760665|gb|ACA73981.1| Beta-ketoacyl synthase [Pseudomonas putida W619]
          Length = 406

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+ + V  +LR +R GI ++ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRYNPEYKEQGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI D+ L   ++++ RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQVSNPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGLNYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNDTPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIKGVRAVFGDKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+RK  +NAKIDTV+SNSFGFGGTNATLV +R+ G
Sbjct: 360 DELDPEVADLPILRKTEENAKIDTVMSNSFGFGGTNATLVLKRWTG 405


>gi|90408676|ref|ZP_01216827.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Psychromonas sp. CNPT3]
 gi|90310222|gb|EAS38356.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Psychromonas sp. CNPT3]
          Length = 405

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 236/404 (58%), Positives = 306/404 (75%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNN  EV  SL+  +SGITFSE FA+   R QVWG   +   + I
Sbjct: 1   MKRAVITGMGIVSSIGNNKEEVLASLKSGQSGITFSEQFAEMKMRSQVWGAVDIVPKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQ+AI D+ L   ++++ERTG++AGSGG S+   V+AA++ +
Sbjct: 61  DRKALRFMGDAAAYTYIAMQQAIDDAGLTDDQVSNERTGIVAGSGGASSLNQVAAAEIMK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RR+GP+ VP+ M+ST SA L+T FKI+G +YS+SSACATSAHCIG+A E IQ GK
Sbjct: 121 TK-GVRRVGPYMVPRTMASTTSACLATPFKIKGINYSMSSACATSAHCIGHAWEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWTM+  FDAMGA+SS +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWTMACEFDAMGALSSKYNDTPEKASRTYDAARDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCMRQAL++V+  VDY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMRQALATVDGKVDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI EVF  + P I +TKS TGHSLGAAG  EAI+ +IMM+  FI  S NI
Sbjct: 300 TPVGDTKELGAINEVFGLDAPKISATKSQTGHSLGAAGVHEAIFSMIMMEHNFISPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           + +D     +PIV+ +   AK++ V+SNSFGFGGTNATLVF+R+
Sbjct: 360 DVLDELAVNLPIVKNKSIEAKLNIVMSNSFGFGGTNATLVFKRF 403


>gi|54309818|ref|YP_130838.1| putative 3-oxoacyl- synthase I [Photobacterium profundum SS9]
 gi|46914256|emb|CAG21036.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I
           [Photobacterium profundum SS9]
          Length = 404

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 306/406 (75%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGN+V EV  SL+  +SGI FSE FA+   R  VWG   +N AE I
Sbjct: 1   MKRAVITGMGIVSSIGNDVKEVLASLKSGKSGINFSEQFAENKLRSNVWGDLKMNPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI DS L   +++++RTGL+AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAIEDSGLSDDQVSNDRTGLVAGSGGASSYNQVAAVDIIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 NK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDDPSKASRTYDADRDGFVISGGGGMVVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEVVGYGATSDGYDMVAPSGEGAVRCMKMAMKDLDAPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFGKNSPAISATKAMTGHALGAAGVHEAIYSTLMLNNNFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + +DP  +G+ IV +     ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 360 DNLDPAAEGLDIVTETR-ETELTTVMSNSFGFGGTNATLVIKKYEG 404


>gi|145299321|ref|YP_001142162.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852093|gb|ABO90414.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 403

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/405 (57%), Positives = 306/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+G++SSIGNN  EV  SL+  +SGIT+SE F +   R +VWG   L  +ELI
Sbjct: 1   MRRAVITGIGVISSIGNNKEEVLASLKAGKSGITYSEQFEQHNLRSRVWGNIKLEPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ LQ  ++++ERTGL+ GSGG S K    + D+ R
Sbjct: 61  DRKVMRFMGDAAAYAYLSMQQAIDDAGLQEDQVSNERTGLVVGSGGASGKNTSESCDIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTTSACLATPFKIKGVNYSISSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+ +  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSSTIQFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGILVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAELTGYG+T DG DMV+PSGEGA+RCM+ A+  V + VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAELTGYGATSDGYDMVAPSGEGAVRCMKMAMQDVGK-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+ +F    P I +TK++TGH+LGAAG  EA+Y L+MM+  FI  S NI
Sbjct: 299 TPVGDTKELEAIQTLFGTQGPKISATKAMTGHALGAAGVHEAVYSLLMMEHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D + +G+PIVR+  + A ++TV+SNSFGFGGTNA+LVF ++K
Sbjct: 359 ETLDEKAEGLPIVRE-YEAADLNTVMSNSFGFGGTNASLVFSKFK 402


>gi|28898968|ref|NP_798573.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153840557|ref|ZP_01993224.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio
           parahaemolyticus AQ3810]
 gi|260365284|ref|ZP_05777841.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus K5030]
 gi|260878834|ref|ZP_05891189.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus AN-5034]
 gi|260896244|ref|ZP_05904740.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus Peru-466]
 gi|28807187|dbj|BAC60457.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149745780|gb|EDM56910.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio
           parahaemolyticus AQ3810]
 gi|308088829|gb|EFO38524.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus Peru-466]
 gi|308094181|gb|EFO43876.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus AN-5034]
 gi|308115399|gb|EFO52939.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus K5030]
 gi|328474492|gb|EGF45297.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio
           parahaemolyticus 10329]
          Length = 403

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 303/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D+ R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLTEEQVSNDRTGIVAGSGGASALNQTVATDIMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V + +DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDV-DSIDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D   KG+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 359 ENLDEAAKGLDIVTEARD-AELTTVMSNSFGFGGTNATLVIKKYQ 402


>gi|110833695|ref|YP_692554.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Alcanivorax borkumensis
           SK2]
 gi|110646806|emb|CAL16282.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Alcanivorax borkumensis
           SK2]
          Length = 404

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/405 (58%), Positives = 301/405 (74%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVS +GN+   V  SLRE RSGI F E + + G R Q+ G P +   + I
Sbjct: 1   MRRVVITGMGIVSCLGNDADSVTRSLREGRSGIRFKEQYQEIGMRSQIAGTPDIQLDDFI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + ++AMQ AITDS L   ++++ERTGLIAGSGG S+   V AAD+ R
Sbjct: 61  DRKPRRFMGDAAAYAYVAMQNAITDSGLSDEQVSNERTGLIAGSGGHSSFNQVEAADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ M+ST SA L+T FKI+G +YSI+SACATSAHCIGNA E IQ GK
Sbjct: 121 NR-GVKRVGPYMVPRVMASTVSACLATPFKIKGVNYSIASACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  WT+S LFDAMGA+SS +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWTLSCLFDAMGALSSKYNDTPEQASRAYDATRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA IYAE+ GYG+T DG DMV+P+GEGA RCMRQAL++V+  +DYIN HGT+
Sbjct: 240 ELEHAKARGATIYAEVLGYGATSDGHDMVAPNGEGAARCMRQALATVDGSIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++AIREVF    P I STKSL+GHSLGAAG QEAIYC++MMQ  F   S NI
Sbjct: 300 TPVGDVAELKAIREVFADQCPSIGSTKSLSGHSLGAAGVQEAIYCMLMMQNDFTAVSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D + +G+P++ K  D+    TVLSNSFGFGGTNA+LV R+++
Sbjct: 360 QTLDEQAEGMPVLVKGKDSGPT-TVLSNSFGFGGTNASLVLRKWQ 403


>gi|86148774|ref|ZP_01067044.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio sp. MED222]
 gi|218708897|ref|YP_002416518.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (Beta-ketoacyl-ACP
           synthase I) [Vibrio splendidus LGP32]
 gi|85833432|gb|EAQ51620.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio sp. MED222]
 gi|218321916|emb|CAV17908.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (Beta-ketoacyl-ACP
           synthase I) [Vibrio splendidus LGP32]
          Length = 403

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 309/406 (76%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N A+ I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKEGKSGITASEQFKENGLRSQVWGNLKMNPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI DS L   +++++RTG++AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAIADSGLTEDQVSNDRTGIVAGSGGASSLNQVNAVDIIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDTPELASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V + VDY+NTHGT+
Sbjct: 240 ELEHAVARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQNV-DGVDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +D   +G+ IV +  +  ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ANLDEAGEGLDIVTEAREQ-ELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|152978564|ref|YP_001344193.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           succinogenes 130Z]
 gi|150840287|gb|ABR74258.1| Beta-ketoacyl synthase [Actinobacillus succinogenes 130Z]
          Length = 406

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/405 (58%), Positives = 296/405 (73%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG G++SSIGNN  EV  SL+  +SGI     F + G R  V G   LNAAELI
Sbjct: 1   MKRVVITGFGVISSIGNNKEEVLASLKAGKSGIETVPGFIEIGMRSHVAGTIKLNAAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+    ++ +L+M+EAI D+ L   ++++ERTGL+ G+G  S    V AAD  R
Sbjct: 61  DRKIYRFMGDAASYAYLSMKEAIEDAGLTEEQVSNERTGLVIGAGIGSAHYQVKAADAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K MSS+ SA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 SPRGVKAIGPYAVTKTMSSSVSACLATPFKIKGVNYSISSACATSAHCIGNAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWEGAAQFDAMGAISTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQA+  ++ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEVVGYGATSDGYDMVAPSGEGAERCMRQAMKDIDGPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELAAIKAVFGEQTPAISSTKSMTGHSLGAAGAHEAIYSLLMLHNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D + KG+ IV +  +NA + TV+SNSFGFGGTNATLVFRRY+
Sbjct: 361 ETLDEQAKGLNIVTETKENAGLKTVMSNSFGFGGTNATLVFRRYE 405


>gi|71735116|ref|YP_274213.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|257486371|ref|ZP_05640412.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289628098|ref|ZP_06461052.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289646719|ref|ZP_06478062.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|298486526|ref|ZP_07004586.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|71555669|gb|AAZ34880.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|298159003|gb|EFI00064.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320324905|gb|EFW80977.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320329271|gb|EFW85268.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330867453|gb|EGH02162.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330880826|gb|EGH14975.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330987451|gb|EGH85554.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. lachrymans str. M301315]
 gi|331010649|gb|EGH90705.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 407

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 299/407 (73%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMKDAITDSGLTEEQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  +    +DYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALGDINSGDIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGAKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPVVADMPILLKTREDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|83941263|ref|ZP_00953725.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Sulfitobacter sp. EE-36]
 gi|83847083|gb|EAP84958.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Sulfitobacter sp. EE-36]
          Length = 409

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/408 (56%), Positives = 309/408 (75%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL++  SGI  S +  + GFR +V G   ++ A+ I
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLASLKDGTSGIVASPEMTEHGFRSRVAGTLKIDVADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + ++AMQ+AI D+ L   +I++ RTGL+AGSGGPST  + +A ++ R
Sbjct: 61  DKRALRFMGGGAAYAYIAMQQAIADAGLSEDQISNPRTGLVAGSGGPSTSALFTAHNVVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 DTGATKRIGPFAVPKCMSSTVSANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P +ASR +D+ RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRAFDANRDGFVISGGGGMLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E AKARGA IYAE+TGY +T DG DMV+PSGEG  R MR AL ++ E   V YIN HG
Sbjct: 241 ELEHAKARGATIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALETLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G+ P + STKS+TGH+ GAAGA EAI+CL+M++  FI +S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGQGSTPPVSSTKSMTGHAQGAAGALEAIFCLLMLKNDFIAKS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DP+     I  +R+DNA +D+V++NSFGFGGTN +++  +++
Sbjct: 361 INVVDLDPKLDPSEIALERVDNAGLDSVMTNSFGFGGTNGSMILSKFQ 408


>gi|117619117|ref|YP_856451.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117560524|gb|ABK37472.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 403

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 307/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+G++SSIGNN  EV  SL+  +SGIT+SE F ++  R +VWG   L+ +ELI
Sbjct: 1   MRRAVITGIGVISSIGNNKEEVLASLKAGKSGITYSEQFEQYNLRSRVWGNIKLDPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L    +++ER+G++ GSGG S K    +AD+ R
Sbjct: 61  DRKVMRFMGDAAAYAYLSMQQAIEDAGLPEEMVSNERSGIVTGSGGASGKNTSESADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKI+G +Y+ISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTTSACLATPFKIKGVNYTISSACATSAHCIGHALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ +  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSSTIQFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGILVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+TGYG+T DG DMV+PSGEGA+RCM+ A+  V + VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEITGYGATSDGYDMVAPSGEGAVRCMKMAMQDVGK-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+ +F  N P + +TK++TGH+LGAAG  EA+Y L+MM+  FI  S NI
Sbjct: 299 TPVGDTKELEAIQTLFGSNAPKLSATKAMTGHALGAAGVHEAVYSLLMMEHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D +  G+PIVR   + A+++TV+SNSFGFGGTNA+LVF ++K
Sbjct: 359 ETLDEKAVGLPIVRA-YEEAELNTVMSNSFGFGGTNASLVFSKFK 402


>gi|84502856|ref|ZP_01000969.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Oceanicola batsensis
           HTCC2597]
 gi|84388839|gb|EAQ01709.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Oceanicola batsensis
           HTCC2597]
          Length = 409

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/409 (58%), Positives = 299/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGN   EV  +LR  RSGI  S + A+ GFR Q+ G   ++ AE I
Sbjct: 1   MRRVVVTGLGIVSSIGNTAEEVTAALRAGRSGIEASAEMAEHGFRSQIAGTLKIDPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + ++AMQ+AI D+ L    IT  RTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAYIAMQQAIADAGLDESHITDPRTGLVAGSGGPSTSAMLAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +   T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGGTKRIGPFAVPKCMSSTVSANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+LDWT+S LFDAMGAMSS FN  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDIMFAGGGEELDWTLSCLFDAMGAMSSKFNDTPARASRAFDEARDGFVISGGGGMVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           ++E A+ARGAKIYAE+TGY +T DG DMV+PSGEG  R M  ALS++ E   V YIN HG
Sbjct: 241 DLEHARARGAKIYAEVTGYAATSDGHDMVAPSGEGGERAMSLALSTLPEDRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G  P I STKS+TGH+ GAAGA EAI+CL+M+++ FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGTTPPISSTKSMTGHAQGAAGALEAIFCLLMLKDDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP  K   I    ++NA +DTV++NSFGFGGTN +++  RY G
Sbjct: 361 INVETLDPALKPEEIATALVENAGLDTVMTNSFGFGGTNGSMLLSRYHG 409


>gi|104782646|ref|YP_609144.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas
           entomophila L48]
 gi|95111633|emb|CAK16354.1| beta-ketoacyl-ACP synthase I (3-oxoacyl-[acyl-carrier-protein]
           synthase I) [Pseudomonas entomophila L48]
          Length = 405

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/406 (58%), Positives = 303/406 (74%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+ + V  +LR +R GI ++ ++ + G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKATVTENLRNSRPGIRYNPEYKEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAMQ+AI D+ L   +I++ RTGL+AGSGG ST   + A D  R
Sbjct: 61  DRKVYRFVGHAAAYAYLAMQDAIKDAGLTEEQISNPRTGLVAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGINYSISSACATSAHCIGTALEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+  N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTKRNETPELASRAYDADRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QALS+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++ +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEMKGVREVFGAKAPKISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PIVRK  ++AK+ TV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPIVRK-TEDAKLTTVMSNSFGFGGTNATLVLKRWEG 404


>gi|297182392|gb|ADI18557.1| 3-oxoacyl-(acyl-carrier-protein) synthase [uncultured gamma
           proteobacterium HF4000_23L14]
          Length = 405

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M+RV +TGMGIV S+GNN SEV  SL++A+SGI FSE +A+ G R  V+G    ++++++
Sbjct: 1   MKRVVITGMGIVCSLGNNKSEVLESLKKAKSGIEFSEKYAEMGLRSHVYGSISEIDSSDV 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK +RF++    +  +AM EAI  S L P  +++ERTGLI GSGG S + +V +AD+ 
Sbjct: 61  IDRKMLRFMADAAIYSAIAMDEAIKQSGLSPEIVSNERTGLIMGSGGASHQNVVESADIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     +R+GP+ VP+ M ST SA LST FKI+G +YSISSAC+TSAHCIGNA E IQ G
Sbjct: 121 RSK-GIKRVGPYRVPRTMGSTTSACLSTLFKIKGINYSISSACSTSAHCIGNAMEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+LDWT + LFDAMGA+SS +N  P  ASR YD+ RDGFVISGG   +VL
Sbjct: 180 KQDVIFAGGGEELDWTGTMLFDAMGALSSKYNDTPEKASRAYDANRDGFVISGGGGALVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E +E A+ARGA I AEL GYG+T DG DMV+PSGEGA RCM  A+S+V   +DYIN HGT
Sbjct: 240 ESLEHAEARGAHIIAELVGYGATSDGYDMVAPSGEGAKRCMELAISTVSGSIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE++AI++VF   IP I STKSL+GH+LGAAG  E+IY L+M++  F+ ES N
Sbjct: 300 STPVGDMKELQAIKQVFNSKIPLIGSTKSLSGHALGAAGVNESIYSLLMLENDFVAESVN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +D E +G+PIVRK     K++ +LSNSFGFGGTNA LVF R+ 
Sbjct: 360 IETLDEEAEGMPIVRKTT-QLKLNRILSNSFGFGGTNACLVFERFN 404


>gi|149910530|ref|ZP_01899169.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Moritella sp. PE36]
 gi|149806373|gb|EDM66346.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Moritella sp. PE36]
          Length = 405

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/404 (58%), Positives = 302/404 (74%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN +EV  SL+   SGI FS  FA+   R  V G   L+  E+I
Sbjct: 1   MKRAVITGIGIVSSIGNNKAEVCESLKAGNSGIEFSPQFAEQNLRSHVCGSVNLDPKEII 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + ++AMQEAI DS L   ++++ RTGLIAGSGG S+K +V + D+ R
Sbjct: 61  DRKAMRFMGDAAAFSYIAMQEAIDDSGLTAEQVSNVRTGLIAGSGGASSKNVVDSVDIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              S +R+GP+ V + MSST SA L+T FKI+G SYSI+SACATSAHCIG+A E IQ GK
Sbjct: 121 NK-SVKRVGPYMVTRTMSSTISACLATPFKIKGPSYSITSACATSAHCIGHAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD  RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEEIDWTLALEFDAMGALSTKYNDTPQQASRTYDKNRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+TGYG+T DG DMV+PSGEGAIRCM+QAL +V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGATIYAEITGYGATSDGYDMVAPSGEGAIRCMKQALETVDGEIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+ VF    P I +TKSLTGH+LGAAG  EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDTKELEAIQAVFGHKSPKISATKSLTGHALGAAGVHEAIYSLIMMENSFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E++D +  G+ IV  +  +A++  V+SNSFGFGGTNATLVF ++
Sbjct: 360 EDLDEKADGLDIVSGQAIDAELTNVMSNSFGFGGTNATLVFSKF 403


>gi|331004816|ref|ZP_08328234.1| 3-oxoacyl-(acyl-carrier-protein) synthase, KASI [gamma
           proteobacterium IMCC1989]
 gi|330421347|gb|EGG95595.1| 3-oxoacyl-(acyl-carrier-protein) synthase, KASI [gamma
           proteobacterium IMCC1989]
          Length = 403

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/403 (57%), Positives = 300/403 (74%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVS +GN+   V  +L++ +SGI+F +++A  GFR  + G   ++  E I
Sbjct: 1   MKRVVITGMGIVSCLGNDKETVLNALKDGKSGISFQQNYADMGFRSHIAGSIDIDIKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQ+AI DS L   ++++ERTG+I GSGG S+  +V +AD+ R
Sbjct: 61  DRKTLRFMGDAAAYNYIAMQQAIDDSGLTEEQVSNERTGIIVGSGGASSSNLVESADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 ER-GLKRVGPYRVTQTMGSTTSACLATPFKIKGVNYSISSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W+MS LFDAMGA+S+ +N  P +ASR YD+ RDGFVISGG   + LE
Sbjct: 180 QDVVFAGGAEELHWSMSCLFDAMGALSTKYNETPENASRAYDANRDGFVISGGGGWVGLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA IYAEL GYG+T DG DMV+PSGEGA RCMRQA++ ++ P+DYIN HGT+
Sbjct: 240 EYEYAKARGATIYAELVGYGATSDGYDMVAPSGEGAARCMRQAIADIDAPIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A++EVF  +IP I STKSL GHSLGA G QEAIY L+MM+  FI  S N+
Sbjct: 300 TPVGDLAELRAVKEVFADDIPSISSTKSLAGHSLGATGVQEAIYTLLMMKHNFICASANV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           + +D E KG+PIV +R D   I   LSNSFGFGGTNA+LVF++
Sbjct: 360 DTLDDEAKGMPIVTERQDGINIKHALSNSFGFGGTNASLVFKQ 402


>gi|85713192|ref|ZP_01044222.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Idiomarina baltica
           OS145]
 gi|85692990|gb|EAQ30958.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Idiomarina baltica
           OS145]
          Length = 404

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 304/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIG N  EV  SLR  +SGI  SE FA+ G RCQVWG   L+  + I
Sbjct: 1   MRRAVITGLGIVSSIGTNQKEVLESLRTGKSGIERSESFAEMGLRCQVWGPVRLDVKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AMQ+AI D+ L   E+++ RTGL+ GSGG S +  V+AAD+ R
Sbjct: 61  DRKALRFMGDSAAYAYIAMQQAIEDAGLSEEEVSNPRTGLVVGSGGASGEHQVAAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 ER-GVKRVGPYMVPRCMASTTSACLATPFKIKGINYSISSACATSAHCIGHALELIQFGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD +FAGG E+L WT+   FDAMGA+S+ +N  P  ASR YD  RDGFV +GG  ++V+E
Sbjct: 180 QDRVFAGGGEELHWTLGMEFDAMGALSTKYNDTPEKASRTYDRDRDGFVPAGGGGILVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGA IYAE+ GYG+T DG DMV+PSGEGAIRCM+ A+ +V+ P+DY+NTHGT+
Sbjct: 240 ELEAAKARGATIYAEIVGYGATSDGYDMVAPSGEGAIRCMKMAMETVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIREVF    P+I +TK++TGH+LGAAG  EAIY L+MM+  F+  S NI
Sbjct: 300 TPVGDVKELEAIREVFPEKTPFISATKAMTGHALGAAGVHEAIYSLLMMKNGFVTPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D   +G+ IVR+  + AK+ TV+SNSFGFGGTNA+LV R Y+
Sbjct: 360 DNLDEAAEGMNIVREPTE-AKLRTVMSNSFGFGGTNASLVLREYQ 403


>gi|323491471|ref|ZP_08096655.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio brasiliensis
           LMG 20546]
 gi|323314340|gb|EGA67420.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio brasiliensis
           LMG 20546]
          Length = 403

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKEGKSGITASEQFKEHGLRSQVWGDLKINPAEFI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLTDEQVSNDRTGIVAGSGGASALNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPDKASRTYDADRDGFVISGGGGMMVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDVDS-IDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +D   +G+ IV ++ D A++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ANLDEAAQGLDIVTEKRD-AELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|307943427|ref|ZP_07658771.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Roseibium sp.
           TrichSKD4]
 gi|307773057|gb|EFO32274.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Roseibium sp.
           TrichSKD4]
          Length = 407

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 247/407 (60%), Positives = 309/407 (75%), Gaps = 1/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG N  EV  SL+E +SGI+F+ D+A+ GFR QV G P ++ A L+
Sbjct: 1   MRRVVVTGIGIVSSIGANADEVLTSLKEGKSGISFAPDYAEHGFRSQVHGMPNVDIASLV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + ++AM++A+ DS L+  ++++ERTGLI GSGGPSTK +  A  +  
Sbjct: 61  DKRQLRFMGDGAAYNYIAMEQALKDSGLEDKDVSNERTGLIMGSGGPSTKNLFQAHKIVV 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIG A E IQ GK
Sbjct: 121 EKGSPKRMGPFMVTRGMSSTNSACLATPFKIKGINYSITSACSTSAHCIGAATEQIQFGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P +ASR YD+ RDGFVI+GG  V+VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNGTPETASRAYDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E+E AKARGAKIYAE+TGY +  DG DMV+PSGEG  RCMR A S++ +  V YINTHGT
Sbjct: 241 ELEHAKARGAKIYAEVTGYAANSDGYDMVAPSGEGGERCMRLATSTLGDRKVSYINTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD  E+EAIR VF  + P   STKSLTGHSLGA G QEAIYCL+M++  F+  S N
Sbjct: 301 STPVGDVGEIEAIRRVFGEDQPKASSTKSLTGHSLGATGVQEAIYCLLMLENDFMTASAN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I E+DP  K   IV +RIDNA +D+VLSNSFGFGGTNA+LV  RY G
Sbjct: 361 INELDPAIKPEEIVTERIDNAGLDSVLSNSFGFGGTNASLVLSRYLG 407


>gi|56460129|ref|YP_155410.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Idiomarina loihiensis
           L2TR]
 gi|56179139|gb|AAV81861.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Idiomarina loihiensis
           L2TR]
          Length = 404

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 304/404 (75%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIGNN  EV  SLR  +SGIT SE FA+ G RCQVWG+  L+  + I
Sbjct: 1   MRRAVITGLGIVSSIGNNQEEVLESLRTGKSGITRSESFAEMGLRCQVWGEVKLDPKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM +AI DS L   +++H RTGL+ GSGG S +  V+AAD+ R
Sbjct: 61  DRKALRFMGDSAAYAYIAMAQAIEDSGLTEEQVSHPRTGLVVGSGGASGEHQVAAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +++GP+ VP+ M+ST SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 ER-GVKKVGPYMVPRCMASTTSACLATPFKIKGVNYSISSACATSAHCIGHALELIQFGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD +FAGG E+L WT+   FDAMGA+S+ +N  P  ASR YD  RDGFV +GG  ++V+E
Sbjct: 180 QDRVFAGGGEELHWTLGMEFDAMGALSTKYNDTPEKASRTYDQGRDGFVPAGGGGILVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E AKARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V+ P+DY+NTHGT+
Sbjct: 240 ELEAAKARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMETVDTPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIREVF    P I +TK++TGH+LGAAG  EAIY L+M++  F+  S NI
Sbjct: 300 TPVGDVKELEAIREVFPEKTPMISATKAMTGHALGAAGVHEAIYSLLMLKNGFVTPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +D +  G+ I+++  + A + TV+SNSFGFGGTNA+LV R+Y
Sbjct: 360 EALDEKADGMNIIQQTTE-APLRTVMSNSFGFGGTNASLVMRQY 402


>gi|332992499|gb|AEF02554.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Alteromonas sp. SN2]
          Length = 404

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/407 (57%), Positives = 308/407 (75%), Gaps = 4/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIG N  +V  SL+  +SGIT SE FA+ G R QVWG   ++  E I
Sbjct: 1   MRRAVITGLGIVSSIGVNKQDVLASLKAGKSGITHSEQFAEMGLRSQVWGNIDIDLKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + ++AMQ+AI DS L+  +I+++RTG+IAGSGG S++  V +AD+ R
Sbjct: 61  DRKAMRFMGDAAAYAYVAMQQAIEDSGLEDSDISNDRTGIIAGSGGASSENQVLSADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKIRG +YSI+SACATS+H IGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRCMASTVSACLATPFKIRGVNYSIASACATSSHSIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W +S+ FDAMGA+SS +N +P  ASR YD+ RDGFV SGG  ++V+E
Sbjct: 180 QDVVFAGGGEELHWALSSQFDAMGALSSKYNDNPSVASRTYDAARDGFVSSGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+ +V  P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEVVGYGATSDGFDMVAPSGEGAIRCMKMAMQNVSAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD KE+ AI+EVF +  +P I +TKSLTGH+LGAAG  EAIY L+MM+  FI  S N
Sbjct: 300 TPVGDVKELAAIQEVFGQSGVP-ISATKSLTGHALGAAGVNEAIYSLLMMENNFIAPSIN 358

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+ +D    G+ IV +  + A ++TV+SNSFGFGGTNATLV +RY+G
Sbjct: 359 IDTLDDAADGLDIVTQARE-ATLNTVMSNSFGFGGTNATLVMQRYQG 404


>gi|254506879|ref|ZP_05119018.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Vibrio
           parahaemolyticus 16]
 gi|219550164|gb|EED27150.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Vibrio
           parahaemolyticus 16]
          Length = 403

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLQEGKSGITASEQFKEQGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   ++++ERTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLSEDQVSNERTGIVAGSGGASALNQALAVDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGMLVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V E +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQEV-EGIDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  + P I +TK++TGH+LGAAG  EAIY  +M+   F+  S N+
Sbjct: 299 TPVGDVKELGAIQELFGESSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFVAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV ++ D  ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDEAAQGLDIVTEKRD-VELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|297183275|gb|ADI19413.1| 3-oxoacyl-(acyl-carrier-protein) synthase [uncultured
           Pseudomonadales bacterium HF0500_12O04]
          Length = 406

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 299/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR +R GI F+ ++A+ G R QV G   L   ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVSANLRASRPGIRFNPEYAEMGLRSQVSGSIDLPLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D+ R
Sbjct: 61  DRKIYRFVGHAAAYAYLAMKDAITDSGLTEEQVSNPRTGLIAGSGGASTLNQMEALDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGTAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNDTPEKASRAYDKNRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ A+S+V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMAMSTVDGPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+E +R VF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVKEMEGVRAVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGNFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EE+DP    +PI+ K  +N  ++ V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 EELDPTVADMPILTKTRENVTLNNVMSNSFGFGGTNATLVLKRWAG 405


>gi|330829441|ref|YP_004392393.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Aeromonas veronii
           B565]
 gi|328804577|gb|AEB49776.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Aeromonas veronii
           B565]
          Length = 399

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/400 (57%), Positives = 305/400 (76%), Gaps = 3/400 (0%)

Query: 6   VTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAM 65
           +TG+G++SSIGNN  EV  SL+  +SGIT+SE F +   R +VWG   L+ +ELIDRK M
Sbjct: 2   ITGIGVISSIGNNKEEVLASLKAGKSGITYSEQFEQHNLRSRVWGNIKLDPSELIDRKVM 61

Query: 66  RFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCST 125
           RF+     + +L+MQ+AI D+ L   ++++ERTGL+ GSGG S K    + D+ RE    
Sbjct: 62  RFMGDAAAYAYLSMQQAIADAGLAEDQVSNERTGLVVGSGGASGKNTSESVDIAREK-GV 120

Query: 126 RRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMF 185
           +R+GP+ VP+ MSST SA L+T F+I+G +YSISSACATSAHCIG+A ELIQ GKQD++F
Sbjct: 121 KRVGPYMVPRTMSSTTSACLATPFQIKGVNYSISSACATSAHCIGHALELIQLGKQDVVF 180

Query: 186 AGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERA 245
           AGG E+LDW+ +  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  V+V+EE+E A
Sbjct: 181 AGGGEELDWSSTIQFDAMGALSTKYNDTPEKASRTYDANRDGFVISGGGGVLVIEELEHA 240

Query: 246 KARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGD 305
            ARGA IYAELTGYG+T DG DMV+PSGEGA+RCM+ A+  V + VDYINTHGT+TP GD
Sbjct: 241 LARGAHIYAELTGYGATSDGYDMVAPSGEGAVRCMKMAMQGVGK-VDYINTHGTSTPVGD 299

Query: 306 KKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDP 365
            KE+EAI+ +F  N P I +TK++TGH+LGAAG  EA+Y L+MM+  FI  S NIE +D 
Sbjct: 300 TKELEAIQTLFGANGPKISATKAMTGHALGAAGVHEAVYSLLMMEHGFIAPSINIETLDE 359

Query: 366 EFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +G+PIVR+  + A+++TV+SNSFGFGGTNA+LVF ++K
Sbjct: 360 KAEGLPIVRE-YEAAELNTVMSNSFGFGGTNASLVFSKFK 398


>gi|114770157|ref|ZP_01447695.1| 3-oxoacyl-(Acyl-carrier-protein) synthase [alpha proteobacterium
           HTCC2255]
 gi|114548994|gb|EAU51877.1| 3-oxoacyl-(Acyl-carrier-protein) synthase [alpha proteobacterium
           HTCC2255]
          Length = 408

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/408 (59%), Positives = 303/408 (74%), Gaps = 2/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI+SSIGN+++EV  SL+  RSGI  + D+ + GFR Q+ G P ++  E I
Sbjct: 1   MRRVVVTGMGIISSIGNDINEVTESLKTGRSGIVAAPDYTEKGFRSQIHGLPKIDVTEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ MRF+ QG  + +LAM++AI DS L+  ++++ERTG++ GSGGPST  + +A  +T 
Sbjct: 61  DKRQMRFMGQGAAYNYLAMEQAIADSGLEDSDVSNERTGMVMGSGGPSTINLFNAHQITL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              + +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  E IQ GK
Sbjct: 121 AKGAPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGVEQIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+MS LFDAMGAMSS +N  P  ASR +D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIVFAGGGEELDWSMSCLFDAMGAMSSKYNDTPEKASRAFDANRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           E+  A ARGAKIYAE+TGYG+T DG DMV+PSGEG  R M+ A+S++ E  V+YIN HGT
Sbjct: 241 ELSHAVARGAKIYAEVTGYGATSDGHDMVAPSGEGGERSMKLAVSTIGERSVNYINAHGT 300

Query: 300 ATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           +TP GD  EVEA+R VF   + P I STKSLTGHSLGA G QEAIY LIM+   FI  S 
Sbjct: 301 STPAGDVTEVEAVRRVFLDKHQPVISSTKSLTGHSLGATGVQEAIYSLIMLDRDFITASS 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           NI E+DP      I  KRIDNA +DTVLSNSFGFGGTNA+L   +Y G
Sbjct: 361 NISELDPALNANEIATKRIDNAGLDTVLSNSFGFGGTNASLAMSKYNG 408


>gi|323496530|ref|ZP_08101584.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio sinaloensis
           DSM 21326]
 gi|323318374|gb|EGA71331.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio sinaloensis
           DSM 21326]
          Length = 403

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 304/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL++ +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLQQGQSGITASEQFKEQGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI DS L   ++++ERTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDSGLTEEQVSNERTGIVAGSGGASALNQALAVDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPDKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V + +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDV-DGIDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  + P I +TK++TGH+LGAAG  EAIY  +M++  F+  S N+
Sbjct: 299 TPVGDVKELGAIQELFGASSPAISATKAMTGHALGAAGVHEAIYSTLMLENNFVAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV ++ D  ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDEAAQGLDIVTEKRD-VELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|253996906|ref|YP_003048970.1| beta-ketoacyl synthase [Methylotenera mobilis JLW8]
 gi|253983585|gb|ACT48443.1| Beta-ketoacyl synthase [Methylotenera mobilis JLW8]
          Length = 410

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 242/406 (59%), Positives = 294/406 (72%), Gaps = 6/406 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV +TG GIVSS+GNN SEV  SL+  +SGIT+  ++A  G R  V G    L   EL
Sbjct: 1   MRRVVITGFGIVSSLGNNKSEVLASLKSGQSGITYQPEYAAMGLRSHVAGSIKNLKVEEL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK MRF+++G  +  LAMQEAI DS+L    +++ RTGLI G+GG S + I+   D  
Sbjct: 61  IDRKLMRFMAKGHAYAWLAMQEAIADSKLPEEMVSNVRTGLIVGAGGASHESILEGVDTL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    RR+GP+ V KAM+S  SA L+T  KI+G +Y ISSAC+TSAHCIG   E IQ G
Sbjct: 121 REK-GVRRVGPYMVTKAMASGVSACLATGAKIKGINYGISSACSTSAHCIGAGVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+  WT+S +FDAMGA+SS +N  P  ASR YD+ RDGFVISGG  ++VL
Sbjct: 180 KQDIIFAGGAEEEHWTLSFMFDAMGALSSKYNETPDKASRTYDADRDGFVISGGGGIVVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL  V+  +DYINTHGT
Sbjct: 240 EEYEHAKARGAKIYAEVVGYGATSDGYDMVAPSGEGAVRCMKLALEGVDAKIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGN----IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIG 355
           +TP GD KE+EAIREVF  N     P I STKSL+GH+LGAAG  EAIY L+MM+  FI 
Sbjct: 300 STPVGDVKELEAIREVFGENGLNQQPAIASTKSLSGHALGAAGVNEAIYTLLMMENNFIA 359

Query: 356 ESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVF 401
            S NIE +DP  +G+ IVR  I+N KI+T LSNSFGFGGTNATL  
Sbjct: 360 ASANIETLDPAAEGLNIVRTAIENVKIETALSNSFGFGGTNATLTL 405


>gi|71281360|ref|YP_270470.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Colwellia
           psychrerythraea 34H]
 gi|71147100|gb|AAZ27573.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Colwellia
           psychrerythraea 34H]
          Length = 403

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 308/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SL+  +SGI+ SE FA+ G R QVWGKP +   + I
Sbjct: 1   MKRVVITGLGIVSSIGNNADEVLASLKAGKSGISHSESFAEQGLRSQVWGKPDIETKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM +A+ D++L   ++++ RTG++AGSGG S++ IV++ D  R
Sbjct: 61  DRKAIRFMGDAAGYAYIAMDQAVKDAKLTEDQVSNFRTGIVAGSGGASSENIVASTDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RR+GP+AVPK M ST SA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 NR-GIRRVGPYAVPKTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W+++ +FD MGA+S+  N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEEVHWSLAMMFDGMGALSAGRNDTPELASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAEL GYG+T DG DMV+PSGEGA+RCM+QA+  VE  +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAELVGYGATSDGYDMVAPSGEGAVRCMQQAMQGVEGKLDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  + P I +TK++TGH+LGAAG  EAIY ++MM+  F+  S NI
Sbjct: 300 TPVGDVKELGAIQELFGEDSPAISATKAMTGHALGAAGVHEAIYSILMMENNFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D + +G+ IV ++ D  +++ V+SNSFGFGGTNATLV ++YK
Sbjct: 360 DNLDEKAQGLDIVTEKRD-VELNLVMSNSFGFGGTNATLVMKKYK 403


>gi|83854740|ref|ZP_00948270.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Sulfitobacter sp.
           NAS-14.1]
 gi|83842583|gb|EAP81750.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Sulfitobacter sp.
           NAS-14.1]
          Length = 429

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/408 (56%), Positives = 309/408 (75%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL++  SGI  S +  + GFR +V G   ++ A+ I
Sbjct: 21  MRRVVVTGLGIVSSIGNNAEEVLASLKDGTSGIVASPEMTEHGFRSRVAGTLKIDVADHI 80

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + ++AMQ+AI D+ L   +I++ RTGL+AGSGGPST  + +A ++ R
Sbjct: 81  DKRALRFMGGGAAYAYIAMQQAIADAGLSEDQISNPRTGLVAGSGGPSTSALFTAHNVVR 140

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 141 DTGATKRIGPFAVPKCMSSTVSANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMLGK 200

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P +ASR +D+ RDGFVISGG  ++VLE
Sbjct: 201 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRAFDANRDGFVISGGGGMLVLE 260

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E AKARGA IYAE+TGY +T DG DMV+PSGEG  R MR AL ++ +   V YIN HG
Sbjct: 261 ELEHAKARGATIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALETLPKGRKVGYINAHG 320

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G+ P + STKS+TGH+ GAAGA EAI+CL+M++  FI +S
Sbjct: 321 TSTPVGDVGEIEAVRRVFGQGSTPPVSSTKSMTGHAQGAAGALEAIFCLLMLKNDFIAKS 380

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DP+     I  +R+DNA +D+V++NSFGFGGTN +++  +++
Sbjct: 381 INVVDLDPKLDPSEIALERVDNAGLDSVMTNSFGFGGTNGSMILSKFQ 428


>gi|330888164|gb|EGH20825.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 407

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/407 (58%), Positives = 298/407 (73%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMKDAITDSGLTEEQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACA SAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACAPSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  +    +DYINTHGT
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALGDINSGDIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+E +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 STPVGDAKEMEGVREVFGAKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPVVADMPILLKTREDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|297538287|ref|YP_003674056.1| beta-ketoacyl synthase [Methylotenera sp. 301]
 gi|297257634|gb|ADI29479.1| Beta-ketoacyl synthase [Methylotenera sp. 301]
          Length = 411

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/407 (59%), Positives = 297/407 (72%), Gaps = 7/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV +TGMGIVSS+GNN +EV  SL+  +SGIT+  ++A+ G R  V G    LN  EL
Sbjct: 1   MRRVVITGMGIVSSLGNNKTEVLESLKSGKSGITYQPEYAEMGLRSHVAGSIKNLNVEEL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK MRF+++G  +  LAMQEAI D++L    I++ RTGLI G+GG S + I+   D  
Sbjct: 61  IDRKLMRFMAKGHAYAWLAMQEAIADAQLAEEYISNVRTGLIVGTGGASHESIMQGIDTL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    RR+GP+ V KAM+S  SA L+T  KI+G +Y ISSAC+TSAHCIG   E IQ G
Sbjct: 121 REK-GVRRVGPYMVTKAMASGVSACLATGAKIKGINYGISSACSTSAHCIGAGVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+  WT+S +FD MGA+SS +N  P  ASR YD+ RDGFVISGG  ++VL
Sbjct: 180 KQDIIFAGGAEEEHWTLSFMFDGMGALSSKYNETPDKASRTYDADRDGFVISGGGGIVVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE----EPVDYIN 295
           EE E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL   +      VDYIN
Sbjct: 240 EEYEHAKARGAKIYAEVIGYGATSDGYDMVAPSGEGAVRCMQLALQGHDGKAIAKVDYIN 299

Query: 296 THGTATPKGDKKEVEAIREVFKGNIPY-IQSTKSLTGHSLGAAGAQEAIYCLIMMQERFI 354
           THGT+TP GD KE+EAIREVF  N P  I STKSL+GH+LGAAG  EAIY L+MM+  FI
Sbjct: 300 THGTSTPVGDTKELEAIREVFGANNPVAIASTKSLSGHALGAAGVNEAIYTLLMMENNFI 359

Query: 355 GESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVF 401
             S NI+ +DP  +G+ IVR RIDN KI+T LSNSFGFGGTNATL+ 
Sbjct: 360 AASANIDNLDPGAEGLNIVRNRIDNVKIETALSNSFGFGGTNATLLL 406


>gi|254490501|ref|ZP_05103687.1| Beta-ketoacyl synthase, N-terminal domain protein [Methylophaga
           thiooxidans DMS010]
 gi|224464245|gb|EEF80508.1| Beta-ketoacyl synthase, N-terminal domain protein [Methylophaga
           thiooxydans DMS010]
          Length = 405

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 300/405 (74%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GI S +G + + V  SLR  +SGI F +++A  GFR  V G   ++  E I
Sbjct: 1   MRRVVVTGLGITSCLGLDATTVTESLRNGKSGIRFKQEYADMGFRSHVAGTIDIDFKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +++MQ+AI DS L   ++++ RTGLI GSGG S+   V AAD+ R
Sbjct: 61  DRKTLRFMGDAAAYSYISMQQAIADSGLSDEQVSNVRTGLIMGSGGASSANQVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T FKI+G +YS+SSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GLKRIGPYRVTQVMGSTTSACLATPFKIKGVNYSMSSACATSAHCIGTAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+MS+LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  V+VLE
Sbjct: 180 QDIVFAGGGEEEHWSMSSLFDAMGALSTKYNESPEKASRAYDADRDGFVIAGGGGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGAKIYAELTGYG+T DG DMV+PSGEGA RCM  A+S++   V YIN HGT+
Sbjct: 240 EYEHAKARGAKIYAELTGYGATSDGYDMVAPSGEGAQRCMELAMSTIRGKVQYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AI++ F  +IPY+ STKSL+GHSLGAAG QEAIY L+M+Q+ F+  S NI
Sbjct: 300 TPVGDLAELGAIKKTFGDDIPYVGSTKSLSGHSLGAAGVQEAIYSLLMLQDDFLAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +DPE + +PI+R+R+DNA + TV+SNSFGFGGTNA LVF + +
Sbjct: 360 ETLDPEAEAVPILRERVDNAGLTTVMSNSFGFGGTNACLVFEKLE 404


>gi|148982201|ref|ZP_01816638.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrionales bacterium
           SWAT-3]
 gi|145960626|gb|EDK25976.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrionales bacterium
           SWAT-3]
          Length = 403

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 307/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N A+ I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKEGKSGITASEQFKENGLRSQVWGNLKMNPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L   +++++RTG++AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAIADAGLTEEQVSNDRTGIVAGSGGASSLNQVNAVDIIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDTPELASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V + VDY+NTHGT+
Sbjct: 240 ELEHAVARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQNV-DGVDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D    G+ IV +  +  ++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 359 SNLDEAAAGLDIVTETREQ-ELTTVMSNSFGFGGTNATLVIKKYQ 402


>gi|261252349|ref|ZP_05944922.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio orientalis
           CIP 102891]
 gi|260935740|gb|EEX91729.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio orientalis
           CIP 102891]
          Length = 403

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 302/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKEGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLTDEQVSNDRTGIVAGSGGASALNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDVDS-IDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQELFGSNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +D    G+ IV ++ D A++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ANLDEAAAGLDIVTEKRD-AELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|91776245|ref|YP_546001.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Methylobacillus
           flagellatus KT]
 gi|91710232|gb|ABE50160.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Methylobacillus
           flagellatus KT]
          Length = 407

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 245/404 (60%), Positives = 294/404 (72%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV VTGMGI+SS+GNN SEV  SL+  RSGI F +++   G R  V G    L+   L
Sbjct: 1   MRRVVVTGMGIISSLGNNKSEVLDSLKAGRSGIRFQQEYVDQGLRSHVAGSIENLDLEAL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK MRF+ +G  +  LAMQEAI D+ L P  +++ RTGLI G GG S + I+S  D  
Sbjct: 61  IDRKLMRFMGKGHAYAWLAMQEAIADAGLPPQLVSNIRTGLIVGQGGASHESILSGVDTL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     RR+GP+ V KAM+S  SA L+T  +I+G +Y ISSACATSAHCIG A E IQ G
Sbjct: 121 RAK-GVRRVGPYMVTKAMASGVSACLATGAEIKGINYGISSACATSAHCIGAAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+  WT+S +FDAMGA+SS +N  P  ASR YD  RDGFVISGG  ++V+
Sbjct: 180 KQDIVFAGGGEEEHWTLSFMFDAMGALSSKYNATPEKASRTYDVDRDGFVISGGGGILVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE E AKARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMR AL  VE PVDYINTHGT
Sbjct: 240 EEYEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRLALQGVEGPVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+EAIR VF  +   I STKSL+GH+LGAAG  EAIY L+MM+ +FI  S N
Sbjct: 300 STPVGDVKELEAIRAVFGDSGVAIASTKSLSGHALGAAGVNEAIYTLLMMEHQFIAASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I+ +DP  +G+ IVR+RIDNA I T +SNSFGFGGTNATL F R
Sbjct: 360 IDNLDPAAEGLNIVRERIDNANIQTAVSNSFGFGGTNATLTFSR 403


>gi|163801899|ref|ZP_02195796.1| 3-oxoacyl- [Vibrio sp. AND4]
 gi|159174407|gb|EDP59211.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio sp. AND4]
          Length = 403

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 301/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKEGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDANLTDEQVSNDRTGIVAGSGGASALNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDVDS-IDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNSFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D    G+ IV ++ D A++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 359 ANLDEAATGLDIVTEKRD-AELTTVMSNSFGFGGTNATLVIKKYQ 402


>gi|83649038|ref|YP_437473.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Hahella chejuensis KCTC
           2396]
 gi|83637081|gb|ABC33048.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Hahella chejuensis KCTC
           2396]
          Length = 404

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 304/406 (74%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVS +GN+  EVA SL+  RSGI F+E + + G R QV G   ++ AE I
Sbjct: 1   MKRAVITGMGIVSCLGNSKEEVAESLKAGRSGIRFNESYKEAGLRSQVSGSVQIDFAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AM +AITD+++    ++  RTG++ GSGG ST  +V + D+ R
Sbjct: 61  DRKHLRFMGDAAAYAYIAMNQAITDAKIDDELLSSTRTGIVMGSGGASTSNVVESVDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+S+ +A LST FKIRG +YSI+SACAT+AHCIG+A E IQ GK
Sbjct: 121 EK-GVKRVGPYRVPRTMNSSVNACLSTAFKIRGVNYSITSACATAAHCIGHAWEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+++ LFDAMGA+SS +N DP  ASRPY S RDGFVI+GG AV+V+E
Sbjct: 180 QDVVFAGGGEEEHWSLAVLFDAMGALSSKYNDDPSRASRPYCSTRDGFVIAGGGAVVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGA IYAEL GYG+T DGDDMV+PSGEGA+RC+ QALS+V  PVDY+NTHGT+
Sbjct: 240 ELEHALRRGAPIYAELVGYGATSDGDDMVAPSGEGAVRCIHQALSTVNTPVDYVNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A++E F  N+P I STKSL+GHSLG AG  EAIYCL+MM+  FI  S++I
Sbjct: 300 TPVGDIIELKAVKEAFGDNLPRISSTKSLSGHSLGVAGVHEAIYCLLMMEGGFIAPSRHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D    G PIV +  D A+++TVLSNSFGFGGTNA L F +YKG
Sbjct: 360 EALDERAAGFPIVTEPTD-AELNTVLSNSFGFGGTNACLAFSKYKG 404


>gi|254487659|ref|ZP_05100864.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp. GAI101]
 gi|214044528|gb|EEB85166.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp. GAI101]
          Length = 412

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/408 (56%), Positives = 306/408 (75%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+   SGI  S +  + GFR +V G   ++ A+ I
Sbjct: 4   MRRVVVTGLGIVSSIGNNAEEVLASLKAGTSGIVASPEMTEHGFRSRVAGTLKIDVADHI 63

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + ++AM +AI D+ L   +I++ RTGL+AGSGGPST  + +A ++ R
Sbjct: 64  DKRALRFMGSGAAYAYIAMAQAIADAGLTEEQISNPRTGLVAGSGGPSTSALFTAHNVVR 123

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 124 DTGATKRIGPFAVPKCMSSTVSANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 183

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P +ASR +D+ RDGFVISGG  ++VLE
Sbjct: 184 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRAFDANRDGFVISGGGGMLVLE 243

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E AKARGA IYAE+TGY +T DG DMV+PSGEG  R MR AL S+ E   V YIN HG
Sbjct: 244 ELEHAKARGATIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALQSLPEGRKVGYINAHG 303

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G  P + STKS+TGH+ GAAGA EA++CL+M++  FI +S
Sbjct: 304 TSTPVGDVGEIEAVRRVFGQGTTPPVSSTKSMTGHAQGAAGALEAVFCLLMLKHDFIAKS 363

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DP+     I  +R+D+A +D+V++NSFGFGGTN +++  ++K
Sbjct: 364 INVVDLDPKLDPSEIALERVDDAGLDSVMTNSFGFGGTNGSMILSKFK 411


>gi|254228470|ref|ZP_04921896.1| beta-ketoacyl synthase, N-terminal domain protein [Vibrio sp. Ex25]
 gi|262393643|ref|YP_003285497.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio sp. Ex25]
 gi|151939058|gb|EDN57890.1| beta-ketoacyl synthase, N-terminal domain protein [Vibrio sp. Ex25]
 gi|262337237|gb|ACY51032.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio sp. Ex25]
          Length = 403

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMEQAIADAGLTEDQVSNDRTGIVAGSGGASAYNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNDTPDKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V + VDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQDV-DGVDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+++F  N P I +TK++TGH+LGAAG  EAIY  +M+ + FI  S NI
Sbjct: 299 TPVGDVKELGAIQQLFGENSPAISATKAMTGHALGAAGVHEAIYSTLMLDKNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDEAAQGLDIVTEARD-AELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|260427094|ref|ZP_05781073.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Citreicella sp. SE45]
 gi|260421586|gb|EEX14837.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Citreicella sp. SE45]
          Length = 409

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/408 (57%), Positives = 301/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  RSGIT +E   + GFR QV G   ++ A  +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAQEVLASLKAGRSGITANEQMKEHGFRSQVAGAVDIDVAAHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +++A+RF+  G  + H+AMQ+AITDS L+  ++ + RTGL+AGSGGPST  +++A     
Sbjct: 61  EKRALRFMGPGAAYAHIAMQQAITDSGLEEGDVINPRTGLVAGSGGPSTSALLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  ST+R+GP AVPKAM ST SA L+T F+I+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGSTKRVGPVAVPKAMCSTVSANLATAFQIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS+FN  P  ASR +D  RDGFVISGG  +IVLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSNFNDTPEKASRAFDKDRDGFVISGGGGIIVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E A+ARGA+IYAE+TGY +T DG +MV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 ELEHARARGARIYAEVTGYAATSDGHNMVAPSGEGGERAMRLALSTLPEDRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF  G+ P + STKS+TGHS GA GAQEAIYCL+ ++  FI  S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGTGSTPPVSSTKSMTGHSQGATGAQEAIYCLLALEHDFIIPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+E +D       I    ++NA +DTV++NSFGFGGTN +++  RY+
Sbjct: 361 INVETLDEALDPAEIATALVENAGLDTVMTNSFGFGGTNGSMLLSRYR 408


>gi|254295398|ref|YP_003061421.1| beta-ketoacyl synthase [Hirschia baltica ATCC 49814]
 gi|254043929|gb|ACT60724.1| Beta-ketoacyl synthase [Hirschia baltica ATCC 49814]
          Length = 410

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 300/406 (73%), Gaps = 5/406 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV VTGMGIVSSIG+N+ EV  SL+  +SGITFS+D+A  GFRC + GKP     E I
Sbjct: 6   LRRVVVTGMGIVSSIGDNIKEVTESLKNGKSGITFSQDYADRGFRCHLVGKPKAIPKEHI 65

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +++AMRF+  G  + ++AM++A+ D  L    +++ RTGLI G+GGPST+ IV AAD+ R
Sbjct: 66  EKRAMRFMGDGSGYCYMAMEQALEDCGLPEELVSNPRTGLIVGTGGPSTRAIVEAADIAR 125

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGPFAVPKAM STASA LST FKI G +YSISSAC TS HCIG AAE IQ GK
Sbjct: 126 EK-GIKRIGPFAVPKAMCSTASAALSTMFKILGVNYSISSACTTSLHCIGAAAEQIQWGK 184

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG ++++W+ S LFDAMGAMSS +N  P  ASR +D  RDGFVISGGA ++VLE
Sbjct: 185 QDIMFAGGGDEVEWSFSALFDAMGAMSSKYNDTPTKASRAFDESRDGFVISGGAGILVLE 244

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AK RGA IY E+TGYG+T DG DMV+PSGEG +R M+QAL++V    DY+N H TA
Sbjct: 245 EYEHAKKRGATIYGEITGYGATSDGHDMVAPSGEGGLRAMQQALATVNAKPDYLNPHATA 304

Query: 301 TPKGDKKEVEAIREVFKGNI---PYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           TP GD  E+E++R++F  N    P I  TKS+TGH++GAAG  EAIY LIMM+E F+  S
Sbjct: 305 TPVGDMVELESVRKLFGNNAEDQPMISGTKSMTGHAMGAAGVNEAIYSLIMMKENFVAPS 364

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            NIE +DP   G+ I+R+  D A +  V+SNSFGFGGTN +++F +
Sbjct: 365 INIENLDPAAIGMNIIREARD-AALKMVMSNSFGFGGTNGSVIFSK 409


>gi|262276342|ref|ZP_06054151.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Grimontia hollisae
           CIP 101886]
 gi|262220150|gb|EEY71466.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Grimontia hollisae
           CIP 101886]
          Length = 403

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 304/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TGMGIVSSIGNNV EV  SL+  +SGI+FS+ FA    R  VWG   LN A+ I
Sbjct: 1   MKRAVITGMGIVSSIGNNVKEVLESLKTGKSGISFSQQFADMKLRSNVWGDLKLNPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M++AI D+ L    ++++RTGL+AGSGG S+   V+A D  R
Sbjct: 61  DRKKFRFMGDAAGFAYLSMEQAIEDAGLTEDMVSNDRTGLVAGSGGASSINQVAAVDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +Y++SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYTMSSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+++ +FDAMGA+S+ +N +P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSLTMMFDAMGALSTKYNDNPEKASRTYDADRDGFVISGGGGMMVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V+  VDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQHVDS-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF  N P I +TK++TGH+LGAAG  EAIY  IM+   F+  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGNNSPAISATKAMTGHALGAAGVHEAIYSTIMLDNNFVAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +DP  +G+ IV +  +  ++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDPAAEGLDIVTETRET-ELKTVMSNSFGFGGTNATLVIKKYEG 403


>gi|254525226|ref|ZP_05137281.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Stenotrophomonas sp.
           SKA14]
 gi|219722817|gb|EED41342.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Stenotrophomonas sp.
           SKA14]
          Length = 402

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/403 (57%), Positives = 302/403 (74%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE RSGIT   D A+ G R QV G+  L+   LI
Sbjct: 1   MRRVVITGMGITSCLGNDLDTVSAALREGRSGITTLADHAEAGLRSQVGGRVDLDLDALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M++AI D+ L P ++++ RTGLIAGSGG S++  + A DL R
Sbjct: 61  DRKQKRFMSDAAAFAYLSMRDAIADAGLSPEQVSNLRTGLIAGSGGGSSEWQIGAVDLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    R++GP+ VP+ M ST SA L+T ++I+G SYS+S+ACATSAHCIG AA++I+ G 
Sbjct: 121 ER-GVRKVGPYMVPRTMCSTVSACLATAYQIKGVSYSLSAACATSAHCIGAAADMIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG EDL W+MS +FDAMGA+S+ FN  P SASRPYD  RDGFVI+GG  ++VLE
Sbjct: 180 QDIMFAGGGEDLHWSMSVMFDAMGALSTSFNETPASASRPYDKDRDGFVIAGGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA I+AEL GYG T DG DMV+PSGEGA+RCM+ AL  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAVARGAHIHAELIGYGVTSDGADMVAPSGEGAVRCMKMALQGIDRPLDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIREVF   +P + STK+L+GHSLGAA   EAIYCL+MM++ F+  S NI
Sbjct: 300 TPLGDVTELNAIREVFGDAVPPLSSTKALSGHSLGAASVHEAIYCLLMMRDGFVAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+DP+ +  PI+R+  +  ++DTV+SNSFGFGGTNA LVF R
Sbjct: 360 AELDPKVESFPILRESREQ-RLDTVMSNSFGFGGTNAALVFGR 401


>gi|153834420|ref|ZP_01987087.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio harveyi HY01]
 gi|269961673|ref|ZP_06176035.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio harveyi 1DA3]
 gi|148869191|gb|EDL68219.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio harveyi HY01]
 gi|269833714|gb|EEZ87811.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio harveyi 1DA3]
          Length = 403

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 300/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKENGLRSQVWGDLKINPAEFI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLSEEQVSNDRTGIVAGSGGASALNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V + +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDV-DAIDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSVNI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D   +G+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 359 SNLDEAAQGLDIVTEARD-AELTTVMSNSFGFGGTNATLVIKKYQ 402


>gi|157374783|ref|YP_001473383.1| beta-ketoacyl synthase [Shewanella sediminis HAW-EB3]
 gi|157317157|gb|ABV36255.1| beta-ketoacyl synthase [Shewanella sediminis HAW-EB3]
          Length = 403

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 238/405 (58%), Positives = 309/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S+ F +   R  VWG   L+  E I
Sbjct: 1   MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSDQFEEMKLRSHVWGDIKLDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM EAI D+ L   + +  R G+IAG+GG S+   V AAD  R
Sbjct: 61  DRKALRFMGNAAAYAYIAMAEAIEDAGLTEEQYSDPRVGIIAGTGGASSANQVQAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST+SA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMSSTSSACLATPFKIKGMNYSISSACATSAHCIGHAAELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEIIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+RE F  N+P I STKSLTGH+LGAAGA EAIY LIMM++ FI  S NI
Sbjct: 300 TPVGDMRELEALRETFGENLPAIASTKSLTGHALGAAGAHEAIYSLIMMEDSFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+P+V +  + A+++TV+SNSFGFGGTNATLV R+YK
Sbjct: 360 DNLDEKAAGMPVVTEYRE-AELNTVMSNSFGFGGTNATLVMRKYK 403


>gi|254475922|ref|ZP_05089308.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Ruegeria sp. R11]
 gi|214030165|gb|EEB71000.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Ruegeria sp. R11]
          Length = 409

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 299/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  S + A+ GFR Q+ G   L+ +E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLASLKAGKSGIEASPEMAEHGFRSQIAGTLKLDVSEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI DS L   +I +ERTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGAGAAYAHIAMSQAIADSGLSEDQIVNERTGLVAGSGGPSTSAMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           ++E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL S+ E   VDYIN HG
Sbjct: 241 DLEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALQSLPEGRKVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA R VF  GN+P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAARRVFGAGNVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +    +   +    ++NA +D+V++NSFGFGGTN ++V  +YKG
Sbjct: 361 INVETLADGIEPSEVATSLVENAGLDSVMTNSFGFGGTNGSMVLSKYKG 409


>gi|260776458|ref|ZP_05885353.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607681|gb|EEX33946.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASI [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 403

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 302/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N +E I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEQGLRSQVWGDLKINPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLTEEQVSNDRTGIVAGSGGASALNQALAVDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHC+G+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCVGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPDKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V + +DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDV-DAIDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSVNV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 ENLDEAAQGLDIVTETRD-AELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|260899987|ref|ZP_05908382.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus AQ4037]
 gi|308107392|gb|EFO44932.1| beta-ketoacyl-acyl-carrier-protein synthase I [Vibrio
           parahaemolyticus AQ4037]
          Length = 409

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/402 (58%), Positives = 300/402 (74%), Gaps = 3/402 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D+ R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLTEEQVSNDRTGIVAGSGGASALNQTVATDIMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDVDS-IDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFR 402
           E +D   KG+ IV +  D A++ TV+SNSFGFGGTNATLV R
Sbjct: 359 ENLDEAAKGLDIVIEARD-AELTTVMSNSFGFGGTNATLVIR 399


>gi|308050325|ref|YP_003913891.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Ferrimonas balearica
           DSM 9799]
 gi|307632515|gb|ADN76817.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Ferrimonas balearica
           DSM 9799]
          Length = 407

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/407 (55%), Positives = 304/407 (74%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+G++SSIGNN  EV  +L+  +SG+++SE F + G R +VWG   +N AE I
Sbjct: 1   MKRAVITGIGVISSIGNNAEEVTAALKAGKSGLSYSEQFEEMGLRSRVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +L+M++AI DS L   ++++ERTG+I G+GG S+   V AAD  R
Sbjct: 61  DRKVLRFMGDAAAYAYLSMEQAIADSGLGEDQVSNERTGIIVGTGGASSLNQVEAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RRIGP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 SK-GVRRIGPYLVPRIMSSTASACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L WT++  FD MGA+S+ +N DP  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGSEELHWTLAMGFDGMGALSTKYNDDPTKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE----PVDYINT 296
           E+E A ARGAKIYAE+ GYG+  DG DMV+PSGEGA+RCM+QAL+   E    PV+Y+NT
Sbjct: 240 ELEHALARGAKIYAEIVGYGANSDGYDMVAPSGEGAVRCMKQALTQAAEAGAGPVEYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD +E+ AIRE F  N P I +TK++TGH+LGAAG  EAIY L+M++  F+  
Sbjct: 300 HGTSTPVGDTRELGAIRETFGDNTPMISATKAMTGHALGAAGVHEAIYSLLMLEHGFVAP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S N++ +DP+ +G+ IV +  + A + TV+SNSFGFGGTNA+L+FR+
Sbjct: 360 SINVDNLDPDAEGMSIVTECQEKA-LSTVMSNSFGFGGTNASLIFRK 405


>gi|84394396|ref|ZP_00993114.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio splendidus
           12B01]
 gi|84374965|gb|EAP91894.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio splendidus
           12B01]
          Length = 404

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 305/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+E +SGIT SE F + G R QVWG   +N A+ I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKEGKSGITASEQFKENGLRSQVWGNLKMNPADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI DS L   +++++RTG++AGSGG S+   V+A D+ R
Sbjct: 61  DRKKMRFMGDAAAFAYLSMEQAIADSGLTEDQVSNDRTGIVAGSGGASSLNQVNAVDIIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDW+++ +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELDWSLTMMFDAMGALSTKYNDTPELASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V + VDY+NTHGT+
Sbjct: 240 ELEHAVARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQNV-DGVDYVNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S N+
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D    G+ IV +  +  ++ TV+SNSFGFGGTNATLV +  K
Sbjct: 359 ANLDEAGAGLDIVTEAREQ-ELTTVMSNSFGFGGTNATLVIKNTK 402


>gi|114571598|ref|YP_758278.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Maricaulis maris
           MCS10]
 gi|114342060|gb|ABI67340.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Maricaulis maris
           MCS10]
          Length = 404

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/405 (58%), Positives = 305/405 (75%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+G++S IGNN +EV  SL+  +SGI   E FA+ GFRCQV GKP ++ A  +
Sbjct: 1   MRRVVITGLGVISPIGNNAAEVTESLKNGKSGIGRMESFAELGFRCQVGGKPDIDPAAHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++  RF+S+G  W ++AM++AI D+ L+  +I++ RTG+I GSGGPS   IV+AAD+TR
Sbjct: 61  DKRVYRFMSEGAGWNYMAMEQAIADAGLEENDISNHRTGIIMGSGGPSAGTIVNAADITR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGPFAVPKAMSSTASATL+T FKI G +YSI+SAC TS HCIG A E IQ GK
Sbjct: 121 EK-GPKRIGPFAVPKAMSSTASATLATPFKILGVNYSITSACTTSLHCIGAATEQIQWGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E++ W +SNLFDAMGAMS+ +N  P  ASR +D  RDGFV   GA V+VLE
Sbjct: 180 QDVMFAGGCEEIHWALSNLFDAMGAMSTKYNDTPEQASRAFDKDRDGFVGGAGAGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E ERAKARGA I AE+TGYG+T DG DMV+PSGEGA+R M+ A+ +V +P+DY+N H TA
Sbjct: 240 EYERAKARGANILAEVTGYGATSDGYDMVAPSGEGAVRAMKLAMETVNKPIDYLNPHATA 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EA++EVF  + P I  TKS+TGHSLGAAG  EAIY L+MM+E F+  S N+
Sbjct: 300 TPVGDIKEMEAVKEVFGDSAPMISGTKSMTGHSLGAAGVHEAIYTLLMMKEGFVAPSINV 359

Query: 361 EEIDPEFKG--IPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            ++DP+     +PI+ +  D A + T +SNSFGFGGTN T+VF +
Sbjct: 360 FDMDPDIAALNLPIITETRD-ADLKTAMSNSFGFGGTNGTVVFEK 403


>gi|269968541|ref|ZP_06182546.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio alginolyticus
           40B]
 gi|269826851|gb|EEZ81180.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Vibrio alginolyticus
           40B]
          Length = 403

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 303/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMEQAIADAGLTEEQVSNDRTGIVAGSGGASAYNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNDTPDKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+ +V + VDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQNV-DGVDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+++F  N P I +TK++TGH+LGAAG  EAIY  +M+ + FI  S NI
Sbjct: 299 TPVGDVKELGAIQQLFGENSPAISATKAMTGHALGAAGVHEAIYSTLMLDKNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +D   +G+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 SNLDEAAQGLDIVTEARD-AELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|190572633|ref|YP_001970478.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I
           [Stenotrophomonas maltophilia K279a]
 gi|190010555|emb|CAQ44164.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I
           [Stenotrophomonas maltophilia K279a]
          Length = 402

 Score =  478 bits (1229), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/403 (57%), Positives = 300/403 (74%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE RSGIT   D A+ G R QV G+  L+   LI
Sbjct: 1   MRRVVITGMGITSCLGNDLDTVSAALREGRSGITALADHAEAGLRSQVGGRVDLDLEALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +LAM++AI D+ L   +++  RTGLIAGSGG S++  + A DL R
Sbjct: 61  DRKQKRFMSDAAAFAYLAMRDAIADAGLSAEQVSSLRTGLIAGSGGGSSEWQIGAVDLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    R++GP+ VP+ M ST SA L+T ++I+G SYS+S+ACATSAHCIG AA++I+ G 
Sbjct: 121 ER-GVRKVGPYMVPRTMCSTVSACLATAYQIKGVSYSLSAACATSAHCIGAAADMIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG EDL W+MS +FDAMGA+S+ FN  P SASRPYD  RDGFVI+GG  ++VLE
Sbjct: 180 QDIMFAGGGEDLHWSMSVMFDAMGALSTSFNETPASASRPYDKDRDGFVIAGGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA I+AEL GYG T DG DMV+PSGEGA+RCM+ AL  V+ P+DY+NTHGT+
Sbjct: 240 DYDHAVARGAHIHAELIGYGVTSDGADMVAPSGEGAVRCMKMALQGVDRPLDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIREVF   +P + STK+L+GHSLGAA   EAIYCL+MM++ F+  S NI
Sbjct: 300 TPLGDVTELNAIREVFGDAVPPLSSTKALSGHSLGAASVHEAIYCLLMMRDGFVAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+DP+ +  PI+R+  +  K+DTV+SNSFGFGGTNA LVF R
Sbjct: 360 GELDPKVESFPILRESREQ-KLDTVMSNSFGFGGTNAALVFGR 401


>gi|254785118|ref|YP_003072546.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Teredinibacter
           turnerae T7901]
 gi|237685280|gb|ACR12544.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Teredinibacter
           turnerae T7901]
          Length = 404

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 298/406 (73%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTGMGIVS IGN++  V  SL+  +SGI+ +E + + GFR  V G   L+ +E I
Sbjct: 1   MKRVVVTGMGIVSCIGNDLDTVLSSLKTGKSGISSNESYKEHGFRSLVSGSVNLDLSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQ+AI  + L    +++ERTG+I GSGG STK +V +AD+ R
Sbjct: 61  DRKVLRFMGDAAGYAYVAMQQAIAHAGLTEEMVSNERTGIIMGSGGASTKSVVDSADIMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R GP+ V + M ST SA L+T FKI+G +YS+SSACATSAHCIGNA ELIQ GK
Sbjct: 121 ER-GVKRAGPYRVTQTMGSTTSACLATPFKIKGVNYSLSSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  WT++ LFDAMGA+S+ +N  P +ASRPYD+ RDGFVI+GG   +V+E
Sbjct: 180 QDIVFAGGGEEEHWTLTGLFDAMGALSTKYNDTPETASRPYDATRDGFVIAGGGGCMVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            ++ A ARGA IY EL GYG+T DG DMV+PSGEGA RCMRQA+++VE  +DYIN+HGT+
Sbjct: 240 SLDHALARGATIYGELVGYGATSDGYDMVAPSGEGASRCMRQAMANVEGSIDYINSHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N P I STKSLTGHSLGA G QEAIY  +MMQ  FI  S NI
Sbjct: 300 TPVGDLAELRAVREVFGSNTPAISSTKSLTGHSLGATGVQEAIYTALMMQHGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            EIDPE   + IV+  ID A+I   +SNSFGFGGTNATL+F +Y G
Sbjct: 360 AEIDPEAADLNIVKNAID-AEIGLAMSNSFGFGGTNATLIFSKYNG 404


>gi|306842719|ref|ZP_07475362.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella sp. BO2]
 gi|306287165|gb|EFM58667.1| 3-oxoacyl-(acyl carrier protein) synthase I [Brucella sp. BO2]
          Length = 343

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/344 (67%), Positives = 276/344 (80%), Gaps = 3/344 (0%)

Query: 65  MRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCS 124
           MRF  +G  W H+AM +AI D+ L   E+++ RTG+I GSGGPST+ IV +AD+TRE   
Sbjct: 1   MRFHGRGTAWNHIAMDQAIADAGLTEEEVSNARTGIIMGSGGPSTRTIVDSADITREK-G 59

Query: 125 TRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIM 184
            +R+GPFAVPKAMSSTASATL+T+FKI+G +YSISSACATS HCIGNA E+IQ GKQD M
Sbjct: 60  PKRVGPFAVPKAMSSTASATLATFFKIKGINYSISSACATSNHCIGNAYEMIQYGKQDRM 119

Query: 185 FAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMER 244
           FAGG EDLDWT+S LFDAMGAMSS +N  P +ASR YD  RDGFVI+GGA V+VLE++E 
Sbjct: 120 FAGGCEDLDWTLSVLFDAMGAMSSKYNDTPSTASRAYDKNRDGFVIAGGAGVLVLEDLET 179

Query: 245 AKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKG 304
           A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ ALS+V   +DYIN H T+TP G
Sbjct: 180 ALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMALSTVTSKIDYINPHATSTPAG 239

Query: 305 DKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEE 362
           D  E+EAIR++F      P I +TKSLTGHSLGA G QEAIY L+MMQ  FI ES +IEE
Sbjct: 240 DAPEIEAIRQIFGAGDACPPIAATKSLTGHSLGATGVQEAIYSLLMMQNNFICESAHIEE 299

Query: 363 IDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +DP F  +PIVRKRIDN +++TVLSNSFGFGGTNATLVF+RY+G
Sbjct: 300 LDPAFADMPIVRKRIDNVQLNTVLSNSFGFGGTNATLVFQRYQG 343


>gi|312884890|ref|ZP_07744580.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309367367|gb|EFP94929.1| 3-oxoacyl-(acyl carrier protein) synthase II [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 403

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 300/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N +ELI
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEQGLRSQVWGDLKINPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+MQ+AI D+ L    ++ +RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMQQAIEDAGLPEDLVSSDRTGIVAGSGGASALNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPDQASRTYDADRDGFVISGGGGMLVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  VE  VDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQDVES-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D   +G+ IV +  D A+++TV+SNSFGFGGTNATLV ++++
Sbjct: 359 ANLDEAAQGLDIVSEARD-AQLNTVMSNSFGFGGTNATLVIKKFE 402


>gi|163750177|ref|ZP_02157419.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella benthica
           KT99]
 gi|161330033|gb|EDQ01017.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella benthica
           KT99]
          Length = 403

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/405 (59%), Positives = 307/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S  F +   R +VWG+  L+  E I
Sbjct: 1   MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMKLRSRVWGEITLDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+ +   + ++AM EAI D+ L   + +  R G+IAG+GG S+   V AAD+ R
Sbjct: 61  DRKALRFMGKAAAYAYVAMAEAIKDAGLTEEQYSDPRVGIIAGTGGASSANQVQAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 121 EK-GIRRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAAELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEIIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+RE F  N+P   STKSLTGH+LGAAGA EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDMRELEALRETFGDNLPPFASTKSLTGHALGAAGAHEAIYSLIMMEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+P+V +    A + TV+SNSFGFGGTNATLV R+YK
Sbjct: 360 DNLDEKAAGMPVVTE-YREADLTTVMSNSFGFGGTNATLVMRKYK 403


>gi|91223600|ref|ZP_01258865.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio alginolyticus
           12G01]
 gi|91191686|gb|EAS77950.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio alginolyticus
           12G01]
          Length = 403

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 302/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M++AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSMEQAIADAGLTEEQVSNDRTGIVAGSGGASAYNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNDTPDKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V + VDYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQDV-DGVDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+++F  N P I +TK++TGH+LGAAG  EAIY  +M+ + FI  S NI
Sbjct: 299 TPVGDVKELGAIQQLFGENSPAISATKAMTGHALGAAGVHEAIYSTLMLDKNFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +D   +G+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+G
Sbjct: 359 SNLDEAAQGLDIVTEARD-AELTTVMSNSFGFGGTNATLVIKKYQG 403


>gi|15596806|ref|NP_250300.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas aeruginosa
           PAO1]
 gi|9947575|gb|AAG04998.1|AE004589_1 beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa PAO1]
          Length = 405

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L P +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A  RGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 GLEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+R+  +NAK+DTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRETRENAKLDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|194364231|ref|YP_002026841.1| beta-ketoacyl synthase [Stenotrophomonas maltophilia R551-3]
 gi|194347035|gb|ACF50158.1| Beta-ketoacyl synthase [Stenotrophomonas maltophilia R551-3]
          Length = 402

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/403 (57%), Positives = 300/403 (74%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE RSGIT   D A  G R QV G+  L+   LI
Sbjct: 1   MRRVVITGMGITSCLGNDLDTVSNALREGRSGITALSDHADAGLRSQVGGRVDLDLDALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M++AI D+ L P ++++ RTGLIAGSGG S++  + A DL R
Sbjct: 61  DRKQKRFMSDAAAFAYLSMRDAIADAGLSPEQVSNLRTGLIAGSGGGSSEWQIGAVDLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    R++GP+ VP+ M ST SA L+T ++I+G SYS+S+ACATSAHCIG AA++I+ G 
Sbjct: 121 ER-GVRKVGPYMVPRTMCSTVSACLATAYQIKGVSYSLSAACATSAHCIGAAADMIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG EDL W+MS +FDAMGA+S+ FN  P SASRPYD  RDGFVI+GG  ++VLE
Sbjct: 180 QDIMFAGGGEDLHWSMSVMFDAMGALSTSFNETPASASRPYDKDRDGFVIAGGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA I+AEL GYG T DG DMV+PSGEGA+RCM+ AL  V+ P+DY+NTHGT+
Sbjct: 240 DYDHAVARGAHIHAELIGYGVTSDGADMVAPSGEGAVRCMKMALQGVDRPLDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIREVF   +P + STK+L+GHSLGAA   EAIYCL+MM++ F+  S NI
Sbjct: 300 TPLGDVTELNAIREVFGDAVPPLSSTKALSGHSLGAASVHEAIYCLLMMRDGFVAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+DP+ +  PI+R+  +   +DTV+SNSFGFGGTNA LVF R
Sbjct: 360 GELDPKVESFPILRESREQ-TLDTVMSNSFGFGGTNAALVFGR 401


>gi|256823306|ref|YP_003147269.1| Beta-ketoacyl synthase [Kangiella koreensis DSM 16069]
 gi|256796845|gb|ACV27501.1| Beta-ketoacyl synthase [Kangiella koreensis DSM 16069]
          Length = 405

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 304/405 (75%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVS +GNNV EVA SL++ +SGI F + + + G R  V GKP ++  + I
Sbjct: 1   MKRVVITGMGIVSCLGNNVEEVAESLKQGKSGIKFKDIYKEKGLRSHVAGKPDMDIKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +++MQ+AI D+ L   ++++ RTGLI GSGG S    V + D+  
Sbjct: 61  DRKIVRFMGDAAGYAYISMQQAIEDAGLSDEQVSNIRTGLITGSGGGSQGTQVESVDIAL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+AVPK M ST SA L+T FKI+G +YSI+SACATSAHCIGNA E I  GK
Sbjct: 121 ER-GVKRVGPYAVPKTMGSTTSACLATPFKIKGINYSITSACATSAHCIGNAYEQIAMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+ DW ++ LFDAMGA+SS +N  P +ASRPYD+ RDGFVIS G  ++V+E
Sbjct: 180 QDIVFAGGGEEEDWRLTLLFDAMGALSSKYNDTPETASRPYDATRDGFVISSGGGILVME 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGAKIYAEL GYG+T DG DMV+PSGEGA+RCM+QAL++V+  +DY+NTHGT+
Sbjct: 240 EYEHAKARGAKIYAELVGYGATSDGYDMVAPSGEGAVRCMQQALATVKGDIDYVNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++AI+EVF   +P I STKSL GHSLGA G  EAIY LIMM+++F+  S NI
Sbjct: 300 TPVGDTAELKAIKEVFGDKLPKISSTKSLAGHSLGATGVHEAIYSLIMMRDKFLAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            ++D + +G+PIV+KR D   I  VLSNSFGFGGTNA LVF +Y+
Sbjct: 360 TQLDEDAEGMPIVQKREDGVDIKRVLSNSFGFGGTNACLVFEKYE 404


>gi|294141661|ref|YP_003557639.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella violacea
           DSS12]
 gi|293328130|dbj|BAJ02861.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Shewanella violacea
           DSS12]
          Length = 403

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 237/405 (58%), Positives = 310/405 (76%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S  F +   R +VWG+  L+  E I
Sbjct: 1   MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSAQFEEMKLRSRVWGEITLDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+ +   + ++AM EAI D+ L   + +  R G+IAG+GG S+   V AAD+ R
Sbjct: 61  DRKALRFMGKAAAYAYVAMAEAIKDAGLTEEQYSDPRVGIIAGTGGASSANQVQAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+AAELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAAELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N +P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDEPQKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEIVGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+RE F  ++P I STKSLTGH+LGAAGA EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDMRELEALRETFGDSLPPIASTKSLTGHALGAAGAHEAIYSLIMMEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+P+V +    A++ TV+SNSFGFGGTNATLV ++YK
Sbjct: 360 DNLDEKAAGMPVVTE-YREAELTTVMSNSFGFGGTNATLVMKKYK 403


>gi|156975374|ref|YP_001446281.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Vibrio harveyi ATCC
           BAA-1116]
 gi|156526968|gb|ABU72054.1| hypothetical protein VIBHAR_03105 [Vibrio harveyi ATCC BAA-1116]
          Length = 403

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 300/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGIVSSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N AE I
Sbjct: 1   MKRVVITGMGIVSSIGNNVEEVLASLKAGKSGITASEQFKENGLRSQVWGDLKINPAEFI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + +L+MQ+AI D+ L   +++++RTG++AGSGG S      A D  R
Sbjct: 61  DRKQVRFMGDAAAYAYLSMQQAIEDAGLSEEQVSNDRTGIVAGSGGASALNQTVATDTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ VP+ MSST SA L+T FKIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSMSSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDW+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELDWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGA+RCM+ A+  V + +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAVRCMKMAMQDV-DAIDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+E+F  N P I +TK++TGH+LGAAG  EAIY  +M+   FI  S NI
Sbjct: 299 TPVGDVKELGAIQELFGDNSPAISATKAMTGHALGAAGVHEAIYSTLMLDNNFIAPSVNI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             +D   +G+ IV +  D A++ TV+SNSFGFGGTNATLV ++Y+
Sbjct: 359 SNLDEAAQGLDIVTEARD-AELTTVMSNSFGFGGTNATLVIKKYQ 402


>gi|52425646|ref|YP_088783.1| 3-oxoacyl-(acyl carrier protein) synthase I [Mannheimia
           succiniciproducens MBEL55E]
 gi|52307698|gb|AAU38198.1| FabB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 406

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/404 (57%), Positives = 294/404 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG G++SSIGNN  EV  SL+  +SGI     F + G R  V G   LN AELI
Sbjct: 1   MKRAVITGFGVISSIGNNKEEVLASLKAGKSGIEIVPSFVEMGMRSHVAGTVKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   ++++ERTGL+ G+G  S    V AAD  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDAGLSEDQVSNERTGLVIGAGIGSAHYQVKAADAAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K MSS+ SA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 GSRGVKAIGPYAVTKTMSSSVSACLATPFKIKGVNYSISSACATSAHCIGNAFELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWEGAAQFDAMGAVSTKYNETPEKASRAYDADRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++++ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMANIDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIR VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIRNVFGEAKPAISSTKSMTGHSLGAAGAHEAIYTLLMLHNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +D + +G+ IV +  +NA + TV+SNSFGFGGTNATLVF+RY
Sbjct: 361 ETLDEQAEGLNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRY 404


>gi|332305348|ref|YP_004433199.1| Beta-ketoacyl synthase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172677|gb|AEE21931.1| Beta-ketoacyl synthase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 436

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 241/406 (59%), Positives = 311/406 (76%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIGNN +EV  SLRE RSGIT+SE+FA+ G R  VWGK  L+ +E I
Sbjct: 33  MRRAVITGLGIVSSIGNNKTEVTKSLREGRSGITYSEEFAENGMRSHVWGKVNLDLSEHI 92

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQ+A+ DS L P  +++ RTG+IAGSGG S++  V A D+ R
Sbjct: 93  DRKTLRFMGDAAGYAYIAMQQAVEDSGLTPEMVSNVRTGIIAGSGGASSQHQVGAVDILR 152

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ V + M ST SA L+T FKI+G +YSISSAC+TSAHCIGNA E IQ GK
Sbjct: 153 EK-GLRRVGPYMVTRCMGSTVSACLATPFKIKGVNYSISSACSTSAHCIGNALEQIQLGK 211

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT+S  FDAMGA+S+ +N +P +ASR YD+ RDGFV +GG  ++V+E
Sbjct: 212 QDIIFAGGGEELHWTLSMEFDAMGALSTKYNDNPSTASRTYDANRDGFVGAGGGGMVVVE 271

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+QA++ V+EP+DYINTHGT+
Sbjct: 272 ELEHALARGAKIYGEIVGYGATSDGADMVAPSGEGAIRCMQQAMNGVDEPIDYINTHGTS 331

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI EVF   +P + +TK++TGH+LGAAG  EAIY L+MM+  FI  S NI
Sbjct: 332 TPVGDVKELWAIGEVFGDKVPPLSATKAMTGHALGAAGVNEAIYSLLMMENDFIAPSINI 391

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G+ +V +  D AK++TV+SNSFGFGGTN TLV +RYKG
Sbjct: 392 ETLDEAAQGMDVVTETRD-AKLNTVMSNSFGFGGTNCTLVMQRYKG 436


>gi|206577113|ref|YP_002237279.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Klebsiella pneumoniae
           342]
 gi|288934215|ref|YP_003438274.1| beta-ketoacyl synthase [Klebsiella variicola At-22]
 gi|290508418|ref|ZP_06547789.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Klebsiella sp. 1_1_55]
 gi|206566171|gb|ACI07947.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Klebsiella pneumoniae
           342]
 gi|288888944|gb|ADC57262.1| Beta-ketoacyl synthase [Klebsiella variicola At-22]
 gi|289777812|gb|EFD85809.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Klebsiella sp. 1_1_55]
          Length = 406

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 296/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++A+ D+ L P    ++ R GLIAGSGG S K  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEAYQSNPRVGLIAGSGGGSPKFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDANRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +EE+D +  G+ IV K  D AK+ TV+SNSFGFGGTNATLV R+Y 
Sbjct: 361 VEELDEQAAGLNIVTKPTD-AKLTTVMSNSFGFGGTNATLVMRKYN 405


>gi|303250195|ref|ZP_07336397.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303250724|ref|ZP_07336920.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251005|ref|ZP_07337192.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251012|ref|ZP_07337198.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251411|ref|ZP_07337588.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307252694|ref|ZP_07534586.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302649765|gb|EFL79944.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650022|gb|EFL80192.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650136|gb|EFL80305.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302650394|gb|EFL80554.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651258|gb|EFL81412.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859870|gb|EFM91891.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 406

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKKPAISSTKSMTGHSLGAAGAHEAIYSLLMLENGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQAEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|109899688|ref|YP_662943.1| beta-ketoacyl synthase [Pseudoalteromonas atlantica T6c]
 gi|109701969|gb|ABG41889.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas
           atlantica T6c]
          Length = 404

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 240/406 (59%), Positives = 308/406 (75%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIGNN +EV  SLRE RSGIT+SE FA+ G R  VWGK  +N A+ I
Sbjct: 1   MRRAVITGLGIVSSIGNNKTEVTKSLREGRSGITYSEQFAENGMRSHVWGKVDINLADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQ+A+ DS L P  +++ RTG+IAGSGG S++  V A D+ R
Sbjct: 61  DRKTLRFMGDAAGYAYIAMQQAVEDSGLTPEMVSNVRTGIIAGSGGASSQHQVEAVDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ V + M ST SA L+T FKI+G +YSISSAC+TSAHCIGNA E IQ GK
Sbjct: 121 EK-GLRRVGPYMVTRCMGSTVSACLATPFKIKGVNYSISSACSTSAHCIGNALEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L WT+S  FDAMGA+S+ +N +P  ASR YD+ RDGFV +GG  ++V+E
Sbjct: 180 QDIIFAGGGEELHWTLSMEFDAMGALSTKYNDEPSKASRTYDANRDGFVGAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+QA++ ++EP+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGADMVAPSGEGAIRCMQQAMNGIDEPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI EVF   +P + +TK++TGH+LGAAG  EAIY L+MM+  FI  S NI
Sbjct: 300 TPVGDVKELWAIGEVFGDKVPPLSATKAMTGHALGAAGVNEAIYSLLMMENDFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D    G+ +V +  D AK++TV+SNSFGFGGTN TLV +RYKG
Sbjct: 360 ETLDEAANGMDVVTQTRD-AKLNTVMSNSFGFGGTNCTLVMQRYKG 404


>gi|260912968|ref|ZP_05919453.1| beta-ketoacyl-acyl-carrier-protein synthase II [Pasteurella
           dagmatis ATCC 43325]
 gi|260632958|gb|EEX51124.1| beta-ketoacyl-acyl-carrier-protein synthase II [Pasteurella
           dagmatis ATCC 43325]
          Length = 406

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 297/406 (73%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG GI+SSIGNN  EV  SL+  +SGI    DF + G R  V G   LN +ELI
Sbjct: 1   MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPDFVEMGMRSHVAGTIKLNPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDAGLTDDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHALELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQA+++++ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQAMATIDAPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   +P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKVPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +DP+ +G  IV + ++NA ++TV+SNSFGFGGTNA L+F++Y G
Sbjct: 361 ETLDPQAEGCNIVTELVENAGLNTVMSNSFGFGGTNAALIFKKYNG 406


>gi|152971251|ref|YP_001336360.1| 3-oxoacyl-(acyl carrier protein) synthase I [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238895844|ref|YP_002920580.1| 3-oxoacyl-(acyl carrier protein) synthase I [Klebsiella pneumoniae
           NTUH-K2044]
 gi|329997363|ref|ZP_08302746.1| beta-ketoacyl-acyl-carrier-protein synthase I [Klebsiella sp. MS
           92-3]
 gi|150956100|gb|ABR78130.1| 3-oxoacyl-(acyl carrier protein) synthase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238548162|dbj|BAH64513.1| 3-oxoacyl-(acyl carrier protein) synthase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|328539112|gb|EGF65148.1| beta-ketoacyl-acyl-carrier-protein synthase I [Klebsiella sp. MS
           92-3]
          Length = 406

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 295/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++A+ D+ L P     + R GLIAGSGG S K  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEAYQNNPRVGLIAGSGGGSPKFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDANRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +EE+D +  G+ IV K  D AK+ TV+SNSFGFGGTNATLV R+Y 
Sbjct: 361 VEELDEQAAGLNIVTKPTD-AKLTTVMSNSFGFGGTNATLVMRKYN 405


>gi|238920615|ref|YP_002934130.1| hypothetical protein NT01EI_2727 [Edwardsiella ictaluri 93-146]
 gi|238870184|gb|ACR69895.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 403

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 298/405 (73%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+ +  + G R QVWG   L+ A LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLKEGRSGITFAPELQEAGMRSQVWGNIKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    + +L+MQEAI DS L    +++ RTGLI GSGG S +  V+ AD  R
Sbjct: 61  DRKVMRFMSDASIYAYLSMQEAIKDSGLSDDMVSNNRTGLIVGSGGGSPRNQVAGADGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIGNA E+IQ GK
Sbjct: 121 AR-GIRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGNAVEMIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++ W ++  FDAMGA+S+H+N  P  ASR YD++RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEEMCWELACEFDAMGALSTHYNDAPEKASRTYDAKRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCM+ A+  +++PVDY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMQMAMQGLDKPVDYLNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD KE+ AIREVF    P I STK++TGH+LGAAG  EAIY L+M++  FI  S NI
Sbjct: 300 TMVGDVKELGAIREVFGDRTPAISSTKAMTGHALGAAGVHEAIYTLLMLEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+D +  G+ IV    +  ++D V+SNSFGFGGTNATLV R+YK
Sbjct: 360 EELDEQATGMDIVTATTER-ELDVVMSNSFGFGGTNATLVMRKYK 403


>gi|190150381|ref|YP_001968906.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307261539|ref|ZP_07543208.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263726|ref|ZP_07545333.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915512|gb|ACE61764.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306868822|gb|EFN00630.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870937|gb|EFN02674.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 405

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKKPAISSTKSMTGHSLGAAGAHEAIYSLLMLENGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQAEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|163747537|ref|ZP_02154887.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Oceanibulbus indolifex
           HEL-45]
 gi|161379215|gb|EDQ03634.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Oceanibulbus indolifex
           HEL-45]
          Length = 409

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 305/409 (74%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  +L++  SGI  S + A+ GFR +V G   +N A+ I
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLAALKDGTSGIEASPEMAEHGFRSRVAGTLKINLADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + ++AM +AI D+ L   +I++ RTGL+AGSGGPST  + +A ++ +
Sbjct: 61  DKRTLRFMGPGAGYAYVAMDQAIKDAGLSEDQISNPRTGLVAGSGGPSTSAMFAAHNIVK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 DTGATKRIGPFAVPKCMSSTVSANLSTAFKIKGINYSITSACSTSLHCIGNAAEQIMLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P +ASR +D+ RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRAFDADRDGFVISGGGGMLVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+TGY +T DG DMV+PSGEG  R MR AL ++ E   V YIN HG
Sbjct: 241 DLDHALARGAKIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALETLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G+ P + STKS+TGH+ GAAGA EAI+ L+M+   FI  S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGQGSTPPVSSTKSMTGHAQGAAGALEAIFSLLMLDNDFIARS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +DP      I  +R+DNA +D+V++NSFGFGGTN +++  +YKG
Sbjct: 361 INVQNLDPALDPSEIALERVDNAGLDSVMTNSFGFGGTNGSMILSKYKG 409


>gi|156933083|ref|YP_001436999.1| 3-oxoacyl-(acyl carrier protein) synthase I [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156531337|gb|ABU76163.1| hypothetical protein ESA_00893 [Cronobacter sakazakii ATCC BAA-894]
          Length = 405

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/407 (57%), Positives = 300/407 (73%), Gaps = 5/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQEFLDAGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF++    + +L+MQEAI D+ L P E+   + R G++AGSGG S+K  V  AD 
Sbjct: 61  DRKVVRFMNDASIYAYLSMQEAIKDAGL-PDEVYQNNPRVGIVAGSGG-SSKAQVFGADA 118

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 119 MRSPRGLKAVGPYVVTKAMASAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQL 178

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 179 GKQDIVFAGGGEELGWEMACEFDAMGALSTKYNETPDKASRTYDASRDGFVIAGGGGMVV 238

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 239 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHG 298

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 299 TSTPVGDVKELGAIREVFGDNTPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 358

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NIEE+D + KG+ I+   ++  ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 359 NIEELDEQAKGMNIITAPVER-ELTTVMSNSFGFGGTNATLVMRKYQ 404


>gi|254234709|ref|ZP_04928032.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa C3719]
 gi|126166640|gb|EAZ52151.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa C3719]
          Length = 404

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/395 (58%), Positives = 293/395 (74%), Gaps = 1/395 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L P +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGT 395
           +E+DPE   +PI+R+  +NAK+DTV+SNSFGFGGT
Sbjct: 360 DELDPEVADLPILRETRENAKLDTVMSNSFGFGGT 394


>gi|307245967|ref|ZP_07528050.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254945|ref|ZP_07536765.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257103|ref|ZP_07538877.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259385|ref|ZP_07541111.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306853186|gb|EFM85408.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862107|gb|EFM94081.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306864413|gb|EFM96322.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306866557|gb|EFM98419.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 405

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKKPAISSTKSMTGHSLGAAGAHEAIYSLLMLENGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQAEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|163739035|ref|ZP_02146448.1| indolepyruvate ferredoxin oxidoreductase [Phaeobacter gallaeciensis
           BS107]
 gi|161387840|gb|EDQ12196.1| indolepyruvate ferredoxin oxidoreductase [Phaeobacter gallaeciensis
           BS107]
          Length = 409

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 300/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  S + A+ GFR Q+ G   LN A+ +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLASLKAGKSGIEASPEMAEHGFRSQIAGTLKLNVADHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ +ERTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGAGAAYAHIAMSQAIADAGLSEEQVVNERTGLVAGSGGPSTSAMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL S+ +   VDYIN HG
Sbjct: 241 DLDHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALQSLPDGRKVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA R VF  GN+P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEIEAARRVFGAGNVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +    +   +  + ++NA +D+V++NSFGFGGTN ++V  +YKG
Sbjct: 361 INVDTLAEGIEPAEVATQLVENAGLDSVMTNSFGFGGTNGSMVLSKYKG 409


>gi|46143558|ref|ZP_00134992.2| COG0304: 3-oxoacyl-(acyl-carrier-protein) synthase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208527|ref|YP_001053752.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae L20]
 gi|165976480|ref|YP_001652073.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|126097319|gb|ABN74147.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876581|gb|ABY69629.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 406

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKSPAISSTKSMTGHSLGAAGAHEAIYSLLMLENGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQAEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|307250306|ref|ZP_07532258.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306857662|gb|EFM89766.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 406

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKSPAISSTKSMTGHSLGAAGAHEAIYSLLMLENGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQTEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|303253688|ref|ZP_07339826.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248100|ref|ZP_07530129.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302647608|gb|EFL77826.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855498|gb|EFM87672.1| 3-oxoacyl-(Acyl-carrier-protein) synthase I [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 405

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKSPAISSTKSMTGHSLGAAGAHEAIYSLLMLENGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQAEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|110681060|ref|YP_684067.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter
           denitrificans OCh 114]
 gi|109457176|gb|ABG33381.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter
           denitrificans OCh 114]
          Length = 409

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/409 (55%), Positives = 303/409 (74%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  +L+   SGIT S + ++ GFR Q+ G   ++  E I
Sbjct: 1   MRRVVVTGLGIVSSIGNNADEVLAALKAGTSGITASPEMSEHGFRSQIAGTLKIDVTEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + ++AM +AI D+ L    I++ RTGL+AGSGGPST  +++A ++ +
Sbjct: 61  DKRALRFMGPGAAYAYIAMGQAIADAGLDENTISNPRTGLVAGSGGPSTSAMLTAHEVVK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T +KI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTVSANLATAYKIKGINYSITSACSTSLHCIGNAAEQIMLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEQASRAFDANRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGA IY E+TGY +T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 DLDHALARGATIYGEVTGYAATSDGHDMVAPSGEGGERAMRLALSTLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF  G  P + STKSLTGH+ GAAGA EAI+ L+M++  F+ +S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGTGTTPPVSSTKSLTGHAQGAAGALEAIFSLLMLKHDFMAKS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      IV +R+DNA +D+V++NSFGFGGTN +++  +Y G
Sbjct: 361 VNVETLDPALTPSEIVLERVDNAGLDSVMTNSFGFGGTNGSMILSKYLG 409


>gi|322831940|ref|YP_004211967.1| Beta-ketoacyl synthase [Rahnella sp. Y9602]
 gi|321167141|gb|ADW72840.1| Beta-ketoacyl synthase [Rahnella sp. Y9602]
          Length = 406

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 298/405 (73%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGNN  EV  SL+E RSGITFS++    G R  VWG   L+ A LI
Sbjct: 1   MKRAVITGLGIISSIGNNKQEVLASLQEGRSGITFSQELKDAGMRSHVWGDVKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+S    + +L+MQ+AI DS L P  +++ERTGLIAGSGG S +  V+ +D  R
Sbjct: 61  DRKIVRFMSDASIYAYLSMQQAIEDSGLTPEMVSNERTGLIAGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIGNA E+IQ GK
Sbjct: 121 AK-GLRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGNAVEMIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELCWEMACEFDAMGALSTSYNETPDKASRTYDKARDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMNGVDTPIDYVNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF    P + STK++TGHSLGAAG QEAIY L+M +  FI  S NI
Sbjct: 300 TPVGDVKELGAIREVFGDKTPALSSTKAMTGHSLGAAGVQEAIYTLLMAEYGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D + +G+ I+ K     ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 360 ENLDEQAEGMDIITKPTQR-ELTTVMSNSFGFGGTNATLVMRKLK 403


>gi|149914124|ref|ZP_01902655.1| beta-ketoacyl synthase [Roseobacter sp. AzwK-3b]
 gi|149811643|gb|EDM71476.1| beta-ketoacyl synthase [Roseobacter sp. AzwK-3b]
          Length = 409

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/409 (56%), Positives = 297/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGN  SEV  +L+   SGI  S +  + GFR QV G   ++  E +
Sbjct: 1   MRRVVVTGLGIVSSIGNTASEVLAALKAGTSGIEASPEMQEHGFRSQVAGTLKIDVTEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   +I + RTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMGQAIADAGLTEADIVNPRTGLVAGSGGPSTSAMLAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +RIGPFAVPK MSST SA LST ++I+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 EKGSPKRIGPFAVPKCMSSTISANLSTAYRIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPQRASRAFDADRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 DLDHALARGAKIYAEVTGYGATSDGADMVAPSGEGGERAMRLALSTLPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EV+++R +F +G+ P I STKS+TGHS GA GAQEAIYCL+ +   FI  S
Sbjct: 301 TSTPVGDVGEVQSVRRIFGEGSTPPISSTKSMTGHSQGATGAQEAIYCLLALDNDFIIPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      I   RIDNA +DTV++NSFGFGGTN +++  ++ G
Sbjct: 361 INVETLDPALHASEIATARIDNAGLDTVMTNSFGFGGTNGSMLLSKFHG 409


>gi|163734556|ref|ZP_02141995.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter litoralis
           Och 149]
 gi|161392049|gb|EDQ16379.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter litoralis
           Och 149]
          Length = 409

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 301/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+   SGIT S + ++ GFR Q+ G   ++  E I
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLTSLKAGTSGITASPEMSEHGFRSQIAGTLKIDVTEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + ++AM +AI D+ L    +++ RTGL+AGSGGPST  +++A ++  
Sbjct: 61  DKRTLRFMGPGAAYAYIAMAQAIADAGLDEDTVSNPRTGLVAGSGGPSTSAMLTAHNVVA 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA LST FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTVSANLSTAFKIKGVNYSITSACSTSLHCIGNAAEQIMLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPELASRAFDANRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E++ A ARGA IYAE+TGY +T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 ELDHALARGATIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALSTLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF  G  P + STKS+TGH+ GAAGA EAI+ L+M++  F+  S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGTGTTPPVSSTKSMTGHAQGAAGALEAIFSLLMLKHDFMTRS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      IV +R+DNA +D+V++NSFGFGGTN +++  +Y G
Sbjct: 361 INVETLDPALTPEEIVLERVDNAGLDSVMTNSFGFGGTNGSMILSKYLG 409


>gi|317048984|ref|YP_004116632.1| beta-ketoacyl synthase [Pantoea sp. At-9b]
 gi|316950601|gb|ADU70076.1| Beta-ketoacyl synthase [Pantoea sp. At-9b]
          Length = 406

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 295/405 (72%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+  + G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEMKEAGMRSHVWGNVKLDTNGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI-THERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M EAI DS L   +  ++ R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKIVRFMSDASIYAYLSMAEAIKDSGLTEEQYQSNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDVVFAGGGEELSWEMACEFDAMGALSTKYNETPEKASRTYDANRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMQGLDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N PYI +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNTPYISATKAMTGHSLGAAGVQEAIYTLLMLEHSFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +EE+D   KG+ IV +  + A + TV+SNSFGFGGTNATL  R+Y
Sbjct: 361 VEELDDAAKGMNIVTQPTEKA-LTTVMSNSFGFGGTNATLTMRKY 404


>gi|260072732|gb|ACX30628.1| 3-oxoacyl-(acyl-carrier-protein) synthase [uncultured bacterium
           ARCTIC96BD-19]
          Length = 407

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 301/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M RV VTGMGIVSS+G N SEV  SL+ A+SGI FSE +++ G R  V G  P ++ +++
Sbjct: 1   MNRVVVTGMGIVSSLGANKSEVLESLKSAKSGIEFSEKYSEMGLRSHVHGSIPDIDTSDV 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK +RF++    +  +A+ EAI +S L    I+HERTGLI GSGG S + IV +AD+ 
Sbjct: 61  IDRKMLRFMADAAIYNAIALYEAIKESGLSQDMISHERTGLIMGSGGASNQNIVESADIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R+    +R+GP+ VP+ M ST SA LST FKI+G +YSISSAC+TSAHCIGNA E IQ G
Sbjct: 121 RDR-GIKRVGPYRVPRTMGSTTSACLSTLFKIKGINYSISSACSTSAHCIGNAMEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+LDW+++ LFDAMGA+SS +N  P  ASR +D+ RDGFVISGG   +VL
Sbjct: 180 KQDVVFAGGGEELDWSLTMLFDAMGALSSKYNDSPDKASRAFDADRDGFVISGGGGALVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E ++ A+ARGA I AEL GYG+T DG DMV+PSGEGA RCM  A++ ++ P+DYIN HGT
Sbjct: 240 ESLDHAQARGANIIAELVGYGATSDGYDMVAPSGEGAKRCMEIAINGIKGPIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AI+EVF   +P I STKSL+GH+LGAAG  E+IY L+M+Q  F+ ES N
Sbjct: 300 STPVGDVKELGAIKEVFGDELPLIGSTKSLSGHALGAAGVNESIYSLLMLQNNFVTESVN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           IE +D E  G+PI R+   N +++ +LSNSFGFGGTNA LVF ++
Sbjct: 360 IENLDEEAIGMPIARET-KNIELNRILSNSFGFGGTNACLVFEKF 403


>gi|251792985|ref|YP_003007711.1| 3-oxoacyl-(acyl carrier protein) synthase I [Aggregatibacter
           aphrophilus NJ8700]
 gi|247534378|gb|ACS97624.1| acyl-carrier-protein (synthase II) [Aggregatibacter aphrophilus
           NJ8700]
          Length = 406

 Score =  474 bits (1219), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 293/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG GI+SSIGNN  EV  SL+  +SGI    +F     R  V G   LN +ELI
Sbjct: 1   MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFIDMKMRSHVAGTVKLNPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   ++++ERTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDAGLTEEQVSNERTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KI+G SYSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIKGVSYSISSACATSAHCIGNALELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++++ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMANIDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D +  G  IV +  +NA + TV+SNSFGFGGTNATLVF+RYKG
Sbjct: 361 ETLDEQAVGCNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRYKG 406


>gi|295098042|emb|CBK87132.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 405

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/406 (58%), Positives = 295/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEFKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF++    + +L+MQEAI DS L +     + R GLIAGSGG S+K  V  AD  
Sbjct: 61  DRKVVRFMNDASIYAYLSMQEAIKDSGLSEDAYQNNPRVGLIAGSGG-SSKAQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKAMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELGWEMACEFDAMGALSTKYNETPDKASRTYDAHRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLENGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  + A + TV+SNSFGFGGTNATLV R+ K
Sbjct: 360 IEEMDEQAAGLNIVTETTERA-LTTVMSNSFGFGGTNATLVMRKLK 404


>gi|113460810|ref|YP_718877.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus somnus
           129PT]
 gi|170717215|ref|YP_001784335.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus somnus
           2336]
 gi|112822853|gb|ABI24942.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus somnus
           129PT]
 gi|168825344|gb|ACA30715.1| Beta-ketoacyl synthase [Haemophilus somnus 2336]
          Length = 406

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/405 (57%), Positives = 296/405 (73%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  VTG GI+SSIGNN  EV  +L++ +SGI    DF K G R  + G   LN AELI
Sbjct: 1   MRRAVVTGFGIISSIGNNKQEVLEALKKGKSGIEVMPDFVKMGMRSHIAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +RK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  ERKIFRFMGDAAAYAYLSMKEAIEDAGLTEDQVSNDRTGLVIGAGTGSGHNQMVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDAHRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QAL++V+ PVDYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQALATVDTPVDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIR VF    P I STKS+TGHSLGAAGA EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELGAIRNVFADQKPAISSTKSMTGHSLGAAGAHEAIYSLLMLEHDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D +  G+ IV +  +NA ++TV+SNSFGFGGTNA LVF+RYK
Sbjct: 361 ETLDEQAVGMNIVTETKENAGLETVMSNSFGFGGTNACLVFKRYK 405


>gi|304312468|ref|YP_003812066.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [gamma proteobacterium
           HdN1]
 gi|301798201|emb|CBL46423.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [gamma proteobacterium
           HdN1]
          Length = 405

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVS +GN+   V  SL E RSGI  ++ + + GFR  + G   ++   L+
Sbjct: 1   MKRVVITGLGIVSCLGNDKQAVLQSLLEGRSGIRANDTYRQMGFRSHLSGSIDIDKEALV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM++AI D+ L   +I+ ERTGL+AGSGG S++  V+AAD+ R
Sbjct: 61  DRKALRFMGDAAAYAYIAMKQAIADAGLTDEQISSERTGLVAGSGGGSSENQVNAADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +RIGP+ VP+ M+ST SA L+T F I+G +YSI+SACATSAHCIG+A ELIQ GK
Sbjct: 121 DK-GVKRIGPYMVPRVMTSTISACLATPFHIKGVNYSITSACATSAHCIGHAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W +S +FDAMGA+SS +N  P SASR +D+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWALSMMFDAMGALSSKYNDAPESASRAFDASRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            ++ A ARGAKIYAEL GYG+T DG DMV+PSGEGA RCM+ A   +++PVDYIN HGT+
Sbjct: 240 SLDHALARGAKIYAELVGYGATSDGHDMVAPSGEGAQRCMKMATRDLKQPVDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A++ VF    P++ STKSL+GHSLGAAG  EAIY L+MM+  FI  S NI
Sbjct: 300 TPVGDLAEMGAVKAVFGDKQPWVSSTKSLSGHSLGAAGVHEAIYTLLMMENDFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DP   G  +  +RIDNAK++  +SNSFGFGGTNA+LVF+RY+G
Sbjct: 360 KELDPALAGAKVATQRIDNAKLEVAMSNSFGFGGTNASLVFQRYRG 405


>gi|226944977|ref|YP_002800050.1| 3-oxoacyl-(acyl carrier protein) synthase I [Azotobacter vinelandii
           DJ]
 gi|226719904|gb|ACO79075.1| 3-oxoacyl-(acyl-carrier-protein) synthase, FabB [Azotobacter
           vinelandii DJ]
          Length = 405

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI ++  +A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRYNPSYAEMGLRSQVSGSVDLDLEALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M++AI D+ L   +I+  R GLIAGSGG ST   + A D+ R
Sbjct: 61  DRKVYRFMGDAAAFAYLSMEQAIKDAGLTAEQISDPRVGLIAGSGGASTFNQMEAMDILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+GP+ VP+ M ST SA L+T FKI+G +YSISSACATSAHCIG+A E I  GK
Sbjct: 121 DK-GVKRVGPYRVPRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGSAMEQILMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDMVFAGGGEEEHWSQSFLFDAMGALSTQYNATPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAVRCMQLALATVDGPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E +A+R VF    P I STKSL+GHSLGAAG QEAIY L+MM+  FI  S NI
Sbjct: 300 TPVGDLAEAKAVRNVFGDKAPAISSTKSLSGHSLGAAGVQEAIYSLLMMEGDFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EE+DPE   +PIVR+  +N  ++TV+SNSFGFGGTNATLVF+R++G
Sbjct: 360 EELDPEVADLPIVRQTRENVVLNTVMSNSFGFGGTNATLVFKRWQG 405


>gi|163741724|ref|ZP_02149114.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Phaeobacter
           gallaeciensis 2.10]
 gi|161384897|gb|EDQ09276.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Phaeobacter
           gallaeciensis 2.10]
          Length = 409

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/409 (55%), Positives = 299/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  S + A+ GFR Q+ G   LN A+ +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVLASLKAGKSGIEASPEMAEHGFRSQIAGTLKLNVADHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ +ERTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGAGAAYAHIAMSQAIADAGLSEEQVVNERTGLVAGSGGPSTSAMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNA E I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNATEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL S+ +   VDYIN HG
Sbjct: 241 DLDHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALQSLPDGRKVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA R VF  GN+P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEIEAARRVFGAGNVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +    +   +  + ++NA +D+V++NSFGFGGTN ++V  +YKG
Sbjct: 361 INVDTLAEGIEPAEVATQLVENAGLDSVMTNSFGFGGTNGSMVLSKYKG 409


>gi|294637228|ref|ZP_06715531.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Edwardsiella tarda
           ATCC 23685]
 gi|291089588|gb|EFE22149.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Edwardsiella tarda
           ATCC 23685]
          Length = 403

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/405 (57%), Positives = 298/405 (73%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+ +  + G R QVWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLKEGRSGITFAPELQEAGMRSQVWGNIKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    + +L+MQEAI DS L    +++ RTGLI GSGG S +  V+ AD  R
Sbjct: 61  DRKVMRFMSDASIYAYLSMQEAIKDSGLTDEMVSNNRTGLIVGSGGGSPRNQVAGADGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIGNA E+IQ GK
Sbjct: 121 SR-GIRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGNAVEMIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++ W ++  FDAMGA+S+H+N  P  ASR YD++RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEEMCWELACEFDAMGALSTHYNDAPEKASRTYDAKRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCM+ A+  +++PVDY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMQMAMQDLDKPVDYLNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD KE+ AIREVF    P I STK++TGH+LGAAG  EAIY L+M++  FI  S NI
Sbjct: 300 TMVGDVKELGAIREVFGDQTPAISSTKAMTGHALGAAGVHEAIYTLLMLEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+D +  G+ IV +  +  ++D V+SNSFGFGGTNATLV R++K
Sbjct: 360 EELDEQAAGMNIVTEMTER-ELDVVMSNSFGFGGTNATLVMRKHK 403


>gi|118602966|ref|YP_904181.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567905|gb|ABL02710.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 405

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 300/406 (73%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M RV VTGMGI+SS+G N  EV  SL+ A+SGI F E+ A+ G R  V G    L+++E+
Sbjct: 1   MNRVVVTGMGIISSLGANCMEVLTSLKTAKSGIKFDENQAQMGLRSHVSGAIAELDSSEV 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK  RF++    +  +A+ EAI  S L P + ++ERTGLI GSGG S + +V AAD+ 
Sbjct: 61  IDRKMKRFMADAAIYNAVALDEAIKQSGLTPEQTSNERTGLIMGSGGASNQNVVEAADIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R+    +R+GP+ VP+ M ST SA LST FKI+G +YSISSAC+TS HCIGNA E IQ G
Sbjct: 121 RKK-GIKRVGPYRVPRTMGSTTSACLSTLFKIKGINYSISSACSTSTHCIGNAMEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD+MFAGG E+L+W+++ LFDAMGA+SS +N  P SASR +D+ RDGFVISGG   +VL
Sbjct: 180 KQDVMFAGGGEELNWSLTMLFDAMGALSSKYNQTPSSASRAFDTNRDGFVISGGGGALVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E +E A+ARGA I AELTGYG++ DG DMV+PSG+GA RCM+ A+S+V+ P+DYIN HGT
Sbjct: 240 ESLEYAQARGAIILAELTGYGASSDGYDMVAPSGQGAKRCMQLAISTVKGPIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AI+ VF  NIP + STKSL+GH+LGAAG  E+IY L+M+Q  F+ ES N
Sbjct: 300 STPVGDIKELSAIKAVFGNNIPNVSSTKSLSGHALGAAGVNESIYSLLMLQNDFMTESIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I+ +D   +G+PIVR     + +  V+SNSFGFGGTNA LVF ++K
Sbjct: 360 IKNLDKAAEGVPIVRTTTKQS-LKRVMSNSFGFGGTNACLVFEKFK 404


>gi|254467965|ref|ZP_05081371.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [beta proteobacterium
           KB13]
 gi|207086775|gb|EDZ64058.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [beta proteobacterium
           KB13]
          Length = 407

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 299/407 (73%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSS+GNN SEV  SL   +SGITF  ++A+ G R QV G   +N  ELI
Sbjct: 1   MRRAVITGLGIVSSLGNNQSEVKDSLYHGKSGITFQPEYAERGLRSQVAGSVNINYEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+++G T+  +AMQEAI D++L    +++  TGLI G+GG ST+ ++   +   
Sbjct: 61  DRKLLRFMAKGHTYAWIAMQEAIADAKLSDDLVSNPMTGLIVGAGGTSTESMLQGTETLA 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ V K MS+  +A L+T  KI+G +YSISSAC+TSAHCIGNA E IQ GK
Sbjct: 121 EK-GIRRVGPYMVTKTMSNGVAACLATGAKIKGINYSISSACSTSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  WTMS LFDAMGAMSS FN  P +ASR YD  RDGFVISGGA ++VLE
Sbjct: 180 QDIVFAGGAEEEHWTMSYLFDAMGAMSSKFNDAPETASRTYDKDRDGFVISGGAGILVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + E AK RGA IYAE+TGYG+T DG DMV+PSGEGA R M  AL +VE+ VDYINTHGT+
Sbjct: 240 DYEHAKNRGATIYAEVTGYGATSDGHDMVAPSGEGAERSMITALGNVEK-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFK----GNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           TP GD  E+ AI+ VF     G+IP I STKSL+GH+LGAAG  EAIY LIMM+  FI  
Sbjct: 299 TPVGDIVEINAIKNVFASGRFGDIPLIASTKSLSGHALGAAGVNEAIYSLIMMKNDFIAA 358

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S N++ ID   + +PIV K I+N +I+T++SNSFGFGGTNATL+F +
Sbjct: 359 SANVDNIDENIQDVPIVTKLIENKQINTIMSNSFGFGGTNATLLFSK 405


>gi|254427780|ref|ZP_05041487.1| Beta-ketoacyl synthase, N-terminal domain protein [Alcanivorax sp.
           DG881]
 gi|196193949|gb|EDX88908.1| Beta-ketoacyl synthase, N-terminal domain protein [Alcanivorax sp.
           DG881]
          Length = 396

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/398 (58%), Positives = 294/398 (73%), Gaps = 2/398 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGIVS +GN+   V  SLRE RSGI F E++ + G R QV G P +   + IDRK  RF+
Sbjct: 1   MGIVSCLGNDTDSVTRSLREGRSGIRFKEEYQEIGMRSQVAGTPTIQLDDFIDRKPRRFM 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
                + ++AMQ AI DS L   ++++ERTGLIAGSGG S+   V AAD+ R     +R+
Sbjct: 61  GDAAAYAYVAMQNAIADSGLNDEQVSNERTGLIAGSGGHSSLNQVEAADIARNR-GVKRV 119

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GP+ VP+ M+ST SA L+T FKI+G +YSI+SACATSAHCIGNA E IQ GKQD++FAGG
Sbjct: 120 GPYMVPRVMASTVSACLATPFKIKGVNYSIASACATSAHCIGNAVEQIQLGKQDVVFAGG 179

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+  WT+S LFD MGA+SS +N  P  ASR YD+ RDGFVI+GG  ++V+EE+E AKAR
Sbjct: 180 GEEEHWTLSCLFDGMGALSSKYNDTPEKASRAYDATRDGFVIAGGGGMVVVEELEHAKAR 239

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GA IYAE+ GYG+T DG DMV+P+GEGA RCMRQAL++VE  VDYIN HGT+TP GD  E
Sbjct: 240 GATIYAEVLGYGATSDGHDMVAPNGEGAARCMRQALATVEGSVDYINAHGTSTPVGDVAE 299

Query: 309 VEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK 368
           ++AIREVF    P I STKSL+GHSLGAAG QEAIYC++MMQ  F   S NIE +D + +
Sbjct: 300 LKAIREVFGDQCPSIGSTKSLSGHSLGAAGVQEAIYCMLMMQNDFTAISANIETLDEKAE 359

Query: 369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           G+P++ K  D+    TVLSNSFGFGGTNA+LV R+++G
Sbjct: 360 GMPVLVKGKDSGPT-TVLSNSFGFGGTNASLVLRKWEG 396


>gi|170727348|ref|YP_001761374.1| beta-ketoacyl synthase [Shewanella woodyi ATCC 51908]
 gi|169812695|gb|ACA87279.1| Beta-ketoacyl synthase [Shewanella woodyi ATCC 51908]
          Length = 403

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 236/405 (58%), Positives = 304/405 (75%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S+ F +   R  VWG   L+  E I
Sbjct: 1   MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSDQFEEMKLRSHVWGDIKLDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM EAI D+ L   + +  R G+IAG+GG S+   V AAD  R
Sbjct: 61  DRKALRFMGNAAAYAYIAMAEAIEDAGLTEEQYSDPRVGIIAGTGGASSANQVQAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST+SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMSSTSSACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V  PVDYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEVVGYGASSDGYDMVAPSGEGAVRCMQMALADVNTPVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+RE F  N+P I STKSLTGH+LGAAGA EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDMRELEALRETFGENLPAIASTKSLTGHALGAAGAHEAIYSLIMMENNFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+P+V +  +  +++TV+SNSFGFGGTNATLV  +YK
Sbjct: 360 DNLDEKAAGMPVVTEYRE-MELNTVMSNSFGFGGTNATLVMSKYK 403


>gi|99080022|ref|YP_612176.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Ruegeria sp. TM1040]
 gi|99036302|gb|ABF62914.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Ruegeria sp. TM1040]
          Length = 409

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/408 (56%), Positives = 299/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SLR  +SGI  SE+ A+ GFR Q+ G   ++ AE +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVIASLRAGKSGIVASEEMAEHGFRSQIAGTLKIDPAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ +ERTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMGQAIADAGLSEDQVVNERTGLVAGSGGPSTSSMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T +KI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAYKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNETPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           ++E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++ E   V YIN HG
Sbjct: 241 DLEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALQTLPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA R VF  GN+P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAARRVFGAGNVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+E +    +   +  + ++NA +D+V++NSFGFGGTN ++V  +YK
Sbjct: 361 INVETLAEGIEEGEVATQYVENAGLDSVMTNSFGFGGTNGSMVLSKYK 408


>gi|261867537|ref|YP_003255459.1| 3-oxoacyl-(acyl carrier protein) synthase I [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293391414|ref|ZP_06635748.1| beta-ketoacyl-acyl-carrier-protein synthase II [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412869|gb|ACX82240.1| hypothetical protein D11S_0844 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290951948|gb|EFE02067.1| beta-ketoacyl-acyl-carrier-protein synthase II [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 406

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 295/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +ELI
Sbjct: 1   MKRVVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFIEMKMRSHVAGTVKLNPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   ++++ER+GL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDAGLTEDQVSNERSGLVIGAGTGSAHNQLIACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KI+G SYSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIKGVSYSISSACATSAHCIGNAYELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNDTPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA++ ++ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMAGLDAPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLHNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G  IV + ++NA + TV+SNSFGFGGTNA+LVF+RY G
Sbjct: 361 ETLDEQAQGCNIVTETVENAGLQTVMSNSFGFGGTNASLVFKRYNG 406


>gi|259415316|ref|ZP_05739237.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Silicibacter sp.
           TrichCH4B]
 gi|259348546|gb|EEW60308.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Silicibacter sp.
           TrichCH4B]
          Length = 409

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/408 (56%), Positives = 299/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  SE+ A+ GFR Q+ G   ++ AE +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVIASLKAGKSGIVASEEMAEHGFRSQIAGTLKIDPAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ +ERTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMSQAIADAGLSDDQVVNERTGLVAGSGGPSTSSMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS FN  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKFNDTPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           ++E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++ E   V YIN HG
Sbjct: 241 DLEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALQTLPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA R VF  GN+P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAARRVFGAGNVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N++ +    +   +  + ++NA +D+V++NSFGFGGTN ++V  +YK
Sbjct: 361 INVDTLAEGIEEGEVATQYVENAGLDSVMTNSFGFGGTNGSMVLSKYK 408


>gi|329893632|ref|ZP_08269766.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [gamma
           proteobacterium IMCC3088]
 gi|328923559|gb|EGG30871.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [gamma
           proteobacterium IMCC3088]
          Length = 407

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 305/405 (75%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV +TG+GIVS +GN+   V  SL    SGI   E   + G R  + G+P ++ AE ID
Sbjct: 3   KRVVITGLGIVSCLGNDAKTVTESLFNGTSGIQTDESHIEMGLRSHISGRPTVDFAEHID 62

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     + ++AMQ+AI DS L   +I++ RTG+IAGSGG S      AAD+ RE
Sbjct: 63  RKQLRFMGDAAAYAYIAMQQAIDDSGLTQEQISNVRTGIIAGSGGASASSQTEAADILRE 122

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + M ST SA L+T F+I+G +YSISSAC+TSAHCIGNAAE IQ GKQ
Sbjct: 123 K-GIRRVGPYRVTQTMGSTVSACLATPFQIKGVNYSISSACSTSAHCIGNAAEQIQLGKQ 181

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           DI+FAGG E+L WTMS+LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E 
Sbjct: 182 DIVFAGGGEELHWTMSSLFDAMGALSTKYNDTPSKASRAYDADRDGFVIAGGGGMLVVES 241

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           ++ A  RGAKIYAEL GYG+T DG DMV+PSGEGA+RCM+QAL++V+ P+DYIN HGT+T
Sbjct: 242 LDHALTRGAKIYAELVGYGATSDGYDMVAPSGEGAMRCMQQALATVDGPIDYINAHGTST 301

Query: 302 PKGDKKEVEAIREVFKG-NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           P GD +E++A+R  F+G +IPYI STKSL+GHSLGAAG QEAIY L+M Q  FI  S NI
Sbjct: 302 PAGDIQEIKAVRAAFEGKDIPYINSTKSLSGHSLGAAGVQEAIYALLMQQNGFISASANI 361

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +DP+  G+PIVR+R+DN  +D ++SNSFGFGGTNA+LVF+RY+
Sbjct: 362 ENLDPDAAGMPIVRERMDNVTLDRIMSNSFGFGGTNASLVFQRYR 406


>gi|89070294|ref|ZP_01157613.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Oceanicola granulosus
           HTCC2516]
 gi|89044133|gb|EAR50294.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Oceanicola granulosus
           HTCC2516]
          Length = 409

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/408 (56%), Positives = 298/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+G+VS IGN+ +EV  SLR  +SGI    + A+ GFR QV G   ++ AE +
Sbjct: 1   MRRVVVTGLGVVSPIGNDAAEVEASLRAGKSGIEGVPEMAEHGFRSQVAGTLKIDVAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + H+AM +AI D+ L+  +I + R+GLIAGSGGPST  + +A     
Sbjct: 61  DKRALRFMGPGAAYAHIAMSQAIADAGLEESDIVNPRSGLIAGSGGPSTSAMFAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +RIGPFAVPK MSST SA LST F+I+G +YSI+SAC+TS HCIG AAE I  GK
Sbjct: 121 EKGSPKRIGPFAVPKCMSSTISANLSTAFRIKGINYSITSACSTSLHCIGAAAEQIAMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS FN  P  ASR +D+ RDGFVI+GG  ++VLE
Sbjct: 181 QDLMFAGGAEELDWTLSCLFDAMGAMSSKFNDTPEKASRAFDADRDGFVIAGGGGMVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           + ERAKARGA+IYAE+TG+ +T DG DMV+PSGEG  R MR AL ++ E   + YIN HG
Sbjct: 241 DYERAKARGARIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALETLPEDRKITYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF KG  P I STKS+TGHS GA GAQEAIYCL+M+Q  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGKGQTPPISSTKSMTGHSQGATGAQEAIYCLLMLQNDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N++ +DP  +   I    ++NA+ DT+++NSFGFGGTN +++  R +
Sbjct: 361 INVDNLDPALEPDEIASALVENARHDTLMTNSFGFGGTNGSMLLSRMR 408


>gi|221134785|ref|ZP_03561088.1| beta-ketoacyl synthase [Glaciecola sp. HTCC2999]
          Length = 404

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/405 (56%), Positives = 300/405 (74%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+GIVSSIGNN +EV  SLR  +SGIT+SE FA+ G R  VWGK  ++ +E I
Sbjct: 1   MRRAVITGLGIVSSIGNNKAEVTESLRAGKSGITYSEQFAEKGLRSHVWGKVDIDLSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+    ++  +AMQ+A+ DS L   +I++ RTG+IAGSGG S++  V +AD+ R
Sbjct: 61  DRKQLRFMGDAASYAFIAMQQAVADSGLTEDQISNIRTGIIAGSGGASSEHQVDSADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RR+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E+IQ  K
Sbjct: 121 NK-GVRRVGPYMVTRCMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNALEMIQLNK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W +S  FDAMGA+SS +N  P  ASR YD+ RDGFV SGG  ++V+E
Sbjct: 180 QDIVFAGGGEELHWALSGQFDAMGALSSQYNDTPDKASRTYDANRDGFVSSGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+ +V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAVRCMQMAMQNVDTDIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E++AI+EVF    P I +TK++TGH+LGAAG  EAIY ++MM+  FI  S N+
Sbjct: 300 TPVGDVQELKAIQEVFGEKSPAISATKAMTGHALGAAGVNEAIYSILMMENDFIAPSINV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D    G+ IV +  +   I+T++SNSFGFGGTNATLV RRY 
Sbjct: 360 ETLDEAAAGLDIVTETREQT-INTIMSNSFGFGGTNATLVMRRYN 403


>gi|33151800|ref|NP_873153.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus ducreyi
           35000HP]
 gi|33148021|gb|AAP95542.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Haemophilus ducreyi
           35000HP]
          Length = 405

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 296/406 (72%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GI+SSIGNN  EV  SL+E +SGI F  +FA+ G R Q+ G   LN AELI
Sbjct: 1   MKRVVITGLGIISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQIAGTVKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLAMKEAIEDSALTETQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGIKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNDTPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQAL++V   ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQALATVNGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELAAIKNVFADKKPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNNFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             +D + +G+ IV +   +  + TV+SNSFGFGGTNA LVF++YKG
Sbjct: 361 TTLDEQAEGLNIVTE-CQHTPLTTVMSNSFGFGGTNAALVFQKYKG 405


>gi|146329133|ref|YP_001209235.1| beta-ketoacyl synthase [Dichelobacter nodosus VCS1703A]
 gi|146232603|gb|ABQ13581.1| beta-ketoacyl synthase [Dichelobacter nodosus VCS1703A]
          Length = 404

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 301/405 (74%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV +TGMGIVSS+GNNV EV  SL+  +SGITFSE + +   R  V G    L+   L
Sbjct: 1   MRRVVITGMGIVSSLGNNVREVLTSLQTLKSGITFSEVYREMKLRSHVHGDIKNLDVKAL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK +RF+     + ++AM+EAI  ++L    I++ RTGL+ GSGG ++   V AAD+ 
Sbjct: 61  IDRKTLRFMGNAAAYCYIAMKEAIEHAKLTTEHISNPRTGLVVGSGGAASSVQVEAADIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    RRIGP+ V K MSST +A L+T + I+G SYS+SSAC+TSAHCIG+AAELIQ G
Sbjct: 121 RE-SGVRRIGPYGVTKTMSSTTAACLATPYGIKGVSYSMSSACSTSAHCIGHAAELIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+  WTMS LFDAMGA+S+ +N +P +ASRPYD+ RDGFVISGG +++VL
Sbjct: 180 KQDIVFAGGGEEEHWTMSMLFDAMGALSTAYNDNPTTASRPYDADRDGFVISGGGSILVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE E AKARGA+I AELTGYG+T DG DMV+PSGEGA+RCM+ AL+S    +DYIN HGT
Sbjct: 240 EEYEHAKARGAEILAELTGYGATSDGYDMVAPSGEGAVRCMQMALASHRGTIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFK-GNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           +T  GD +E+EAIRE FK   +P I STKSL+GH+LGAAG+ EAIY L+M+   F+  S 
Sbjct: 300 STVAGDMRELEAIRETFKNAELPLISSTKSLSGHALGAAGSNEAIYSLLMLLHGFVTASA 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NI  +D    G+PIVR+ +  + ++ V+SNSFGFGGTNATL+F R
Sbjct: 360 NIFNLDEVASGMPIVRENVQKS-LNAVMSNSFGFGGTNATLIFSR 403


>gi|261340716|ref|ZP_05968574.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Enterobacter
           cancerogenus ATCC 35316]
 gi|288317132|gb|EFC56070.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Enterobacter
           cancerogenus ATCC 35316]
          Length = 405

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 294/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEFKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF++    + +L+MQEAI D+ L +     + R GLIAGSGG S+K  V  AD  
Sbjct: 61  DRKVVRFMNDASIYAYLSMQEAIADAGLSEDVYQNNPRVGLIAGSGG-SSKAQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKAMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELGWEMACEFDAMGALSTKYNETPEKASRTYDAHRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELGAIREVFADKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E +D + +G+ IV K  D A + TV+SNSFGFGGTNATLV R+ K
Sbjct: 360 VEALDEQAEGLNIVTKPTD-ATLTTVMSNSFGFGGTNATLVMRKLK 404


>gi|261855583|ref|YP_003262866.1| beta-ketoacyl synthase [Halothiobacillus neapolitanus c2]
 gi|261836052|gb|ACX95819.1| Beta-ketoacyl synthase [Halothiobacillus neapolitanus c2]
          Length = 405

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 306/406 (75%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSSIGNN  EV  SL   RSGI  + +  + GFR  V G   +N  + I
Sbjct: 1   MRRVVITGMGIVSSIGNNQKEVLDSLMNGRSGIEINPEQVERGFRSHVAGTLKINPEDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI  S L P ++++ RTGLI GSGG S + IV  AD+ R
Sbjct: 61  DRKLFRFMGSAAAYTYLSMKEAIEQSGLTPEQVSNPRTGLIVGSGGSSCENIVETADIVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T F I+G ++SISSACATSAHCIG+  E IQ GK
Sbjct: 121 EK-GVKRVGPYMVTRTMGSTTSACLATPFGIKGINFSISSACATSAHCIGSGVEQIQFGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+SS +N  P +ASRP+D+ RDGFVISGG  V+VLE
Sbjct: 180 QDIVFAGGGEELHWSQTAMFDAMGALSSKYNDTPHTASRPFDATRDGFVISGGGGVVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA I AE+ GYG+T DG DMV PSGEGA+RCM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGANILAEVVGYGATSDGYDMVQPSGEGALRCMKQALATVDTPIDYVNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+E++ ++F  + P+I STKSLTGHSLGAAG+QEAIY L+MMQ RFI  S N+
Sbjct: 300 TPAGDMRELESLAKIFTDHKPFITSTKSLTGHSLGAAGSQEAIYSLLMMQNRFIAASANL 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            EIDP+ +G+ ++ + ++N KIDTVLSNSFGFGGTNA+LV RRY+G
Sbjct: 360 NEIDPKAEGVNLLTEMLENVKIDTVLSNSFGFGGTNASLVMRRYQG 405


>gi|114320529|ref|YP_742212.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226923|gb|ABI56722.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 405

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 303/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMG+VS IGN+   V  +LR  RSGI +  ++ + G R QV G   ++ ++ I
Sbjct: 1   MRRVVVTGMGVVSCIGNDRETVTEALRAGRSGIKYKPEYEEVGLRSQVAGSVDIDLSDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            RK++RF+     + ++AM++A+ D+ L   EI++ R GLIAGSGG ST  +V AA+ T 
Sbjct: 61  PRKSLRFMGDAAAFSYIAMEQAMRDAGLSADEISNPRVGLIAGSGGASTANVVQAAE-TL 119

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++   R+IGP+ V + M ST SA L+T F+I+G +YSI+SACATSAHCIG+A E IQ GK
Sbjct: 120 KNRGVRKIGPYGVTRTMGSTVSACLATPFRIKGLNYSITSACATSAHCIGSAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W++S LFD MGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDLIFAGGGEEEHWSLSMLFDGMGALSTKYNETPEKASRTYDADRDGFVIAGGGGMLVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            ++ A ARGAKIYAEL GYG+T DG DMV+PSGEGA RCMRQAL +VE PVDY+N HGT+
Sbjct: 240 ALDHALARGAKIYAELVGYGATSDGHDMVAPSGEGAARCMRQALETVEGPVDYVNAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A+REVF   +P + +TKSLTGHSLGAAG QEAIY L M++E FI  S NI
Sbjct: 300 TPVGDLAELKAMREVFGEQVPPVSATKSLTGHSLGAAGVQEAIYSLAMLEEGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +DPE +G+PIV +  +  +++TV+SNSFGFGGTN+TLVFRRY G
Sbjct: 360 ETMDPEAEGMPIVTEPREGVELNTVMSNSFGFGGTNSTLVFRRYDG 405


>gi|260598743|ref|YP_003211314.1| 3-oxoacyl-(acyl carrier protein) synthase I [Cronobacter turicensis
           z3032]
 gi|260217920|emb|CBA32510.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Cronobacter turicensis
           z3032]
          Length = 405

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/407 (57%), Positives = 299/407 (73%), Gaps = 5/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQEFFDAGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF++    + +L+MQEAI D+ L P E+   + R G++AGSGG S+K  V  AD 
Sbjct: 61  DRKVVRFMNDASIYAYLSMQEAIKDAGL-PDEVYQNNPRVGIVAGSGG-SSKAQVFGADA 118

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 119 MRSPRGLKAVGPYVVTKAMASAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQL 178

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 179 GKQDIVFAGGGEELGWEMACEFDAMGALSTKYNETPEKASRTYDASRDGFVIAGGGGMVV 238

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DY+N+HG
Sbjct: 239 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGLDTPIDYLNSHG 298

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 299 TSTPVGDVKELGAIREVFGDNTPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 358

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NIEE+D +  G+ I+   ++  ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 359 NIEELDEQANGMNIITAPVER-ELTTVMSNSFGFGGTNATLVMRKYQ 404


>gi|322515223|ref|ZP_08068221.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Actinobacillus ureae
           ATCC 25976]
 gi|322118728|gb|EFX90934.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Actinobacillus ureae
           ATCC 25976]
          Length = 405

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 298/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++R GL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDSGLTEDQVSNDRAGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N +P  ASR YD+ RDGFVI+GG AV+++E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDNPTKASRAYDANRDGFVIAGGGAVVMVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQAL++V   V+YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQALATVNGEVEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKKPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y G
Sbjct: 361 ETLDEQAEGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYNG 405


>gi|254360669|ref|ZP_04976818.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Mannheimia haemolytica
           PHL213]
 gi|261493314|ref|ZP_05989840.1| Beta-ketoacyl synthase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|153091209|gb|EDN73214.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Mannheimia haemolytica
           PHL213]
 gi|261310958|gb|EEY12135.1| Beta-ketoacyl synthase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 405

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 296/404 (73%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+  +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLESLKAGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDSGLTEEQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQA+++V   ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQAMATVNGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIR VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIRNVFGDKTPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNNFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF+RY
Sbjct: 361 ETLDEQAQGMNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQRY 403


>gi|329297429|ref|ZP_08254765.1| 3-oxoacyl-(acyl carrier protein) synthase I [Plautia stali
           symbiont]
          Length = 404

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 293/405 (72%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEETKDAGMRSHVWGNVKLDTNGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M EAI DS L   +  +  R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKIVRFMSDASIYAYLSMAEAIKDSGLTDEQYQNNPRVGLIAGSGGGSPRYQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKGVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDVVFAGGGEELSWEMACEFDAMGALSTKYNETPEKASRTYDASRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DY+NTHGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMQGLDTPIDYLNTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N PYI +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNTPYISATKAMTGHSLGAAGVQEAIYTLLMLEHSFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +E++D   KG+ IV +  + A + TV+SNSFGFGGTNATL  R+Y
Sbjct: 361 VEQLDDAAKGMNIVTQPTEKA-LTTVMSNSFGFGGTNATLTLRKY 404


>gi|332288393|ref|YP_004419245.1| 3-oxoacyl-acyl-carrier-protein synthase [Gallibacterium anatis
           UMN179]
 gi|330431289|gb|AEC16348.1| 3-oxoacyl-acyl-carrier-protein synthase [Gallibacterium anatis
           UMN179]
          Length = 406

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 294/405 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG G++SSIGNN  EV  SL E +SGIT   +F + G R  V G   +  +E I
Sbjct: 1   MKRAVITGFGVISSIGNNKDEVLASLLEGKSGITTMPEFVEVGMRSHVAGTVKITPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L+M+EAI D+ L    +++ERTGL+ G+G  S    + AAD  R
Sbjct: 61  DRKVMRFMGNAAAYAYLSMKEAIADAGLSEEIVSNERTGLVVGAGTGSAHNQIVAADAMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV + M+S+ SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 TPRGVKAIGPYAVTRTMASSVSACLATPFKIKGVNYSISSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 181 QDVVFAGGAEELSWECACEFDAMGAVSTKYNDTPEKASRAYDANRDGFVIAGGGGIVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QAL++V+ P+DY+N HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQALATVDTPIDYLNVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+ VF   +P I STKS+TGHSLGAAG  EAIY L+M++  FI  S NI
Sbjct: 301 TPVGDVKELEAIKNVFADKMPAISSTKSMTGHSLGAAGVHEAIYTLLMLEHDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D   +G  I+ K I NA + TV+SNSFGFGGTNATLVF+RY+
Sbjct: 361 ETLDERAEGCNIITKTIRNANLQTVMSNSFGFGGTNATLVFKRYQ 405


>gi|317492675|ref|ZP_07951102.1| beta-ketoacyl synthase domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919425|gb|EFV40757.1| beta-ketoacyl synthase domain-containing protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 404

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 296/405 (73%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+G+VSSIGNN  EV  SL+E RSGITF+ +  + G R  VWG   L+   +I
Sbjct: 1   MKRAVITGLGVVSSIGNNQQEVLASLKEGRSGITFAPELKEAGMRSHVWGNIKLDTTGMI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    + +L+MQEAI DS L    ++++RTGLI GSGG S +  V+ AD  R
Sbjct: 61  DRKVMRFMSDASIYAYLSMQEAIKDSGLADDMVSNDRTGLIVGSGGGSPRNQVAGADGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM S  SA L+T FKIRG +YSISSACATSAHCIGNA E+IQ GK
Sbjct: 121 SR-GLRGVGPYMVTKAMGSGVSACLATPFKIRGVNYSISSACATSAHCIGNAVEMIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD++RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELCWELACEFDAMGALSTQYNETPDKASRTYDTKRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCMR A+  ++ PVDY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMRMAMKDLDAPVDYLNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF  N P I STK++TGH+LGAAG  EAIY L+M++  F+  S NI
Sbjct: 300 TPVGDVKELGAIREVFGDNTPAISSTKAMTGHALGAAGVHEAIYTLLMLEHGFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+D + +G+ IV +      + TV+SNSFGFGGTNATLV ++++
Sbjct: 360 EELDEQAQGMNIVTEPTQR-DLTTVMSNSFGFGGTNATLVMKKFQ 403


>gi|56709221|ref|YP_165267.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Ruegeria pomeroyi DSS-3]
 gi|56680906|gb|AAV97571.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Ruegeria pomeroyi DSS-3]
          Length = 409

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 301/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIG N  EV  SLR  RSGI   E+ A+ GFR ++ G   ++ AE +
Sbjct: 1   MRRVVVTGLGIVSSIGVNAEEVTASLRAGRSGIVACEEMAEHGFRSRIAGTLKIDVAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + H+AMQ+AI D+ L   ++ + RTGL+AGSGGPST  ++SA     
Sbjct: 61  DKRALRFMGPGAAYAHIAMQQAIADAGLSEEQVVNPRTGLVAGSGGPSTSAMLSAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK M ST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMCSTISANLATAFKIKGLNYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E A ARGAKIYAE+TGY +T DG DMV+PSGEG  R MR A+S++ E   + YIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGYAATSDGHDMVAPSGEGGERAMRLAVSTLPEDRKISYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G +P I STKS+TGH+ GAAGA EAI+CL+M++  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGRVPPISSTKSMTGHAQGAAGALEAIFCLLMLEHDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +    +   +  + ++NA +D+V++NSFGFGGTN ++V  +++G
Sbjct: 361 INVETLAEGIQPGEVATQYVENAGLDSVMTNSFGFGGTNGSMVLSKFRG 409


>gi|315633870|ref|ZP_07889159.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Aggregatibacter
           segnis ATCC 33393]
 gi|315477120|gb|EFU67863.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Aggregatibacter
           segnis ATCC 33393]
          Length = 416

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 292/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG GI+SSIGNN  EV  SL+  +SGI    +F     R  V G   LN +ELI
Sbjct: 11  MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEIVPEFIDMKMRSHVAGTIKLNPSELI 70

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   ++++ERTGL+ G+G  S    + A D  R
Sbjct: 71  DRKVYRFMGDAAAYAYLSMKEAIEDAGLTEEQVSNERTGLVIGAGTGSAHNQLVACDAVR 130

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KI+G SYSISSACATSAHCIGNA ELIQ GK
Sbjct: 131 GPRGVKAVGPYAVTKTMASSVSACLATPYKIKGVSYSISSACATSAHCIGNALELIQLGK 190

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 191 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 250

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++++ P+DYIN HGT+
Sbjct: 251 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMANIDTPIDYINVHGTS 310

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 311 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 370

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D +  G  IV +  +NA + TV+SNSFGFGGTNATLVF+RY G
Sbjct: 371 ETLDEQAVGCNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRYNG 416


>gi|254464369|ref|ZP_05077780.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Rhodobacterales
           bacterium Y4I]
 gi|206685277|gb|EDZ45759.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Rhodobacterales
           bacterium Y4I]
          Length = 409

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/409 (56%), Positives = 297/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  S + A+ GFR QV G   ++ AE +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVTASLKAGKSGIVASPEMAEHGFRSQVAGTLKIDVAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L    + +ERTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMSQAIADAGLSEDHVVNERTGLVAGSGGPSTSAMLAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS  N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKKNDAPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL+++ E   VDYIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALATLPEGRKVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA R VF +G +P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAARRVFGEGKVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +        I    ++NA +D+V++NSFGFGGTN ++V  +YKG
Sbjct: 361 INVDTLAEGILPGEIATSLVENAGLDSVMTNSFGFGGTNGSMVLSKYKG 409


>gi|261496579|ref|ZP_05992959.1| Beta-ketoacyl synthase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261307782|gb|EEY09105.1| Beta-ketoacyl synthase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 405

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 296/404 (73%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G++SSIGNN  EV  SL+  +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGLGVISSIGNNKEEVLESLKAGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDSGLTEEQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDMVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQA+++V   ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQAMATVNGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIR VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIRNVFGDKTPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNNFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF+RY
Sbjct: 361 ETLDEQAQGMNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQRY 403


>gi|91762473|ref|ZP_01264438.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718275|gb|EAS84925.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 403

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 297/403 (73%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+G+VS +GNN  EV  SL  ++SGI+F E++ +   R  + GKP +   + +
Sbjct: 1   MRRVVVTGLGVVSCLGNNQEEVYKSLLNSKSGISFCEEYKEHNLRSHIHGKPNIKLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+  G  + ++AM+EAI DS L+  +I++ +TG++ GSGGPS + +V + D TR
Sbjct: 61  DRKTIRFMGSGAAYNYIAMKEAIKDSGLEDNDISNFKTGIVMGSGGPSIENVVLSVDKTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              + + +GPF VP+ M+ST+SATL+  FKI+G +Y++SSACATS HCIG+A+ELIQ GK
Sbjct: 121 AK-TPKLMGPFIVPRTMASTSSATLAVPFKIKGVNYTMSSACATSGHCIGHASELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+ +FDAM A+SS +N  P +ASR YD  RDGFVI+GG  V+VLE
Sbjct: 180 QDVVFAGGSEELHWAMTAMFDAMTALSSKYNDAPETASRAYDKTRDGFVIAGGGGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA IYAELTGYG+T DG DMV+PSGEGA+RCM+ AL++ +  +DY+NTHGT+
Sbjct: 240 EYEHAKARGANIYAELTGYGATSDGYDMVAPSGEGAVRCMKMALATAKNKMDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  + E F   +P I STKSL+GH LGAA   EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDITELRGVGEAFGAEVPKISSTKSLSGHPLGAASVHEAIYSLIMMKNNFITASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            E+D E K  PIV K   + K+++V+SNSFGFGGTNATL+F +
Sbjct: 360 TEMDDEAKKFPIVTKTETDVKLNSVMSNSFGFGGTNATLIFEK 402


>gi|269468357|gb|EEZ80028.1| 3-oxoacyl-(acyl-carrier-protein) synthase [uncultured SUP05 cluster
           bacterium]
          Length = 405

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/406 (56%), Positives = 298/406 (73%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPL-LNAAEL 59
           M RV VTGMGIVSS+G N  EV  SL+ A+SGI F E +A+ G R QV G    ++++++
Sbjct: 1   MNRVVVTGMGIVSSLGGNCKEVLESLKTAKSGIKFDETYAEMGLRSQVSGAVAEVDSSDI 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK  RF++    +  +A+ EAI  S L   ++++ RTGLI GSGG S + +V AAD+ 
Sbjct: 61  IDRKMKRFMADAAIYNAVALDEAIKQSGLTEEQVSNPRTGLITGSGGASNQNVVEAADIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    +R+GP+ VP+ M ST SA LST FKI+G +YSISSAC+TSAHCIGNA E IQ G
Sbjct: 121 REK-GIKRVGPYRVPRTMGSTTSACLSTMFKIKGINYSISSACSTSAHCIGNAMEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+LDW+++ LFDAMGA+SS +N  P  ASR YD+ RDGFVISGG   +VL
Sbjct: 180 KQDVVFAGGGEELDWSLTMLFDAMGALSSKYNETPEKASRAYDTDRDGFVISGGGGALVL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E +E A+ARGA I AELTGYG+T DG DMV+PSGEGA RCM  A+S+V+ P+DYIN HGT
Sbjct: 240 ESLEHAEARGATILAELTGYGATSDGFDMVAPSGEGAKRCMELAISTVDGPIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AI+EVF    P + STKSL+GH+LGAAG  EAIY L+M++  F+ ES N
Sbjct: 300 STPVGDAKELGAIKEVFGDKCPNVGSTKSLSGHALGAAGVNEAIYSLLMLENNFMAESVN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +D    GIP+V+     + ++ V+SNSFGFGGTNA LVF ++K
Sbjct: 360 IENLDEAADGIPVVQATTIQS-LNRVMSNSFGFGGTNACLVFEKFK 404


>gi|77361004|ref|YP_340579.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76875915|emb|CAI87136.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 403

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 306/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+G+VSSIGNN  EV  SL+  RSGI F+++FA +  R  V GK  ++  E +
Sbjct: 1   MRRAVITGIGVVSSIGNNKEEVLESLKTGRSGIAFNQEFADYKLRSNVSGKIDIDVKEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + +++M +AI DS L   ++++ERTG+I GSGG S+K  V AAD+ R
Sbjct: 61  DRKAMRFMGDAAAYSYISMTQAIADSGLSDEQVSNERTGIIVGSGGGSSKWQVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTTSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L WT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELHWTLAMEFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCMRQA+  V E +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMRQAMQDV-ESIDYLNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI++VF GN P I +TK++TGH+LGAAG  EAI+ L+M++  F+  S NI
Sbjct: 299 TPVGDVKELGAIQDVFGGNSPMISATKAMTGHALGAAGVHEAIFSLLMLEHGFVAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+D +  G+ IV +R D  +++TV+SNSFGFGGTNATLV  +YKG
Sbjct: 359 DELDEQAAGLDIVTERRD-VELNTVMSNSFGFGGTNATLVMSKYKG 403


>gi|88860427|ref|ZP_01135065.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas
           tunicata D2]
 gi|88817625|gb|EAR27442.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas
           tunicata D2]
          Length = 404

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 309/406 (76%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGN+  +V  SL+  RSGI ++E+FA++  R  V G   ++ AE +
Sbjct: 1   MKRAVITGIGIVSSIGNDKQQVLESLQTGRSGIKYNEEFAEYKLRSHVCGAIEIDIAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM +AI DS L   ++++ RTGL+ GSGG S+K  V AAD+ R
Sbjct: 61  DRKALRFMGDAAAFSYIAMAQAIADSGLTEDQVSNPRTGLVVGSGGGSSKNQVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+STASA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTASACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L WT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELHWTLAMEFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+QA+++VE P+DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAVRCMQQAMATVEGPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF G  P I +TK++TGH+LGAAG  EAIY L+M++  F+  S NI
Sbjct: 300 TPVGDVKELGAIQEVFGGKSPAISATKAMTGHALGAAGVHEAIYSLLMLEHGFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           + +D +  G+ IV ++ D A + TV+SNSFGFGGTNATLV ++YKG
Sbjct: 360 DTLDEQAVGLDIVTQKRDVA-LTTVMSNSFGFGGTNATLVMQKYKG 404


>gi|15602204|ref|NP_245276.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|12720580|gb|AAK02423.1| FabB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 406

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 294/405 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG GI+SSIGNN  EV  SL+  +SGI    +F + G R  V G   LN +ELI
Sbjct: 1   MKRAVITGFGIISSIGNNKDEVLASLKAGKSGIEVMPEFVEIGMRSHVAGTVKLNPSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLIACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHALELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNDTPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCMRQA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   +P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKVPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D   KG  IV + ++NA + TV+SNSFGFGGTNA L+F++Y+
Sbjct: 361 ETLDENAKGCNIVTETVENAGLKTVMSNSFGFGGTNAALIFKKYQ 405


>gi|212635895|ref|YP_002312420.1| beta-ketoacyl synthase [Shewanella piezotolerans WP3]
 gi|212557379|gb|ACJ29833.1| Beta-ketoacyl synthase [Shewanella piezotolerans WP3]
          Length = 399

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 235/400 (58%), Positives = 301/400 (75%), Gaps = 2/400 (0%)

Query: 6   VTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAM 65
           +TG+G+VSSIGNN  EV  SLR  RSGIT S+ F +   R  VWG   L+  E IDRKA+
Sbjct: 2   ITGLGVVSSIGNNKQEVTESLRAGRSGITHSDQFEEMKLRSHVWGDIKLDPKEHIDRKAL 61

Query: 66  RFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCST 125
           RF+     + ++AM EAI D+ L   + +  R G+IAG+GG S+   V AAD  RE    
Sbjct: 62  RFMGNAAAYAYIAMAEAIEDAGLTEEQYSDPRVGIIAGTGGASSANQVQAADTLREK-GV 120

Query: 126 RRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMF 185
           +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GKQD++F
Sbjct: 121 KRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGKQDMLF 180

Query: 186 AGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERA 245
           AGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+EE+E A
Sbjct: 181 AGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGIVVVEELEHA 240

Query: 246 KARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGD 305
            ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+  +DYINTHGT+TP GD
Sbjct: 241 LARGAKIYAEVIGYGASSDGYDMVAPSGEGAVRCMQMALADVDTRIDYINTHGTSTPVGD 300

Query: 306 KKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDP 365
            +E+EA+RE F  N+P I STKSLTGH+LGAAGA EAIY LIMM+  FI  S NI+ +D 
Sbjct: 301 MRELEALRETFGDNLPAIASTKSLTGHALGAAGAHEAIYSLIMMENSFIAPSINIDTVDE 360

Query: 366 EFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +  G+PIV + +   +++TV+SNSFGFGGTNATLV R+YK
Sbjct: 361 KAAGMPIVTE-MKQQELNTVMSNSFGFGGTNATLVMRKYK 399


>gi|71083101|ref|YP_265820.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|71062214|gb|AAZ21217.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 403

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/403 (54%), Positives = 297/403 (73%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+G+VS +GNN  EV  SL  ++SGI+F E++ +   R  + GKP +   + +
Sbjct: 1   MRRVVVTGLGVVSCLGNNQEEVYQSLLNSKSGISFCEEYKEHNLRSHIHGKPNIKLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+  G  + ++AM+EAI DS L+  +I++ +TG++ GSGGPS + +V + D TR
Sbjct: 61  DRKTIRFMGSGSAYNYIAMKEAIKDSGLEDKDISNFKTGIVMGSGGPSIENVVLSVDKTR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              + + +GPF VP+ M+ST+SATL+  FKI+G +Y++SSACATS HCIG+A+ELIQ GK
Sbjct: 121 AK-TPKLMGPFIVPRTMASTSSATLAVPFKIKGVNYTMSSACATSGHCIGHASELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+ +FDAM A+SS +N  P +ASR YD  RDGFVI+GG  V+VLE
Sbjct: 180 QDVVFAGGSEELHWAMTAMFDAMTALSSKYNDAPETASRAYDKTRDGFVIAGGGGVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA IYAELTGYG+T DG DMV+PSGEGA+RCM+ AL++ +  +DY+NTHGT+
Sbjct: 240 EYEHAKARGANIYAELTGYGATSDGYDMVAPSGEGAVRCMKMALATAKNKMDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  + E F   +P I STKSL+GH LGAA   EAIY LIMM+  FI  S NI
Sbjct: 300 TPVGDITELRGVGEAFGAEVPKISSTKSLSGHPLGAASVHEAIYSLIMMKNNFITASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            ++D E K  PIV K   + K+++V+SNSFGFGGTNATL+F +
Sbjct: 360 TDMDDEAKKFPIVTKTETDVKLNSVMSNSFGFGGTNATLIFEK 402


>gi|126200815|gb|ABN80398.1| beta-keto-acyl-carrier protein synthase [Shewanella hanedai]
          Length = 403

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/405 (58%), Positives = 303/405 (74%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+G+VSSIGNN  EV  SL+  RSGIT S+ F +   R  VWG   L+  E I
Sbjct: 1   MKRVVITGLGVVSSIGNNKQEVTESLKAGRSGITHSDQFEEMKLRSHVWGAIKLDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKA+RF+     + ++AM EAI D+ L   + +  R G+IAG GG S+   V AAD+ R
Sbjct: 61  DRKALRFMGNAAAYAYIAMAEAIEDAGLTEEQYSDPRVGIIAGCGGASSANQVQAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSSTASA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 EK-GVKRVGPYIVPRIMSSTASACLATPFKIKGMNYSISSACATSAHCIGHAVELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E++DWT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDMVFAGGSEEVDWTLTMGFDAMGALSTKYNDTPEKASRTYDADRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG++ DG DMV+PSGEGA+RCM+ AL+ V+ P+DYINTHGT+
Sbjct: 240 ELEHALARGAKIYAEVVGYGASSDGYDMVAPSGEGAVRCMQMALADVDTPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E+EA+ E F   +P I STKSLTGH+LGAAGA EAI+ LIMM+E FI  S NI
Sbjct: 300 TPVGDMRELEALPETFGDALPPIASTKSLTGHALGAAGAHEAIFSLIMMEEGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+P+V +    A + TV+SNSFGFGGTNATLV R+YK
Sbjct: 360 DNLDEKAVGMPVVTE-YRKADLTTVMSNSFGFGGTNATLVMRKYK 403


>gi|89054147|ref|YP_509598.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Jannaschia sp. CCS1]
 gi|88863696|gb|ABD54573.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Jannaschia sp. CCS1]
          Length = 409

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/408 (56%), Positives = 297/408 (72%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVS IGNN +EV  SL+  RSGI  S +  + GFR QV G   ++ AE +
Sbjct: 1   MRRVVVTGLGIVSPIGNNAAEVVESLKAGRSGIESSPEMVEHGFRSQVAGTLKIDVAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + H+AM +AI D+ L+  ++ +ERTGLIAGSGGPST  + +A     
Sbjct: 61  DKRALRFMGPGAAYAHIAMGQAIADAGLEESDVINERTGLIAGSGGPSTSAMFAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  + +RIGPFAVPK MSST SA LST +KI+G +YSI+SAC+TS HCIG+AAE I  GK
Sbjct: 121 EKGAPKRIGPFAVPKCMSSTISANLSTAYKIKGINYSITSACSTSLHCIGSAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI GG A++VLE
Sbjct: 181 QDVMFAGGAEELDWTLSCLFDAMGAMSSKYNDTPQRASRAFDADRDGFVIGGGGAILVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           EM+RA ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR A+ ++ E   V YIN HG
Sbjct: 241 EMDRAVARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLAMQTLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +GN P I STKS+TGH+ GAAGA EA +CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGNTPPISSTKSMTGHAQGAAGALEATFCLLMLDGDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+E +DP      I      +A +DTV++NSFGFGGTN +++  R++
Sbjct: 361 INVETLDPALNPAEIATAFKADAGLDTVMTNSFGFGGTNGSMLLSRFE 408


>gi|296104009|ref|YP_003614155.1| 3-oxoacyl-(acyl carrier protein) synthase I [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295058468|gb|ADF63206.1| 3-oxoacyl-(acyl carrier protein) synthase I [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 405

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 294/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEFKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF++    + +L+MQEAI DS L +     + R GLIAGSGG S+K  V  AD  
Sbjct: 61  DRKVVRFMNDASIYAYLSMQEAIKDSGLSEEVYQNNPRVGLIAGSGG-SSKAQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKAMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELGWEMACEFDAMGALSTKYNETPAKASRTYDAHRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLENGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 360 IEEMDEQAAGLNIVTET-TERELTTVMSNSFGFGGTNATLVMRKLK 404


>gi|126736938|ref|ZP_01752673.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp.
           SK209-2-6]
 gi|126721523|gb|EBA18226.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp.
           SK209-2-6]
          Length = 409

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/409 (56%), Positives = 298/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  S +  + GFR QV G   ++  E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAEEVIASLKAGKSGIEASPEMTEHGFRSQVAGTLKIDIKEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + H+AM +AI DS L   ++ + RTGL+AGSGGPST  +++A  +  
Sbjct: 61  DKRALRFMGDGAAYAHIAMSQAIADSGLTEEQVVNTRTGLVAGSGGPSTSAMLTAHQVVA 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS  N DP  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKKNDDPTKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           ++E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 DLEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALSTLPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA R VF  GN+P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAARRVFGAGNVPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +    +   +  + + +A +D+V++NSFGFGGTN ++V  +Y+G
Sbjct: 361 INVETLAEGIEPGEVATEFVPDAGLDSVMTNSFGFGGTNGSMVLSKYQG 409


>gi|310814630|ref|YP_003962594.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Ketogulonicigenium
           vulgare Y25]
 gi|308753365|gb|ADO41294.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Ketogulonicigenium
           vulgare Y25]
          Length = 408

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/406 (56%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GI SSIGNN  EVA +L+  +SGIT +    + GFR Q+ G   LN A+ I
Sbjct: 1   MRRVVITGLGIASSIGNNAEEVAAALKAGKSGITANAQMQEHGFRSQIAGDVKLNIADHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +++ +RF+  G  +  +AM +AI D+ L   EI+HERTGLIAGSGGPST  + +A     
Sbjct: 61  EKRTLRFMGPGAAYAWIAMSQAIADAGLTESEISHERTGLIAGSGGPSTSNLFAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              S +RIGP  VP+ MSST SA LST FKI+G +YSI+SAC+TS HCIG AAE IQ GK
Sbjct: 121 TTGSPKRIGPLMVPRGMSSTVSANLSTAFKIKGINYSITSACSTSLHCIGAAAEQIQFGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVIS G A++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDAGRDGFVISAGGAIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           E+E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL+++ E   V YIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGFAATSDGHDMVAPSGEGGERAMRLALNTLPEGRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD  EVEA+R VF    P I STKS+TGHS GA GAQEAIYCL+M+++ FI  S 
Sbjct: 301 TSTPVGDVGEVEAVRRVFGDTHPVISSTKSMTGHSQGATGAQEAIYCLLMLRDDFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           N+E +DP      I    + +A +DTV++NSFGFGGTN +++  R+
Sbjct: 361 NVETLDPAINPGEIALTTVLDAGLDTVMTNSFGFGGTNGSMLLSRF 406


>gi|170767297|ref|ZP_02901750.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia albertii
           TW07627]
 gi|170123631|gb|EDS92562.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia albertii
           TW07627]
          Length = 406

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 293/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPETYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV + ID  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETIDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|68249950|ref|YP_249062.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           86-028NP]
 gi|148826059|ref|YP_001290812.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittEE]
 gi|68058149|gb|AAX88402.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus influenzae
           86-028NP]
 gi|148716219|gb|ABQ98429.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittEE]
          Length = 406

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 293/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+E +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRAVITGFGIISSIGNNKEEVLASLKEGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|6573501|pdb|1DD8|A Chain A, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I From Escherichia Coli
 gi|6573502|pdb|1DD8|B Chain B, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I From Escherichia Coli
 gi|6573503|pdb|1DD8|C Chain C, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I From Escherichia Coli
 gi|6573504|pdb|1DD8|D Chain D, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I From Escherichia Coli
 gi|93279072|pdb|2CDH|A Chain A, Architecture Of The Thermomyces Lanuginosus Fungal Fatty
           Acid Synthase At 5 Angstrom Resolution.
 gi|93279073|pdb|2CDH|B Chain B, Architecture Of The Thermomyces Lanuginosus Fungal Fatty
           Acid Synthase At 5 Angstrom Resolution.
 gi|93279074|pdb|2CDH|C Chain C, Architecture Of The Thermomyces Lanuginosus Fungal Fatty
           Acid Synthase At 5 Angstrom Resolution.
 gi|93279075|pdb|2CDH|D Chain D, Architecture Of The Thermomyces Lanuginosus Fungal Fatty
           Acid Synthase At 5 Angstrom Resolution.
 gi|93279076|pdb|2CDH|E Chain E, Architecture Of The Thermomyces Lanuginosus Fungal Fatty
           Acid Synthase At 5 Angstrom Resolution.
 gi|93279077|pdb|2CDH|F Chain F, Architecture Of The Thermomyces Lanuginosus Fungal Fatty
           Acid Synthase At 5 Angstrom Resolution
          Length = 406

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 293/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|146312513|ref|YP_001177587.1| 3-oxoacyl-(acyl carrier protein) synthase I [Enterobacter sp. 638]
 gi|145319389|gb|ABP61536.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Enterobacter sp. 638]
          Length = 405

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 294/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEFKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF++    + +L+MQEAI D+ L +    ++ R GLIAGSGG S+K  V  AD  
Sbjct: 61  DRKVVRFMNDASIYAYLSMQEAIADAGLSEDVYQSNPRVGLIAGSGG-SSKAQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKAMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELGWEMACEFDAMGALSTKYNETPEKASRTYDAHRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMQGLDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AI EVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELGAICEVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +EE+D +  G+ IV K  +   + TV+SNSFGFGGTNATLV R+ K
Sbjct: 360 VEELDEKAAGLNIVTKPTEQ-TLTTVMSNSFGFGGTNATLVMRKLK 404


>gi|311278716|ref|YP_003940947.1| Beta-ketoacyl synthase [Enterobacter cloacae SCF1]
 gi|308747911|gb|ADO47663.1| Beta-ketoacyl synthase [Enterobacter cloacae SCF1]
          Length = 404

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 294/405 (72%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF+S    +  L+M++AI D+ L   E+   + R GLIAGSGG S K  V  AD 
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLS-AEVYQNNPRVGLIAGSGGGSPKFQVFGADA 119

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQL 179

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 180 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDANRDGFVIAGGGGMVV 239

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 240 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHG 299

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 300 TSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           N+EE+D + +G+ IV K  D A + TV+SNSFGFGGTNATLV R+
Sbjct: 360 NVEELDEQAQGLNIVTKPTD-ATLTTVMSNSFGFGGTNATLVMRK 403


>gi|283832245|ref|ZP_06351986.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Citrobacter youngae
           ATCC 29220]
 gi|291071886|gb|EFE09995.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Citrobacter youngae
           ATCC 29220]
          Length = 406

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 293/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++A+ D+ L   +  +  R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAVADAGLAAEDYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N DP  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDDPSKASRTYDANRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV K  + A + TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTKPTEQA-LTTVMSNSFGFGGTNATLVMRKLK 405


>gi|323170406|gb|EFZ56059.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           LT-68]
          Length = 406

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK MRF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVMRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|119470779|ref|ZP_01613390.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Alteromonadales
           bacterium TW-7]
 gi|119446006|gb|EAW27285.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Alteromonadales
           bacterium TW-7]
          Length = 403

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 307/405 (75%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+G+VSSIGNN  EV  SL+  +SGI F+++FA +  R  V GK  +N  + +
Sbjct: 1   MRRAVITGIGVVSSIGNNKEEVLESLKTGKSGIAFNQEFADYSLRSNVSGKIDINVKDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + +++M +AI DS L   ++++ERTG+I GSGG S+K  V AAD+ R
Sbjct: 61  DRKAMRFMGDAAAYSYISMTQAIEDSGLSEEQVSNERTGIIVGSGGGSSKWQVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTTSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L WT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELHWTLAMEFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCMRQA+ +V + +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMRQAMQNV-DSIDYLNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI++VF GN P I +TK++TGH+LGAAG  EAI+ L+M++  F+  S N+
Sbjct: 299 TPVGDVKELGAIQDVFGGNSPMISATKAMTGHALGAAGVHEAIFSLLMLEHGFVAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E+D + +G+ IV +R D  +++TV+SNSFGFGGTNATLV  +YK
Sbjct: 359 DELDEQAEGLDIVTERKD-VELNTVMSNSFGFGGTNATLVMSKYK 402


>gi|283786401|ref|YP_003366266.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Citrobacter rodentium
           ICC168]
 gi|282949855|emb|CBG89478.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Citrobacter rodentium
           ICC168]
          Length = 405

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 295/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+F   G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSEEFKDAGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF++    + +L+MQ+AI D+ L +     + R GLIAGSGG S+K  V  AD  
Sbjct: 61  DRKVVRFMNDASIYAYLSMQQAIADAGLSEEVYQNNPRVGLIAGSGG-SSKAQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKAMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGF+I+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELGWEMACEFDAMGALSTKYNDQPAKASRTYDAHRDGFIIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA+IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGARIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDSPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 360 IEEMDEQAAGLNIVTET-TERELTTVMSNSFGFGGTNATLVMRKLK 404


>gi|126735004|ref|ZP_01750750.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp. CCS2]
 gi|126715559|gb|EBA12424.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp. CCS2]
          Length = 409

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/409 (54%), Positives = 299/409 (73%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVS IGNN  EV  +L+  +SGI  S + A+ GFR Q+ G   ++  E +
Sbjct: 1   MRRVVVTGLGIVSPIGNNADEVLAALKAGKSGIEASPEMAEHGFRSQIAGTLKIDIKEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ +  TGLIAGSGGPST  I++A ++ +
Sbjct: 61  DKRTLRFMGPGAAYAHIAMGQAIADAGLGEDQVVNPMTGLIAGSGGPSTSAILAAHEVVK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
              +T+RIGPFAVPKAMSST SA L+T ++I+G ++SI+SAC+TS HCIG AA+ +  G 
Sbjct: 121 NTGATKRIGPFAVPKAMSSTVSANLATAYQIKGMNFSITSACSTSLHCIGMAAQQVALGN 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI+GG A++VLE
Sbjct: 181 QDIMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDADRDGFVIAGGGAMVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV--EEPVDYINTHG 298
            +E A+ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++  +  + YIN HG
Sbjct: 241 SLENAQARGAKIYAEVTGFSATSDGADMVAPSGEGGERAMRSALKTLPDDRKISYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G  P I STKS+TGHS GA GAQEA+YCL+M++  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGQGTTPPISSTKSMTGHSQGATGAQEAVYCLLMLENDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      I    ++NA +DTV++NSFGFGGTN +++  ++KG
Sbjct: 361 INVENLDPALDPAEIATSLVENAGLDTVMTNSFGFGGTNGSMLLSKFKG 409


>gi|291618235|ref|YP_003520977.1| FabB [Pantoea ananatis LMG 20103]
 gi|291153265|gb|ADD77849.1| FabB [Pantoea ananatis LMG 20103]
 gi|327394628|dbj|BAK12050.1| 3-oxoacyl-[acyl-carrier-protein] synthase I FabB [Pantoea ananatis
           AJ13355]
          Length = 406

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQEMKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M+EAI DS L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEEAIKDSGLSNEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTRYNDTPEKASRTYDNERDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N PYI +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNTPYISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I  +D   +G+ IV +  + A + TV+SNSFGFGGTNATL  R+Y+
Sbjct: 361 ISSLDAAAEGMNIVTQPTEKA-LTTVMSNSFGFGGTNATLTMRKYQ 405


>gi|254463277|ref|ZP_05076693.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Rhodobacterales
           bacterium HTCC2083]
 gi|206679866|gb|EDZ44353.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 409

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/409 (55%), Positives = 297/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SLRE RSGIT +ED  + GFR Q+ G   L+  + +
Sbjct: 1   MRRVVVTGLGIVSSIGNNADEVLTSLREGRSGITANEDMKEHGFRSQIAGAIDLDIKDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI+D+ L   EI +  TGLIAGSGGPST  +++A  +  
Sbjct: 61  DKRTLRFMGPGAAYAHIAMSQAISDAGLTEKEIINPMTGLIAGSGGPSTSAMLAAHQVVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T ++I+G ++SI+SAC+TS HCIG AA+ +  G 
Sbjct: 121 KSGATKRIGPFAVPKTMSSTVSANLATAYQIKGMNFSITSACSTSLHCIGMAAQQVALGL 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI GG  ++VLE
Sbjct: 181 QDTMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDANRDGFVIGGGGGMVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
            +E A+ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL +++    V YIN HG
Sbjct: 241 SLESAQARGAKIYAEVTGFSATSDGADMVAPSGEGGERAMRGALKTLQSDRSVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF +G  P + STKS+TGHS GA GAQEAIYCL+ +Q  FI  S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGEGTTPPVSSTKSMTGHSQGATGAQEAIYCLLALQNDFIIPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      I   R+DNA +DTV++NSFGFGGTN +++  ++ G
Sbjct: 361 INVETLDPALNAAEIATTRVDNAGLDTVMTNSFGFGGTNGSMLLSKFHG 409


>gi|90020645|ref|YP_526472.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Saccharophagus
           degradans 2-40]
 gi|89950245|gb|ABD80260.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Saccharophagus
           degradans 2-40]
          Length = 405

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/405 (56%), Positives = 296/405 (73%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTGMGI S IG ++  V  +LRE +SGI F+E + + GFR  V G   ++ +E I
Sbjct: 1   MKRVVVTGMGIASCIGTDLDTVLAALREGKSGIRFNESYKEQGFRSHVSGSVDMDLSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +++M++AI DS L   ++++ERTG+I GSGG STK +V  AD  R
Sbjct: 61  DRKMYRFMGDAAGYAYVSMKQAIEDSGLTEEQVSNERTGIIMGSGGASTKSVVECADTIR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R GP+ V + M STASA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 DR-GVKRAGPYRVTQTMGSTASACLATPFKIKGINYSISSACATSAHCIGNAMELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  WT++ +FDAMGA+SS +N  P  ASR YD+ RDGFVI+GG   +V+E
Sbjct: 180 QDVVFAGGGEEEHWTLTGMFDAMGALSSKYNDTPEKASRAYDADRDGFVIAGGGGCMVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE-EPVDYINTHGT 299
            ++ A ARGAKIY EL GYG+T DG DMV+PSGEGA RCMRQA++      +DYIN+HGT
Sbjct: 240 SLDHALARGAKIYGELVGYGATSDGYDMVAPSGEGAARCMRQAMAQAGVSTIDYINSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD  E++A++EVF  N+P I STKSLTGHSLGA G QEAIY ++MM   FI  S N
Sbjct: 300 STPVGDLAELKAVKEVFGENVPAISSTKSLTGHSLGATGVQEAIYTMLMMNNNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +E IDP  +G+PIV    D A I++ +SNSFGFGGTNATLVF++Y
Sbjct: 360 VETIDPAAEGMPIVTASKD-ANIESAMSNSFGFGGTNATLVFKKY 403


>gi|241767008|ref|ZP_04764797.1| Beta-ketoacyl synthase [Acidovorax delafieldii 2AN]
 gi|241362477|gb|EER58398.1| Beta-ketoacyl synthase [Acidovorax delafieldii 2AN]
          Length = 405

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 294/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG GIVS IGN+++ V  SLRE+RSGI     F + G R QV G P +N  E I
Sbjct: 1   MKRVVITGTGIVSCIGNDMATVTQSLRESRSGIRAMPQFTEMGMRSQVAGVPQINLEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + H+A+++AI +S L P ++++ RTGLI GSGG S    + AAD+ R
Sbjct: 61  DRKQLRFMGDAAAYAHIALKQAIAESGLMPDQVSNPRTGLIMGSGGGSPANQIEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RR+GP+ V + MSST SA LST F I+G +YSI+SAC+TSAHCIG AA+ I  G 
Sbjct: 121 SK-GIRRVGPYQVTRCMSSTVSACLSTNFGIKGINYSITSACSTSAHCIGAAAQQIAWGM 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E++ W M  LFDAMGAMSS +N  P  ASR YD+ RDGFV+SGG   +VLE
Sbjct: 180 QDVMFAGGGEEVTWGMGLLFDAMGAMSSAYNATPEKASRAYDANRDGFVLSGGGGAVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            ++ A ARGA I  E+ G+G+T DG DMV+PSG+GAI CMRQA+S+V EP+DYINTHGT+
Sbjct: 240 SLDHALARGANILGEVIGFGATSDGADMVAPSGDGAIACMRQAISTVGEPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIREVF   +P   STKSLTGHSLGA G QEAIYCL+M+++ FI  S NI
Sbjct: 300 TPVGDVPELRAIREVFGDAVPPFSSTKSLTGHSLGATGVQEAIYCLLMLRQGFIAASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E ++P  +G+P+VR+  D A I T LSNSFGFGGTNA+LV RR+ G
Sbjct: 360 ETLEPAAEGMPLVRETRD-APIRTALSNSFGFGGTNASLVLRRWDG 404


>gi|229847149|ref|ZP_04467254.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           7P49H1]
 gi|229809978|gb|EEP45699.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           7P49H1]
          Length = 406

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 293/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+E +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRAVITGFGIISSIGNNKEEVLASLKEGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEYALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|161502478|ref|YP_001569590.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863825|gb|ABX20448.1| hypothetical protein SARI_00522 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 406

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/408 (57%), Positives = 296/408 (72%), Gaps = 4/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R QVWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF+S    + +L+M++A+ D+ L P E+   + R GLIAGSGG S K  V  AD 
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAP-EVYQNNPRVGLIAGSGGGSPKFQVFGADA 119

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIFGVNYSISSACATSAHCIGNAVEQIQL 179

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 180 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVV 239

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 240 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHG 299

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 300 TSTPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           NIE++D +  G+ IV +  +   + TV+SNSFGFGGTNATLV R+ KG
Sbjct: 360 NIEQMDEQAAGLNIVTETTERG-LTTVMSNSFGFGGTNATLVMRKLKG 406


>gi|304398252|ref|ZP_07380126.1| Beta-ketoacyl synthase [Pantoea sp. aB]
 gi|304354118|gb|EFM18491.1| Beta-ketoacyl synthase [Pantoea sp. aB]
          Length = 406

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 293/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLSSLREGRSGITFSEEMKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M+EAI DS L      ++ R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEEAIKDSGLTTEMYQSNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTRYNDTPEKASRTYDNERDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N PYI +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNTPYISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I  +D    G+ IV + ++  ++ TV+SNSFGFGGTNATL  R+Y+
Sbjct: 361 ITSLDAAATGMNIVTEPVEK-ELTTVMSNSFGFGGTNATLTMRKYQ 405


>gi|2384564|gb|AAC45620.1| beta-ketoacyl-ACP synthase I [Pseudomonas aeruginosa PAO1]
          Length = 405

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 300/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V+ +LR  R GI F+  +A+ G R  V G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI DS L P +I++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V + M ST SA L+T F+I+G +YSISSACATSAHCIG A E IQ GK
Sbjct: 121 EK-GVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+ S LFDAMGA+S+ +N     ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEEEHWSQSCLFDAMGALSTQYNETAEKASRAYDAKRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A  RGAKIYAE+ GYG+T DG DMV+PSGEGAI CM+QAL++V+ P+DY+NTHGT+
Sbjct: 240 GLEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIPCMQQALATVDAPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+  +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S NI
Sbjct: 300 TPVGDVGEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+DPE   +PI+R+  +NAK+DTV+SNSFGFGGTNATLV +R++G
Sbjct: 360 DELDPEVADLPILRETRENAKLDTVMSNSFGFGGTNATLVLKRWQG 405


>gi|323967765|gb|EGB63177.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           M863]
 gi|323977475|gb|EGB72561.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           TW10509]
 gi|327252594|gb|EGE64253.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           STEC_7v]
          Length = 406

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|325918967|ref|ZP_08181034.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325534812|gb|EGD06741.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 402

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/403 (56%), Positives = 296/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI S +GN++  V+ +LRE+RSGIT   D A  G R QV G   L+   LI
Sbjct: 1   MRRVVVTGMGINSCLGNDLDTVSTALRESRSGITALPDHADAGLRSQVGGAVTLDLEALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L   +++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLSAEQVSDVRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+  +E P+DY+NTHGT+
Sbjct: 240 DYDHAVARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMQGLERPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N P + STK+L+GHSLGAA   EAIY L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNAPPLSSTKALSGHSLGAASVHEAIYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R+  D A ++TV+SNSFGFGGTN TLVF R
Sbjct: 360 DELDPRAEGFPILRQTQD-ATLNTVMSNSFGFGGTNGTLVFGR 401


>gi|40063324|gb|AAR38142.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [uncultured marine
           bacterium 578]
          Length = 406

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/407 (57%), Positives = 298/407 (73%), Gaps = 4/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M RV +TGMGIVSS+G N +EV  SL+ A+SGI FSE +A+ G R  V G    ++ +++
Sbjct: 1   MNRVVITGMGIVSSLGGNKAEVLESLKSAKSGIEFSEKYAEMGLRSHVHGSISEVDTSDI 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK +RF++    +  +A+ EAI  S L    ++ ERTGLI GSGG S   +V AAD+ 
Sbjct: 61  IDRKMLRFMADAAIFNAIALDEAIKQSGLSEDMVSSERTGLIMGSGGASNVNVVEAADIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    +R+GP+ VP+ M ST SA LST FKI+G +YSISSAC+TSAHCIGNA E IQ G
Sbjct: 121 REK-GIKRVGPYRVPRTMGSTTSACLSTLFKIKGINYSISSACSTSAHCIGNAMEQIQHG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+LDW+ + LFD+MGA+SS +N  P  ASR +D+ RDGFVISGG   ++L
Sbjct: 180 KQDVVFAGGGEELDWSTTMLFDSMGALSSKYNKTPELASRAFDANRDGFVISGGGGALIL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E +E A+ARGA I AEL GYG+T DG DMV+PSGEGA RCM  A S+V   +DYIN HGT
Sbjct: 240 ESLEHAEARGATIIAELVGYGATSDGHDMVAPSGEGARRCMEIATSTVNGTIDYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFK-GNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           +TP GD KE+EAI++VF   +IP I STKSL+GH+LGAAG  E+IY L+M++  F+ ES 
Sbjct: 300 STPVGDIKELEAIKQVFDTTSIPLIGSTKSLSGHALGAAGVNESIYSLLMLENDFVAESV 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NIE +D E +G+PIVR+   N K+D +LSNSFGFGGTNA LVF R+ 
Sbjct: 360 NIEILDDEAEGMPIVRET-KNIKLDRILSNSFGFGGTNACLVFERFN 405


>gi|145639076|ref|ZP_01794684.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittII]
 gi|145272048|gb|EDK11957.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittII]
 gi|309751028|gb|ADO81012.1| 3-oxoacyl-(acyl carrier protein) synthase [Haemophilus influenzae
           R2866]
          Length = 406

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 293/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA ++TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLETVMSNSFGFGGTNATLIFKRYNG 406


>gi|16130258|ref|NP_416826.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str.
           K-12 substr. MG1655]
 gi|26248711|ref|NP_754751.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           CFT073]
 gi|82544804|ref|YP_408751.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella boydii Sb227]
 gi|89109143|ref|AP_002923.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str.
           K-12 substr. W3110]
 gi|91211620|ref|YP_541606.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           UTI89]
 gi|110642527|ref|YP_670257.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli 536]
 gi|117624513|ref|YP_853426.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli APEC
           O1]
 gi|157161811|ref|YP_001459129.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli HS]
 gi|170019368|ref|YP_001724322.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli ATCC
           8739]
 gi|170081939|ref|YP_001731259.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170683941|ref|YP_001744524.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           SMS-3-5]
 gi|188491922|ref|ZP_02999192.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           53638]
 gi|191165554|ref|ZP_03027395.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli B7A]
 gi|191170022|ref|ZP_03031576.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli F11]
 gi|193062409|ref|ZP_03043504.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli E22]
 gi|193069745|ref|ZP_03050696.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           E110019]
 gi|194428636|ref|ZP_03061174.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli B171]
 gi|194436265|ref|ZP_03068367.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           101-1]
 gi|209919823|ref|YP_002293907.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli SE11]
 gi|215487536|ref|YP_002329967.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218554878|ref|YP_002387791.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli IAI1]
 gi|218559236|ref|YP_002392149.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli S88]
 gi|218690483|ref|YP_002398695.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli ED1a]
 gi|218695922|ref|YP_002403589.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           55989]
 gi|218700799|ref|YP_002408428.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           IAI39]
 gi|218705853|ref|YP_002413372.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           UMN026]
 gi|227887383|ref|ZP_04005188.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           83972]
 gi|237704803|ref|ZP_04535284.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia sp.
           3_2_53FAA]
 gi|238901498|ref|YP_002927294.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           BW2952]
 gi|253772753|ref|YP_003035584.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162332|ref|YP_003045440.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli B
           str. REL606]
 gi|256017519|ref|ZP_05431384.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella sp. D9]
 gi|256021992|ref|ZP_05435857.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia sp.
           4_1_40B]
 gi|260844910|ref|YP_003222688.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O103:H2 str. 12009]
 gi|260856367|ref|YP_003230258.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O26:H11 str. 11368]
 gi|260869045|ref|YP_003235447.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O111:H- str. 11128]
 gi|293405789|ref|ZP_06649781.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           FVEC1412]
 gi|293410680|ref|ZP_06654256.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli B354]
 gi|293446660|ref|ZP_06663082.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli B088]
 gi|297521559|ref|ZP_06939945.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli OP50]
 gi|298381472|ref|ZP_06991071.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           FVEC1302]
 gi|300818071|ref|ZP_07098283.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           107-1]
 gi|300822199|ref|ZP_07102341.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           119-7]
 gi|300897006|ref|ZP_07115485.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           198-1]
 gi|300922063|ref|ZP_07138205.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           182-1]
 gi|300936903|ref|ZP_07151790.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           21-1]
 gi|300948527|ref|ZP_07162621.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           116-1]
 gi|300956408|ref|ZP_07168699.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           175-1]
 gi|300983547|ref|ZP_07176641.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           45-1]
 gi|300986864|ref|ZP_07177846.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           200-1]
 gi|301023571|ref|ZP_07187335.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           196-1]
 gi|301024156|ref|ZP_07187866.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           69-1]
 gi|301049082|ref|ZP_07196066.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           185-1]
 gi|301328829|ref|ZP_07221871.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           78-1]
 gi|301647573|ref|ZP_07247370.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           146-1]
 gi|306814565|ref|ZP_07448727.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           NC101]
 gi|307138988|ref|ZP_07498344.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli H736]
 gi|307311116|ref|ZP_07590760.1| Beta-ketoacyl synthase [Escherichia coli W]
 gi|309793207|ref|ZP_07687635.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           145-7]
 gi|312967623|ref|ZP_07781838.1| beta-ketoacyl synthase family protein [Escherichia coli 2362-75]
 gi|312973416|ref|ZP_07787588.1| beta-ketoacyl synthase family protein [Escherichia coli 1827-70]
 gi|331642965|ref|ZP_08344100.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           H736]
 gi|331647980|ref|ZP_08349072.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           M605]
 gi|331658497|ref|ZP_08359441.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA206]
 gi|331663841|ref|ZP_08364751.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA143]
 gi|331669023|ref|ZP_08369871.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA271]
 gi|331673825|ref|ZP_08374588.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA280]
 gi|331678270|ref|ZP_08378945.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           H591]
 gi|331683996|ref|ZP_08384592.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           H299]
 gi|332278525|ref|ZP_08390938.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella sp. D9]
 gi|71159320|sp|P0A954|FABB_ECOL6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 1; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase I;
           AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS I
 gi|71159321|sp|P0A953|FABB_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 1; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase I;
           AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS I
 gi|10120827|pdb|1FJ4|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Thiolactomycin, Implications
           For Drug Design
 gi|10120828|pdb|1FJ4|B Chain B, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Thiolactomycin, Implications
           For Drug Design
 gi|10120829|pdb|1FJ4|C Chain C, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Thiolactomycin, Implications
           For Drug Design
 gi|10120830|pdb|1FJ4|D Chain D, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Thiolactomycin, Implications
           For Drug Design
 gi|10120831|pdb|1FJ8|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Cerulenin, Implications For
           Drug Design
 gi|10120832|pdb|1FJ8|B Chain B, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Cerulenin, Implications For
           Drug Design
 gi|10120833|pdb|1FJ8|C Chain C, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Cerulenin, Implications For
           Drug Design
 gi|10120834|pdb|1FJ8|D Chain D, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I In Complex With Cerulenin, Implications For
           Drug Design
 gi|11513728|pdb|1G5X|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I
 gi|11513729|pdb|1G5X|B Chain B, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I
 gi|11513730|pdb|1G5X|C Chain C, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I
 gi|11513731|pdb|1G5X|D Chain D, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein]
           Synthase I
 gi|71042783|pdb|2BUH|A Chain A, E. Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I,
           120 K
 gi|71042784|pdb|2BUH|B Chain B, E. Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I,
           120 K
 gi|71042785|pdb|2BUH|C Chain C, E. Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I,
           120 K
 gi|71042786|pdb|2BUH|D Chain D, E. Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I,
           120 K
 gi|71042787|pdb|2BUI|A Chain A, E.Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I In
           Complex With Octanoic Acid, 120k
 gi|71042788|pdb|2BUI|B Chain B, E.Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I In
           Complex With Octanoic Acid, 120k
 gi|71042789|pdb|2BUI|C Chain C, E.Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I In
           Complex With Octanoic Acid, 120k
 gi|71042790|pdb|2BUI|D Chain D, E.Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I In
           Complex With Octanoic Acid, 120k
 gi|88192107|pdb|2AQ7|A Chain A, Structure-Activity Relationships At The 5-Posiiton Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherichia Coli
 gi|88192108|pdb|2AQ7|B Chain B, Structure-Activity Relationships At The 5-Posiiton Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherichia Coli
 gi|88192109|pdb|2AQ7|C Chain C, Structure-Activity Relationships At The 5-Posiiton Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherichia Coli
 gi|88192110|pdb|2AQ7|D Chain D, Structure-Activity Relationships At The 5-Posiiton Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherichia Coli
 gi|88192111|pdb|2AQB|A Chain A, Structure-Activity Relationships At The 5-Position Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherchia Coli
 gi|88192112|pdb|2AQB|B Chain B, Structure-Activity Relationships At The 5-Position Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherchia Coli
 gi|88192113|pdb|2AQB|C Chain C, Structure-Activity Relationships At The 5-Position Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherchia Coli
 gi|88192114|pdb|2AQB|D Chain D, Structure-Activity Relationships At The 5-Position Of
           Thiolactomycin: An Intact 5(R)-Isoprene Unit Is Required
           For Activity Against The Condensing Enzymes From
           Mycobacterium Tuberculosis And Escherchia Coli
 gi|163931069|pdb|2VB7|A Chain A, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure After Soak In Peg Solution
 gi|163931070|pdb|2VB7|B Chain B, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure After Soak In Peg Solution
 gi|163931072|pdb|2VB7|D Chain D, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure After Soak In Peg Solution
 gi|163931073|pdb|2VB8|A Chain A, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Inhibitor Thiolactomycin
 gi|163931074|pdb|2VB8|B Chain B, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Inhibitor Thiolactomycin
 gi|163931075|pdb|2VB8|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Inhibitor Thiolactomycin
 gi|163931076|pdb|2VB8|D Chain D, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Inhibitor Thiolactomycin
 gi|163931077|pdb|2VB9|A Chain A, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure
 gi|163931078|pdb|2VB9|B Chain B, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure
 gi|163931079|pdb|2VB9|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure
 gi|163931080|pdb|2VB9|D Chain D, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure
 gi|163931081|pdb|2VBA|A Chain A, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Amino-Thiazole Inhibitor
 gi|163931082|pdb|2VBA|B Chain B, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Amino-Thiazole Inhibitor
 gi|163931083|pdb|2VBA|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Amino-Thiazole Inhibitor
 gi|163931084|pdb|2VBA|D Chain D, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli With Bound
           Amino-Thiazole Inhibitor
 gi|26109117|gb|AAN81319.1|AE016764_1 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           CFT073]
 gi|145884|gb|AAC67304.1| beta-ketoacyl-ACP synthase I [Escherichia coli]
 gi|1788663|gb|AAC75383.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str.
           K-12 substr. MG1655]
 gi|1799716|dbj|BAA16180.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str.
           K12 substr. W3110]
 gi|81246215|gb|ABB66923.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella boydii Sb227]
 gi|91073194|gb|ABE08075.1| bifunctional beta-ketoacyl-ACP synthase I/malonyl-ACP decarboxylase
           [Escherichia coli UTI89]
 gi|110344119|gb|ABG70356.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli 536]
 gi|115513637|gb|ABJ01712.1| 3-oxoacyl-(acyl carrier protein) synthase [Escherichia coli APEC
           O1]
 gi|157067491|gb|ABV06746.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli HS]
 gi|169754296|gb|ACA76995.1| Beta-ketoacyl synthase [Escherichia coli ATCC 8739]
 gi|169889774|gb|ACB03481.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170521659|gb|ACB19837.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           SMS-3-5]
 gi|188487121|gb|EDU62224.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           53638]
 gi|190904477|gb|EDV64185.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli B7A]
 gi|190909538|gb|EDV69123.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli F11]
 gi|192932075|gb|EDV84674.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli E22]
 gi|192956947|gb|EDV87399.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           E110019]
 gi|194413359|gb|EDX29643.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli B171]
 gi|194424993|gb|EDX40978.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           101-1]
 gi|195183114|dbj|BAG66674.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O111:H-]
 gi|209913082|dbj|BAG78156.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli SE11]
 gi|215265608|emb|CAS10011.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218352654|emb|CAU98435.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           55989]
 gi|218361646|emb|CAQ99242.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli IAI1]
 gi|218366005|emb|CAR03749.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli S88]
 gi|218370785|emb|CAR18598.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           IAI39]
 gi|218428047|emb|CAR08966.2| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli ED1a]
 gi|218432950|emb|CAR13844.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           UMN026]
 gi|222034079|emb|CAP76820.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli LF82]
 gi|226901169|gb|EEH87428.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia sp.
           3_2_53FAA]
 gi|227835733|gb|EEJ46199.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           83972]
 gi|238859829|gb|ACR61827.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           BW2952]
 gi|242377956|emb|CAQ32725.1| KASI [Escherichia coli BL21(DE3)]
 gi|253323797|gb|ACT28399.1| Beta-ketoacyl synthase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974233|gb|ACT39904.1| 3-oxoacyl-(acyl carrier protein) synthase [Escherichia coli B str.
           REL606]
 gi|253978400|gb|ACT44070.1| 3-oxoacyl-(acyl carrier protein) synthase [Escherichia coli
           BL21(DE3)]
 gi|257755016|dbj|BAI26518.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O26:H11 str. 11368]
 gi|257760057|dbj|BAI31554.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O103:H2 str. 12009]
 gi|257765401|dbj|BAI36896.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O111:H- str. 11128]
 gi|260448583|gb|ACX39005.1| Beta-ketoacyl synthase [Escherichia coli DH1]
 gi|262176863|gb|ACY27486.1| 3-oxoacyl-acyl-carrier-protein synthase I [Escherichia coli
           LW1655F+]
 gi|281179410|dbj|BAI55740.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli SE15]
 gi|284922311|emb|CBG35396.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli 042]
 gi|291323490|gb|EFE62918.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli B088]
 gi|291427997|gb|EFF01024.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           FVEC1412]
 gi|291471148|gb|EFF13632.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli B354]
 gi|294491558|gb|ADE90314.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           IHE3034]
 gi|298278914|gb|EFI20428.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           FVEC1302]
 gi|299880806|gb|EFI89017.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           196-1]
 gi|300299129|gb|EFJ55514.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           185-1]
 gi|300306353|gb|EFJ60873.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           200-1]
 gi|300316757|gb|EFJ66541.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           175-1]
 gi|300359187|gb|EFJ75057.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           198-1]
 gi|300396700|gb|EFJ80238.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           69-1]
 gi|300408509|gb|EFJ92047.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           45-1]
 gi|300421563|gb|EFK04874.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           182-1]
 gi|300451937|gb|EFK15557.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           116-1]
 gi|300458014|gb|EFK21507.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           21-1]
 gi|300525329|gb|EFK46398.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           119-7]
 gi|300529215|gb|EFK50277.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           107-1]
 gi|300844778|gb|EFK72538.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           78-1]
 gi|301074263|gb|EFK89069.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           146-1]
 gi|305851959|gb|EFM52411.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           NC101]
 gi|306908622|gb|EFN39119.1| Beta-ketoacyl synthase [Escherichia coli W]
 gi|307554385|gb|ADN47160.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli ABU
           83972]
 gi|307626140|gb|ADN70444.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           UM146]
 gi|308123493|gb|EFO60755.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           145-7]
 gi|309702635|emb|CBJ01964.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli ETEC
           H10407]
 gi|310332011|gb|EFP99246.1| beta-ketoacyl synthase family protein [Escherichia coli 1827-70]
 gi|312287820|gb|EFR15725.1| beta-ketoacyl synthase family protein [Escherichia coli 2362-75]
 gi|312946942|gb|ADR27769.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315061616|gb|ADT75943.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli W]
 gi|315136958|dbj|BAJ44117.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli DH1]
 gi|315288298|gb|EFU47697.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           110-3]
 gi|315292270|gb|EFU51622.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           153-1]
 gi|315298141|gb|EFU57405.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           16-3]
 gi|315615592|gb|EFU96224.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           3431]
 gi|320174680|gb|EFW49813.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Shigella
           dysenteriae CDC 74-1112]
 gi|320183780|gb|EFW58614.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Shigella flexneri
           CDC 796-83]
 gi|320199914|gb|EFW74503.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Escherichia coli
           EC4100B]
 gi|323156475|gb|EFZ42630.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           EPECa14]
 gi|323162209|gb|EFZ48070.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           E128010]
 gi|323176751|gb|EFZ62341.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           1180]
 gi|323184357|gb|EFZ69733.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           1357]
 gi|323187952|gb|EFZ73247.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           RN587/1]
 gi|323377803|gb|ADX50071.1| Beta-ketoacyl synthase [Escherichia coli KO11]
 gi|323936613|gb|EGB32900.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           E1520]
 gi|323940980|gb|EGB37167.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           E482]
 gi|323944836|gb|EGB40902.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           H120]
 gi|323952116|gb|EGB47990.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           H252]
 gi|323955894|gb|EGB51648.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           H263]
 gi|323961396|gb|EGB57007.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           H489]
 gi|323970960|gb|EGB66211.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           TA007]
 gi|324009244|gb|EGB78463.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           57-2]
 gi|324015387|gb|EGB84606.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           60-1]
 gi|324020846|gb|EGB90065.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           117-3]
 gi|324117799|gb|EGC11698.1| beta-ketoacyl synthase domain-containing protein [Escherichia coli
           E1167]
 gi|330912144|gb|EGH40654.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Escherichia coli
           AA86]
 gi|331039763|gb|EGI11983.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           H736]
 gi|331043704|gb|EGI15842.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           M605]
 gi|331054162|gb|EGI26189.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA206]
 gi|331059640|gb|EGI31617.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA143]
 gi|331064217|gb|EGI36128.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA271]
 gi|331069098|gb|EGI40490.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           TA280]
 gi|331074730|gb|EGI46050.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           H591]
 gi|331078948|gb|EGI50150.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           H299]
 gi|332093457|gb|EGI98515.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella boydii
           3594-74]
 gi|332100877|gb|EGJ04223.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella sp. D9]
          Length = 406

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|308187635|ref|YP_003931766.1| 3-oxoacyl-ACP synthase [Pantoea vagans C9-1]
 gi|308058145|gb|ADO10317.1| 3-oxoacyl-ACP synthase [Pantoea vagans C9-1]
          Length = 406

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLSSLREGRSGITFSEEMKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M+EAI DS L      ++ R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEEAIKDSGLTTEMYQSNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTRYNDTPEKASRTYDNERDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N PYI +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNTPYISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I  +D    G+ IV   ++  ++ TV+SNSFGFGGTNATL  R+Y+
Sbjct: 361 ITSLDAAATGMNIVTAPMEK-ELTTVMSNSFGFGGTNATLTMRKYQ 405


>gi|187730069|ref|YP_001881145.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella boydii CDC
           3083-94]
 gi|187427061|gb|ACD06335.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Shigella boydii CDC
           3083-94]
          Length = 406

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADTGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|269139766|ref|YP_003296467.1| beta-ketoacyl synthase [Edwardsiella tarda EIB202]
 gi|267985427|gb|ACY85256.1| beta-ketoacyl synthase [Edwardsiella tarda EIB202]
 gi|304559632|gb|ADM42296.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Edwardsiella tarda
           FL6-60]
          Length = 395

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/397 (58%), Positives = 290/397 (73%), Gaps = 2/397 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGIVSSIGNN  EV  SL+E RSGITF+ +  + G R QVWG   L+ A LIDRK MRF+
Sbjct: 1   MGIVSSIGNNQQEVLASLKEGRSGITFAPELQEAGMRSQVWGNIKLDTAGLIDRKVMRFM 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
           S    +  L+MQEAI DS L    +++ RTGLI GSGG S +  V+ AD  R     R +
Sbjct: 61  SDASIYAFLSMQEAIKDSGLSDDMVSNNRTGLIVGSGGGSPRNQVAGADGMRAR-GIRGV 119

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIGNA E+IQ GKQD++FAGG
Sbjct: 120 GPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGNAVEMIQLGKQDVVFAGG 179

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E++ W ++  FDAMGA+S+H+N  P  ASR YD++RDGFVISGG  ++V+EE+E A AR
Sbjct: 180 GEEMCWELACEFDAMGALSTHYNDTPEKASRTYDAKRDGFVISGGGGIVVVEELEHALAR 239

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GA IYAE+ GYG+T DG DMV+PSGEGA RCM  A+  +++PVDY+N HGT+T  GD KE
Sbjct: 240 GAHIYAEIVGYGATSDGYDMVAPSGEGAARCMHMAMQGLDKPVDYLNVHGTSTMVGDVKE 299

Query: 309 VEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK 368
           + AIREVF  + P I STK++TGH+LGAAG  EAIY L+M++  FI  S NIEE+D +  
Sbjct: 300 LGAIREVFGDHTPAISSTKAMTGHALGAAGVHEAIYTLLMLEHGFIAPSINIEELDEQAA 359

Query: 369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           G+ IV    +   +D V+SNSFGFGGTNATLV R+YK
Sbjct: 360 GMDIVTATTER-DLDVVMSNSFGFGGTNATLVMRKYK 395


>gi|237732356|ref|ZP_04562837.1| 3-oxoacyl-(acyl carrier protein) synthase I [Citrobacter sp. 30_2]
 gi|226907895|gb|EEH93813.1| 3-oxoacyl-(acyl carrier protein) synthase I [Citrobacter sp. 30_2]
          Length = 406

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 293/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++A+ D+ L   +  +  R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAVADAGLAAEDYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDAPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV K  + A + TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTKPTEQA-LTTVMSNSFGFGGTNATLVMRKLK 405


>gi|260431183|ref|ZP_05785154.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415011|gb|EEX08270.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 409

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/409 (55%), Positives = 298/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+G+VSSIGNN  EV  SL+  +SGI  +   A+ GFR QV G   ++ AE +
Sbjct: 1   MRRVVVTGLGVVSSIGNNAEEVLASLKAGKSGIEANAQMAEHGFRSQVAGTLKIDVAEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ + RTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMSQAIADAGLTEDQVVNPRTGLVAGSGGPSTSAMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK M ST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMCSTVSANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+TGY +T DG DMV+PSGEG  R MR AL ++ E   V YIN HG
Sbjct: 241 DLDHALARGAKIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALQNLPEDRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R +F +G++P I STKS+TGH+ GAAGA EAI+CL+M++  FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRIFGEGSVPPISSTKSMTGHAQGAAGALEAIFCLLMLEHDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +    +   I  K ++NA +D+V++NSFGFGGTN ++V  R+ G
Sbjct: 361 INVDTLAEGIQPGEIATKVVENAGLDSVMTNSFGFGGTNGSMVLSRFNG 409


>gi|119478095|ref|ZP_01618174.1| 3-oxoacyl-(acyl carrier protein) synthase [marine gamma
           proteobacterium HTCC2143]
 gi|119448801|gb|EAW30044.1| 3-oxoacyl-(acyl carrier protein) synthase [marine gamma
           proteobacterium HTCC2143]
          Length = 405

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/404 (55%), Positives = 295/404 (73%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI S IG + + V  SL+   SGI F ED+ + G R  V G   ++  + I
Sbjct: 1   MKRAVITGLGIASCIGTDTTSVLESLKAGTSGIRFREDYKEIGLRSHVAGTIDIDFKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           +RK +RF+     +  ++MQ+AI D+ L   ++++ R+G+IAGSGG S+  ++ +AD+ R
Sbjct: 61  ERKQLRFMGDAAGYAFISMQQAIEDAGLSEEQVSNVRSGIIAGSGGASSANLIESADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 AK-GVKRIGPYRVTQTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNALELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W++S LFDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIIFAGGGEEEHWSLSCLFDAMGALSTKYNDTPEQASRAYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA+RCM QAL++VE P+DYIN+HGT+
Sbjct: 240 ELEHALARGAKIYAEVVGYGATSDGYDMVAPSGEGAVRCMAQALATVEGPLDYINSHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD +E++AI   F  N P I STKSLTGHSLGA G QEAIY L+MM+  F+  S NI
Sbjct: 300 TPAGDIQELKAIVSAFGDNSPMISSTKSLTGHSLGATGVQEAIYSLLMMENNFVCASANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +DPE   + IVR+R DN  I   +SNSFGFGGTNA+LVF++Y
Sbjct: 360 ENLDPEAASLNIVRERQDNVNIQRAMSNSFGFGGTNASLVFQKY 403


>gi|15832461|ref|NP_311234.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H7 str. Sakai]
 gi|74312840|ref|YP_311259.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella sonnei Ss046]
 gi|157156872|ref|YP_001463668.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           E24377A]
 gi|168748179|ref|ZP_02773201.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4113]
 gi|168755082|ref|ZP_02780089.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4401]
 gi|168761232|ref|ZP_02786239.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4501]
 gi|168767956|ref|ZP_02792963.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4486]
 gi|168772944|ref|ZP_02797951.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4196]
 gi|168780185|ref|ZP_02805192.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4076]
 gi|168787237|ref|ZP_02812244.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC869]
 gi|168798500|ref|ZP_02823507.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC508]
 gi|194432954|ref|ZP_03065238.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Shigella dysenteriae
           1012]
 gi|195935703|ref|ZP_03081085.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807366|ref|ZP_03249703.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4206]
 gi|208814200|ref|ZP_03255529.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4045]
 gi|208821906|ref|ZP_03262226.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4042]
 gi|209399153|ref|YP_002271733.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4115]
 gi|217327469|ref|ZP_03443552.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. TW14588]
 gi|254794216|ref|YP_003079053.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H7 str. TW14359]
 gi|261223222|ref|ZP_05937503.1| Beta-ketoacyl-ACP synthase I [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259228|ref|ZP_05951761.1| Beta-ketoacyl-ACP synthase I [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283564|ref|YP_003500382.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O55:H7 str. CB9615]
 gi|300903715|ref|ZP_07121630.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           84-1]
 gi|300918504|ref|ZP_07135097.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           115-1]
 gi|300928495|ref|ZP_07144021.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           187-1]
 gi|301303214|ref|ZP_07209339.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           124-1]
 gi|331653768|ref|ZP_08354769.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           M718]
 gi|13362677|dbj|BAB36630.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O157:H7 str. Sakai]
 gi|73856317|gb|AAZ89024.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella sonnei Ss046]
 gi|157078902|gb|ABV18610.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           E24377A]
 gi|187771112|gb|EDU34956.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4196]
 gi|188017300|gb|EDU55422.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4113]
 gi|189001960|gb|EDU70946.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4076]
 gi|189357728|gb|EDU76147.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4401]
 gi|189362822|gb|EDU81241.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4486]
 gi|189368339|gb|EDU86755.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4501]
 gi|189372932|gb|EDU91348.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC869]
 gi|189378974|gb|EDU97390.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC508]
 gi|194418942|gb|EDX35027.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Shigella dysenteriae
           1012]
 gi|208727167|gb|EDZ76768.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4206]
 gi|208735477|gb|EDZ84164.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4045]
 gi|208742029|gb|EDZ89711.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160553|gb|ACI37986.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. EC4115]
 gi|209764748|gb|ACI80686.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209764750|gb|ACI80687.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209764752|gb|ACI80688.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209764754|gb|ACI80689.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209764756|gb|ACI80690.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|217319836|gb|EEC28261.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O157:H7 str. TW14588]
 gi|254593616|gb|ACT72977.1| Beta-ketoacyl-ACP synthase I [Escherichia coli O157:H7 str.
           TW14359]
 gi|290763437|gb|ADD57398.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli
           O55:H7 str. CB9615]
 gi|300404297|gb|EFJ87835.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           84-1]
 gi|300414318|gb|EFJ97628.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           115-1]
 gi|300463490|gb|EFK26983.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           187-1]
 gi|300841388|gb|EFK69148.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           124-1]
 gi|315255261|gb|EFU35229.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli MS
           85-1]
 gi|320178702|gb|EFW53665.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Shigella boydii
           ATCC 9905]
 gi|320192053|gb|EFW66698.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Escherichia coli
           O157:H7 str. EC1212]
 gi|320196192|gb|EFW70816.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Escherichia coli
           WV_060327]
 gi|320641151|gb|EFX10630.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H7 str. G5101]
 gi|320646367|gb|EFX15290.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H- str. 493-89]
 gi|320651637|gb|EFX20017.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H- str. H 2687]
 gi|320657388|gb|EFX25190.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320662923|gb|EFX30247.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320667667|gb|EFX34578.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323168504|gb|EFZ54184.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella sonnei
           53G]
 gi|324112860|gb|EGC06836.1| beta-ketoacyl synthase domain-containing protein [Escherichia
           fergusonii B253]
 gi|325496637|gb|EGC94496.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia fergusonii
           ECD227]
 gi|326339676|gb|EGD63487.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Escherichia coli
           O157:H7 str. 1125]
 gi|326344138|gb|EGD67899.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Escherichia coli
           O157:H7 str. 1044]
 gi|331048617|gb|EGI20693.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1
           (3-oxoacyl-[acyl-carrier-protein] synthase I)
           (Beta-ketoacyl-ACP synthase I) (KASI) [Escherichia coli
           M718]
          Length = 406

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|242240003|ref|YP_002988184.1| beta-ketoacyl synthase [Dickeya dadantii Ech703]
 gi|242132060|gb|ACS86362.1| Beta-ketoacyl synthase [Dickeya dadantii Ech703]
          Length = 405

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 295/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGNN  EV  SLRE RSGITFSE+  + G R  VWG   L+ A LI
Sbjct: 1   MKRAVITGLGILSSIGNNKEEVLASLREGRSGITFSEELKESGMRSHVWGNVKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAADLT 119
           +RK +RF+S    + +L+M+EAI DS L   +  H  R GLIAGSGG S +  V  AD  
Sbjct: 61  ERKVVRFMSDASIYAYLSMEEAIKDSGLSEEQYQHNPRVGLIAGSGG-SARSQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM S  SA L+T FKI+G +YSISSAC+TSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKAMGSAVSACLATPFKIQGVNYSISSACSTSAHCIGNAVEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELCWELACEFDAMGALSTKYNETPARASRTYDADRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+QAL  V+ P+DYINTHGT
Sbjct: 240 EELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMKQALQGVDTPIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIR+VF   IP I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELWAIRQVFGDKIPPISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I+ +D + + + IV +  +  K+ TV+SN FGFGGTNA LV R+Y+
Sbjct: 360 IDTLDEQAQNMNIVTETTER-KLTTVMSNGFGFGGTNAVLVMRKYQ 404


>gi|319897153|ref|YP_004135348.1| 3-oxoacyl-[acyl-carrier-protein] synthase i [Haemophilus influenzae
           F3031]
 gi|317432657|emb|CBY81020.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus influenzae
           F3031]
          Length = 406

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/406 (55%), Positives = 293/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA ++TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLETVMSNSFGFGGTNATLIFKRYNG 406


>gi|78101712|pdb|2BYW|A Chain A, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier
           Protein) Synthase I Lys328ala Mutant
 gi|78101713|pdb|2BYW|B Chain B, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier
           Protein) Synthase I Lys328ala Mutant
 gi|78101714|pdb|2BYW|C Chain C, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier
           Protein) Synthase I Lys328ala Mutant
 gi|78101715|pdb|2BYW|D Chain D, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier
           Protein) Synthase I Lys328ala Mutant
 gi|90108908|pdb|2BYX|A Chain A, Kas I Lys328ala Mutant In Complex With Fatty Acid
 gi|90108909|pdb|2BYX|B Chain B, Kas I Lys328ala Mutant In Complex With Fatty Acid
 gi|90108910|pdb|2BYX|C Chain C, Kas I Lys328ala Mutant In Complex With Fatty Acid
 gi|90108911|pdb|2BYX|D Chain D, Kas I Lys328ala Mutant In Complex With Fatty Acid
          Length = 418

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 13  MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 72

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 73  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 132

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 133 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 192

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 193 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 252

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 253 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 312

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +T ++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 313 STPVGDVKELAAIREVFGDKSPAISATAAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 372

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 373 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 417


>gi|145631954|ref|ZP_01787708.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           R3021]
 gi|145632924|ref|ZP_01788657.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           3655]
 gi|229844207|ref|ZP_04464348.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           6P18H1]
 gi|260583326|ref|ZP_05851100.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Haemophilus influenzae
           NT127]
 gi|319776387|ref|YP_004138875.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus influenzae
           F3047]
 gi|329123552|ref|ZP_08252115.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Haemophilus aegyptius
           ATCC 11116]
 gi|144982405|gb|EDJ89979.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           R3021]
 gi|144986580|gb|EDJ93146.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           3655]
 gi|229813201|gb|EEP48889.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           6P18H1]
 gi|260093639|gb|EEW77553.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Haemophilus influenzae
           NT127]
 gi|301170273|emb|CBW29878.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus influenzae
           10810]
 gi|317450978|emb|CBY87207.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus influenzae
           F3047]
 gi|327470368|gb|EGF15826.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Haemophilus aegyptius
           ATCC 11116]
          Length = 406

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 292/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|301156088|emb|CBW15559.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Haemophilus
           parainfluenzae T3T1]
          Length = 406

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 294/406 (72%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   L+ +E I
Sbjct: 1   MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFIEMKMRSHVAGTIKLDPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMREAIEDSGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDTPEKASRAYDADRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLHNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E++D   +G  IV +  +NA + TV+SNSFGFGGTNATLVF+RYKG
Sbjct: 361 EKLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRYKG 406


>gi|157144735|ref|YP_001452054.1| 3-oxoacyl-(acyl carrier protein) synthase I [Citrobacter koseri
           ATCC BAA-895]
 gi|157081940|gb|ABV11618.1| hypothetical protein CKO_00462 [Citrobacter koseri ATCC BAA-895]
          Length = 406

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 293/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQ-PCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++AI D+ L       + R GLIAGSGG S K  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAIADAGLSVETYQNNPRVGLIAGSGGGSPKFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N+DP  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNNDPSKASRTYDANRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+  +DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTLIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEEMDEQAAGLNIVTEATDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|145634898|ref|ZP_01790605.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittAA]
 gi|145267764|gb|EDK07761.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittAA]
          Length = 406

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 292/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDIVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|294664553|ref|ZP_06729897.1| beta-ketoacyl-ACP synthase I [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292605687|gb|EFF48994.1| beta-ketoacyl-ACP synthase I [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 402

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 298/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGM I S +GN++  V+ +LRE+RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGMSITSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVALDLDNLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L   +++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAEQVSGLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S+ SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSSVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMQGLQRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK L+GHSLGAA   EAIY L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAIYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R+  D A ++TV+SNSFGFGGTNATLVF R
Sbjct: 360 DELDPRAEGFPILRQTQD-ATLNTVMSNSFGFGGTNATLVFGR 401


>gi|332344107|gb|AEE57441.1| beta-ketoacyl synthase, C-terminal domain protein [Escherichia coli
           UMNK88]
          Length = 406

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDIPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|149377609|ref|ZP_01895347.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Marinobacter algicola
           DG893]
 gi|149358082|gb|EDM46566.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Marinobacter algicola
           DG893]
          Length = 402

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 302/401 (75%), Gaps = 2/401 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVS +GN+   V  SL+  +SGI F+E +   GFR QV G   ++ + +I
Sbjct: 1   MRRVVVTGMGIVSCLGNSTDAVLESLKAGKSGIRFNETYRDMGFRSQVAGSVDVDTS-VI 59

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+ Q   + +LAM++AI  +RL    ++++RTGLIAGSGG S+   V A D+ R
Sbjct: 60  DRKTRRFMGQSAMYSYLAMEQAIASARLTDDLVSNDRTGLIAGSGGASSASQVEAVDIMR 119

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ VP+ M+ST SA L+T FKIRG +YS+SSACATSAHCIG+AAE IQSGK
Sbjct: 120 EK-GVKRIGPYMVPRIMTSTVSACLATAFKIRGVNYSMSSACATSAHCIGHAAEQIQSGK 178

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+ DW+++ LFDAMGA+S+ +N  P +ASRP+D+ RDGFVI+GG  ++V+E
Sbjct: 179 QDIVFAGGGEEEDWSLTMLFDAMGALSTKYNDAPETASRPFDAGRDGFVIAGGGGMVVME 238

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A  RGA I AELTGYG+T DG DMV+PSGEGA+RCM+QAL++VE PVDYIN HGT+
Sbjct: 239 ELEHALKRGAPIIAELTGYGATSDGHDMVAPSGEGAMRCMQQALATVEAPVDYINAHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A+R VF  N+P I STKSL+GHSLGA+G  EAIY LIM+Q  FI  +KN+
Sbjct: 299 TPVGDVAEMKAVRNVFGNNVPQISSTKSLSGHSLGASGVHEAIYSLIMLQNGFIAGTKNL 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVF 401
             +D    G+P+V      A ++TV+SNSFGFGGTNA+LVF
Sbjct: 359 TNLDDTISGMPVVGPDSKTAPLNTVMSNSFGFGGTNASLVF 399


>gi|82777734|ref|YP_404083.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella dysenteriae
           Sd197]
 gi|309784967|ref|ZP_07679600.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           dysenteriae 1617]
 gi|81241882|gb|ABB62592.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella dysenteriae
           Sd197]
 gi|308927337|gb|EFP72811.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           dysenteriae 1617]
          Length = 406

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDSSIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|315127210|ref|YP_004069213.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas sp.
           SM9913]
 gi|315015724|gb|ADT69062.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pseudoalteromonas sp.
           SM9913]
          Length = 403

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 307/406 (75%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+G+VSSIGNN  EV  SLR  +SGI F+++FA +  R  V GK  ++  E +
Sbjct: 1   MRRAVITGIGVVSSIGNNKEEVLESLRAGKSGIAFNQEFADYKLRSNVSGKIDIDVKEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + +++M +AI D+ L   ++++ERTGL+ GSGG S+K  V AAD+ R
Sbjct: 61  DRKAMRFMGDAAAYSYISMAQAIEDAGLSDEQVSNERTGLLVGSGGGSSKWQVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKI+G +YSISSACATSAHCIG+A E IQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTTSACLATPFKIKGVNYSISSACATSAHCIGHAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L WT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVIS G  ++V+E
Sbjct: 180 QDVIFAGGGEELHWTLAMEFDAMGALSTKYNDTPEKASRTYDANRDGFVISAGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+TGYG+T DG DMV+PSGEGA+RCMRQA+ +V + +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEITGYGATSDGYDMVAPSGEGAVRCMRQAMQNV-DSIDYLNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAI+ L+M++  F+  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPMISATKAMTGHALGAAGVHEAIFSLLMLEHGFVAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+D +  G+ IV +  D  +++TV+SNSFGFGGTNATLV  +YKG
Sbjct: 359 DELDEQAAGLNIVTEAKD-VELNTVMSNSFGFGGTNATLVMSKYKG 403


>gi|16273433|ref|NP_439682.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           Rd KW20]
 gi|148826808|ref|YP_001291561.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittGG]
 gi|260580316|ref|ZP_05848145.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Haemophilus influenzae
           RdAW]
 gi|1169589|sp|P43710|FABB_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 1; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase I;
           AltName: Full=Beta-ketoacyl-ACP synthase I; Short=KAS I
 gi|1574377|gb|AAC23183.1| beta-ketoacyl-ACP synthase I (fabB) [Haemophilus influenzae Rd
           KW20]
 gi|148718050|gb|ABQ99177.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittGG]
 gi|260092993|gb|EEW76927.1| 3-oxoacyl-[acyl-carrier-protein] synthase 2 [Haemophilus influenzae
           RdAW]
          Length = 406

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/406 (55%), Positives = 292/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|333001468|gb|EGK21036.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri VA-6]
          Length = 406

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNIKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAYIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|3805908|emb|CAA09934.1| beta-ketoacyl-ACP synthase I [Escherichia coli]
          Length = 406

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK +TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKVMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|47168330|pdb|1H4F|A Chain A, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I
           K328r
 gi|47168331|pdb|1H4F|B Chain B, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I
           K328r
 gi|47168332|pdb|1H4F|C Chain C, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I
           K328r
 gi|47168333|pdb|1H4F|D Chain D, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I
           K328r
          Length = 406

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +T+++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATRAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|333002693|gb|EGK22253.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri K-272]
 gi|333016576|gb|EGK35906.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri K-227]
          Length = 406

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNIKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLTTPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAYIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|84515213|ref|ZP_01002575.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Loktanella vestfoldensis
           SKA53]
 gi|84510496|gb|EAQ06951.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Loktanella vestfoldensis
           SKA53]
          Length = 409

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/409 (55%), Positives = 298/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  +L+   SGI  S + A+ GFR +V G   ++ A+ +
Sbjct: 1   MRRVVITGLGIVSPIGNNTTEVTAALKAGTSGIVASAEMAEHGFRSRVAGTLKIDVADHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   +I +  TGLIAGSGGPST  + +A ++  
Sbjct: 61  DKRTLRFMGPGAAYAHIAMGQAIADAGLTQDQIVNPMTGLIAGSGGPSTSAMFAAHNVVT 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  +T+RIGPFAVPK MSST SA L+T  +I+G ++SI+SAC+TS HCIG AA+ +  G 
Sbjct: 121 ETGATKRIGPFAVPKCMSSTISANLATAHQIKGMNFSITSACSTSLHCIGMAAQQVALGT 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI+GG A++VLE
Sbjct: 181 QDIMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDAGRDGFVIAGGGAIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE--EPVDYINTHG 298
            +E A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++     + YIN HG
Sbjct: 241 SLEGALARGAKIYAEVTGFAATSDGADMVAPSGEGGERAMRGALRTLPAGRKISYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G+ P I STKS+TGHS GA GAQEAIYCL+M+Q+ FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGRGSTPPISSTKSMTGHSQGATGAQEAIYCLLMLQDDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      I   R+DNA +DTV++NSFGFGGTN +++  +Y+G
Sbjct: 361 INVETLDPALDPAEIAMVRVDNAGLDTVMTNSFGFGGTNGSMLLSKYQG 409


>gi|319788067|ref|YP_004147542.1| beta-ketoacyl synthase [Pseudoxanthomonas suwonensis 11-1]
 gi|317466579|gb|ADV28311.1| Beta-ketoacyl synthase [Pseudoxanthomonas suwonensis 11-1]
          Length = 403

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/404 (56%), Positives = 298/404 (73%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRVA+TGMGI S +GN++  V+ +LRE R+GI    D A+ G R QV G   L+   +I
Sbjct: 1   MRRVAITGMGIASCLGNDLDTVSAALREGRAGIRHLPDAAEHGLRSQVGGAVDLDLDAVI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + ++++++A+ D+ L    ++H RTGL+AGSGG S+   V  ADL R
Sbjct: 61  DRKLKRFMSDAAAYSYVSLRDAVADAGLDEALVSHPRTGLVAGSGGGSSHWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M ST SA L+T F+I+G SYSIS+ACATSAHCIG AA+LI+ G 
Sbjct: 121 AK-GVRKVGPYMVPRTMCSTVSANLATAFRIKGVSYSISAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG EDLDWTMS +FDAMGA+SS +N  P  ASRPYD+ RDGFVI+GG  ++VLE
Sbjct: 180 QDIVFAGGGEDLDWTMSVMFDAMGALSSSYNETPEKASRPYDAGRDGFVIAGGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV-EEPVDYINTHGT 299
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+ ++    VDY+NTHGT
Sbjct: 240 DWDHAVARGARIHAELVGYGVTSDGADMVAPSGEGAVRCMHMAMENLGGRKVDYLNTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD  E+ A+REVF  ++P I STK+L+GHSLGAA   EAIY L+MM++ FI  S N
Sbjct: 300 STPLGDIVELNAVREVFGDDLPPISSTKALSGHSLGAASVHEAIYSLLMMRDGFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +DP+ +G PI R+  D A++D V+SNSFGFGGTNATLVF R
Sbjct: 360 IETLDPKAEGFPIARESRD-AQLDVVMSNSFGFGGTNATLVFAR 402


>gi|309973206|gb|ADO96407.1| 3-oxoacyl-(acyl carrier protein) synthase [Haemophilus influenzae
           R2846]
          Length = 406

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/406 (55%), Positives = 292/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|254483420|ref|ZP_05096649.1| Beta-ketoacyl synthase, N-terminal domain protein [marine gamma
           proteobacterium HTCC2148]
 gi|214036294|gb|EEB76972.1| Beta-ketoacyl synthase, N-terminal domain protein [marine gamma
           proteobacterium HTCC2148]
          Length = 408

 Score =  464 bits (1195), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 305/404 (75%), Gaps = 3/404 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           RRV VTG+GIVS +GN+   V +SL    SGI+  ++    G R  V G P ++ A LID
Sbjct: 3   RRVVVTGLGIVSCLGNDAETVTLSLYNGTSGISARQEHIDMGMRSHVAGSPNIDTASLID 62

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     + +++MQ+AI DS L+  ++++ RTG+IAGSGG S+     AAD+ R+
Sbjct: 63  RKQLRFMGDAAAYAYISMQQAIEDSGLEESDVSNVRTGIIAGSGGASSASQTQAADILRD 122

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + M ST SA L+T FKI+G +YSISSAC+TSAHCIGNA E IQ  KQ
Sbjct: 123 R-GLRRVGPYRVTQTMGSTVSACLATPFKIKGVNYSISSACSTSAHCIGNAMEQIQLNKQ 181

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           DI+FAGG E+L WT+S+LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++VLEE
Sbjct: 182 DIVFAGGGEELHWTLSSLFDAMGALSTKYNDTPQRASRAYDADRDGFVIAGGGGMLVLEE 241

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E AKARGAKIYAEL GYG+T DG DMVSPSGEGA+RCM+QAL++V+  VDYIN HGT+T
Sbjct: 242 LEHAKARGAKIYAELVGYGATSDGYDMVSPSGEGAVRCMQQALATVDGAVDYINAHGTST 301

Query: 302 PKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           P GD +E++A+++ +  +  IP + STKSL+GHSLGAAG QEAIY L+M Q+ FI  S N
Sbjct: 302 PAGDIQELKAVKDAYADSDRIPVVGSTKSLSGHSLGAAGVQEAIYSLLMQQKGFIAASAN 361

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I+ +DPE +G+PI R+R+DN  + TV+SNSFGFGGTNA+LVF++
Sbjct: 362 IDNLDPEAEGLPIARERVDNVDLRTVMSNSFGFGGTNASLVFQK 405


>gi|24113695|ref|NP_708205.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella flexneri 2a
           str. 301]
 gi|30063749|ref|NP_837920.1| 3-oxoacyl-(acyl carrier protein) synthase I [Shigella flexneri 2a
           str. 2457T]
 gi|24052764|gb|AAN43912.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella flexneri 2a
           str. 301]
 gi|30042004|gb|AAP17730.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella flexneri 2a
           str. 2457T]
 gi|281601764|gb|ADA74748.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Shigella flexneri
           2002017]
 gi|313651148|gb|EFS15547.1| beta-ketoacyl synthase family protein [Shigella flexneri 2a str.
           2457T]
 gi|332755373|gb|EGJ85737.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri K-671]
 gi|332756350|gb|EGJ86701.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri 2747-71]
 gi|332766143|gb|EGJ96353.1| fabB [Shigella flexneri 2930-71]
 gi|333002070|gb|EGK21636.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri K-218]
 gi|333016285|gb|EGK35616.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri K-304]
          Length = 413

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNIKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAYIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|332088455|gb|EGI93573.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella boydii
           5216-82]
          Length = 406

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I+E+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IDELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|325924735|ref|ZP_08186172.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Xanthomonas perforans
           91-118]
 gi|325544827|gb|EGD16173.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Xanthomonas perforans
           91-118]
          Length = 402

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 297/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE+RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGMGITSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVALDLDSLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L   ++   RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAEQVGGLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S+ SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSSVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMHGLQRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK L+GHSLGAA   EAIY L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAIYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R+  D A ++TV+SNSFGFGGTNA LVF R
Sbjct: 360 DELDPRAEGFPILRQTQD-ATLNTVMSNSFGFGGTNAALVFGR 401


>gi|86136009|ref|ZP_01054588.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp. MED193]
 gi|85826883|gb|EAQ47079.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Roseobacter sp. MED193]
          Length = 409

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/409 (55%), Positives = 296/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  +L+  +SGI  S +  + GFR QV G   ++  E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNTEEVIAALKAGKSGIVASPEMTEHGFRSQVAGTLKIDIKEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + H+AM +AI D+ L   ++ + RTGL+AGSGGPST  +++A  +  
Sbjct: 61  DKRALRFMGPGAAYAHIAMSQAIADAGLSEDQVVNTRTGLVAGSGGPSTSAMLTAHQVVA 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KTGATKRIGPFAVPKCMSSTISANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS  N DP +ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVMFAGGGEELDWTLSCLFDAMGAMSSKKNDDPEAASRAFDQDRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+ GY +T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 DLDHALARGAKIYAEVVGYAATSDGHDMVAPSGEGGERAMRLALSTLPESRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G  P I STKS+TGH+ GAAGA EAI+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGQTPPISSTKSMTGHAQGAAGALEAIFCLLMLDNDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +        I    ++NA +D V++NSFGFGGTN ++V  +YKG
Sbjct: 361 INVDTLAEGILPGEIATDLVENAGLDCVMTNSFGFGGTNGSMVLSKYKG 409


>gi|325921294|ref|ZP_08183154.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Xanthomonas gardneri
           ATCC 19865]
 gi|325548261|gb|EGD19255.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Xanthomonas gardneri
           ATCC 19865]
          Length = 402

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 297/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI S +GN++  V+ +LRE+RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVVTGMGINSCLGNDLDTVSTALRESRSGITALPDHAEAGLRSQVGGAVALDLDSLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L   +++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAEQVSALRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVIS G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVISSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+  + +P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMQGLSQPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK+L+GHSLGAA   EAIY L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNVPPLSSTKALSGHSLGAASVHEAIYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R+    A ++TV+SNSFGFGGTN  LVF R
Sbjct: 360 DELDPRAEGFPILRE-TREATLNTVMSNSFGFGGTNGALVFGR 401


>gi|300724029|ref|YP_003713344.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Xenorhabdus
           nematophila ATCC 19061]
 gi|297630561|emb|CBJ91226.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Xenorhabdus
           nematophila ATCC 19061]
          Length = 404

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 291/404 (72%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE F + G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQKEVLESLKEGRSGITFSEKFKEMGMRSHVWGDIKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +LAM EAI DS L    ++  RTGL+ G+GG S    V+ AD  R
Sbjct: 61  DRKIQRFMSDASVYAYLAMDEAIKDSGLSEEHVSDLRTGLVVGAGGGSPYYQVAGADGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AR-GLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W +S  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVIFAGGGEELSWELSCEFDAMGALSTKYNETPQQASRTYDQNRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+  DG DMV+PSGEGA+RCMR AL  +E  VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEIIGYGANSDGADMVAPSGEGAVRCMRMALDGIEGGVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIREVF  + P I +TK++TGHSLGAAGA EAIY L+M++   I  S NI
Sbjct: 300 TPIGDLKELEAIREVFGDDTPAISATKAMTGHSLGAAGAHEAIYSLLMLEHGIIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E++D +  G+ I+ +     ++ TV+SNSFGFGGTNA+LV R+Y
Sbjct: 360 EDLDEKAAGMNIITEPTKR-ELRTVMSNSFGFGGTNASLVMRKY 402


>gi|3805906|emb|CAA09933.1| beta-ketoacyl-ACP synthase I [Escherichia coli]
          Length = 406

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+   SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMAFGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|28883197|gb|AAO50078.1| fatty-acid synthase beta subunit [Pseudomonas syringae pv.
           phaseolicola]
          Length = 407

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/407 (57%), Positives = 292/407 (71%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS +GN+   V  +LR  R GI F+ ++A+ G R QV G   LN  ELI
Sbjct: 1   MRRVVITGLGIVSCLGNDKETVTANLRANRPGIRFNPEYAEMGLRSQVSGSIDLNLEELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AITDS L   ++++ RTGLIAGSGG ST   + A D  R
Sbjct: 61  DRKIFRFVGHAAAYAYLAMKDAITDSGLTEEQVSNVRTGLIAGSGGASTLNQMEALDTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ V + M ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYRVTRTMGSTVSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+  W+ S LFDAMGA+S+ +N  P  ASR YD++RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEEEHWSQSFLFDAMGALSTQYNETPEKASRAYDAKRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE-PVDYINTHGT 299
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  +    +DY     T
Sbjct: 240 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQMALGDINSGDIDYTTLIPT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           A   GD KE+E +REVF    P I STKSL+GHSLGAAG  EAIYCL+MM+  FI  S N
Sbjct: 300 APRVGDAKEMEGVREVFGAKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMENNFIAGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           I+E+DP    +PI+ K  ++AK+D V+SNSFGFGGTNATLV +R+ G
Sbjct: 360 IDELDPVVADMPILLKTREDAKLDLVMSNSFGFGGTNATLVLKRWAG 406


>gi|332534643|ref|ZP_08410475.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035923|gb|EGI72404.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 403

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 304/406 (74%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG+G+VSSIGNN  EV  SL+  +SGI F+++FA +  R  V GK  ++    +
Sbjct: 1   MRRAVITGIGVVSSIGNNKEEVLESLKTGKSGIAFNQEFADYKLRSNVSGKIDIDVKAHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRKAMRF+     + +++M +AI DS L   ++++ERTG+I GSGG S+K  V AAD+ R
Sbjct: 61  DRKAMRFMGDAAAYSYISMTQAIEDSGLSDDQVSNERTGIIVGSGGGSSKWQVEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ M+ST SA L+T FKI+G +YSISSACATSAHCIGNA E IQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMASTTSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L WT++  FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDVVFAGGGEELHWTLAMEFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCMRQA+  V + +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMRQAMQDV-DSIDYLNTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+EVF G  P I +TK++TGH+LGAAG  EAI+ L+M++  F+  S NI
Sbjct: 299 TPVGDVKELGAIQEVFGGKSPMISATKAMTGHALGAAGVHEAIFSLLMLEHSFVAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+D +  G+ I+ +R D  +++TV+SNSFGFGGTNATLV  +YKG
Sbjct: 359 DELDEQATGLDIITERRD-VELNTVMSNSFGFGGTNATLVMSKYKG 403


>gi|3805904|emb|CAA09932.1| beta-ketoacyl-ACP synthase I [Escherichia coli]
          Length = 406

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRTVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+H T
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHST 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|145637572|ref|ZP_01793229.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittHH]
 gi|145269258|gb|EDK09204.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           PittHH]
          Length = 406

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/406 (55%), Positives = 291/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRR  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   LN +E I
Sbjct: 1   MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA E IY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEVIYTLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 406


>gi|166713497|ref|ZP_02244704.1| beta-ketoacyl- synthase I [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 402

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/403 (56%), Positives = 294/403 (72%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGMGINSCLGNDLDTVSSALREGRSGITALPDHAEAGLRSQVGGAVALDLDSLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L    ++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAEHVSGLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           +   A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCMR A+  ++ P+DY+NTHGT+
Sbjct: 240 DYNHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMRMAIQGLDRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK L+GHSLGAA   EA+Y L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAVYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           EE+DP  +G PI+R+    A ++TV+SNSFGFGGTN TLVF R
Sbjct: 360 EELDPRAEGFPILRQ-TQEATLNTVMSNSFGFGGTNGTLVFGR 401


>gi|90108916|pdb|2BYZ|A Chain A, Structure Of E. Coli Kas I H298q Mutant In Complex With
           C12 Fatty Acid
 gi|90108917|pdb|2BYZ|B Chain B, Structure Of E. Coli Kas I H298q Mutant In Complex With
           C12 Fatty Acid
 gi|90108918|pdb|2BYZ|C Chain C, Structure Of E. Coli Kas I H298q Mutant In Complex With
           C12 Fatty Acid
 gi|90108919|pdb|2BYZ|D Chain D, Structure Of E. Coli Kas I H298q Mutant In Complex With
           C12 Fatty Acid
 gi|90108924|pdb|2BZ4|A Chain A, Structure Of E. Coli Kas I H298q Mutant
 gi|90108925|pdb|2BZ4|B Chain B, Structure Of E. Coli Kas I H298q Mutant
 gi|90108926|pdb|2BZ4|C Chain C, Structure Of E. Coli Kas I H298q Mutant
 gi|90108927|pdb|2BZ4|D Chain D, Structure Of E. Coli Kas I H298q Mutant
          Length = 418

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 13  MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 72

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 73  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 132

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 133 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 192

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 193 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 252

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+ GT
Sbjct: 253 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSQGT 312

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 313 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 372

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 373 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 417


>gi|90108912|pdb|2BYY|A Chain A, E. Coli Kas I H298e Mutation
 gi|90108913|pdb|2BYY|B Chain B, E. Coli Kas I H298e Mutation
 gi|90108914|pdb|2BYY|C Chain C, E. Coli Kas I H298e Mutation
 gi|90108915|pdb|2BYY|D Chain D, E. Coli Kas I H298e Mutation
 gi|90108920|pdb|2BZ3|A Chain A, Structure Of E. Coli Kas I H298e Mutant In Complex With
           C12 Fatty Acid
 gi|90108921|pdb|2BZ3|B Chain B, Structure Of E. Coli Kas I H298e Mutant In Complex With
           C12 Fatty Acid
 gi|90108922|pdb|2BZ3|C Chain C, Structure Of E. Coli Kas I H298e Mutant In Complex With
           C12 Fatty Acid
 gi|90108923|pdb|2BZ3|D Chain D, Structure Of E. Coli Kas I H298e Mutant In Complex With
           C12 Fatty Acid
          Length = 418

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 13  MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 72

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 73  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 132

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 133 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 192

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 193 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 252

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+ GT
Sbjct: 253 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSEGT 312

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 313 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 372

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 373 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 417


>gi|325578186|ref|ZP_08148321.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325159922|gb|EGC72051.1| 3-oxoacyl-(acyl-carrier-protein) synthase II [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 406

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 292/406 (71%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG GI+SSIGNN  EV  SL+  +SGI    +F +   R  V G   L+ +E I
Sbjct: 1   MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFIEMKMRSHVAGTIKLDPSEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMREAIEDSGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAVELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNDTPEKASRAYDADRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF   IP I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEAIYTLLMLHNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +D   +G  IV +  +NA + TV+SNSFGFGGTNATLVF+RY G
Sbjct: 361 ETLDEAAEGCNIVTETKENAGLQTVMSNSFGFGGTNATLVFKRYNG 406


>gi|16761303|ref|NP_456920.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16765705|ref|NP_461320.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29141001|ref|NP_804343.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56412725|ref|YP_149800.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|161612886|ref|YP_001586851.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167549615|ref|ZP_02343374.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167993067|ref|ZP_02574162.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168242504|ref|ZP_02667436.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261598|ref|ZP_02683571.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168817884|ref|ZP_02829884.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194449188|ref|YP_002046434.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197361659|ref|YP_002141295.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|198242741|ref|YP_002216450.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200387889|ref|ZP_03214501.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|207857796|ref|YP_002244447.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213161564|ref|ZP_03347274.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213426967|ref|ZP_03359717.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|25286608|pir||AH0803 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41) -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16420922|gb|AAL21279.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16503602|emb|CAD07610.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29136626|gb|AAO68192.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56126982|gb|AAV76488.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|161362250|gb|ABX66018.1| hypothetical protein SPAB_00592 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194407492|gb|ACF67711.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197093135|emb|CAR58579.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197937257|gb|ACH74590.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199604987|gb|EDZ03532.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|205325213|gb|EDZ13052.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205328817|gb|EDZ15581.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338604|gb|EDZ25368.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205345056|gb|EDZ31820.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349552|gb|EDZ36183.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206709599|emb|CAR33944.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|261247584|emb|CBG25411.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267994481|gb|ACY89366.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158936|emb|CBW18449.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312913369|dbj|BAJ37343.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320086811|emb|CBY96583.1| 3-oxoacyl [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321222920|gb|EFX47991.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323130711|gb|ADX18141.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|332989311|gb|AEF08294.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 404

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 295/405 (72%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R QVWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF+S    + +L+M++A+ D+ L P E+   + R GLIAGSGG S K  V  AD 
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAP-EVYQNNPRVGLIAGSGGGSPKFQVFGADA 119

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 180 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVV 239

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 240 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHG 299

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 300 TSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NIEE+D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 NIEELDEQAAGLNIVTET-TERELTTVMSNSFGFGGTNATLVMRK 403


>gi|15802870|ref|NP_288897.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli
           O157:H7 EDL933]
 gi|12516685|gb|AAG57452.1|AE005464_3 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli
           O157:H7 str. EDL933]
          Length = 406

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +G + V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKXVGXYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFXDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|205353491|ref|YP_002227292.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205273272|emb|CAR38237.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326628584|gb|EGE34927.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 404

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 295/405 (72%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R QVWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF+S    + +L+M++A+ D+ L P E+   + R GLIAGSGG S K  V  AD 
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAP-EVYQNNPRVGLIAGSGGGSPKFQVFGADA 119

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 180 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVV 239

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 240 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHG 299

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 300 TSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NIEE+D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 NIEELDEQAAGLNIVTET-TERELTTVMSNSFGFGGTNATLVIRK 403


>gi|62180950|ref|YP_217367.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|168229753|ref|ZP_02654811.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237403|ref|ZP_02662461.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 (beta-ketoacyl-acp
           synthase i) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168465910|ref|ZP_02699780.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|194445726|ref|YP_002041643.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194469300|ref|ZP_03075284.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734265|ref|YP_002115448.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197248177|ref|YP_002147337.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197262076|ref|ZP_03162150.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|204929249|ref|ZP_03220392.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|224583133|ref|YP_002636931.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238912343|ref|ZP_04656180.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|62128583|gb|AAX66286.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|194404389|gb|ACF64611.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194455664|gb|EDX44503.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194709767|gb|ACF88988.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195631244|gb|EDX49804.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197211880|gb|ACH49277.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197240331|gb|EDY22951.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289689|gb|EDY29052.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 (beta-ketoacyl-acp
           synthase i) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204321793|gb|EDZ06992.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205335690|gb|EDZ22454.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|224467660|gb|ACN45490.1| 3-oxoacyl-(acyl carrier protein) synthase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|322617123|gb|EFY14029.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322617572|gb|EFY14471.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322624799|gb|EFY21628.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322630349|gb|EFY27119.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322634529|gb|EFY31262.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322639240|gb|EFY35932.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640103|gb|EFY36770.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645678|gb|EFY42202.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652041|gb|EFY48404.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322656214|gb|EFY52511.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659366|gb|EFY55613.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322665826|gb|EFY62009.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669936|gb|EFY66077.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673921|gb|EFY70018.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678680|gb|EFY74736.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683526|gb|EFY79540.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322687601|gb|EFY83571.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322715430|gb|EFZ07001.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323193565|gb|EFZ78770.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323198472|gb|EFZ83574.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204584|gb|EFZ89587.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323208478|gb|EFZ93417.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323213616|gb|EFZ98405.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323218349|gb|EGA03059.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219258|gb|EGA03751.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323224529|gb|EGA08811.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323232344|gb|EGA16447.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235623|gb|EGA19707.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323241218|gb|EGA25254.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244960|gb|EGA28962.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323250079|gb|EGA33973.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253863|gb|EGA37688.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255000|gb|EGA38791.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262791|gb|EGA46342.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323264166|gb|EGA47673.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270864|gb|EGA54302.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 404

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 295/405 (72%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R QVWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF+S    + +L+M++A+ D+ L P E+   + R GLIAGSGG S K  V  AD 
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAP-EVYQNNPRVGLIAGSGGGSPKFQVFGADA 119

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 180 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVV 239

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 240 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHG 299

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 300 TSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NIEE+D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 NIEELDEQAAGLDIVTET-TERELTTVMSNSFGFGGTNATLVMRK 403


>gi|255261306|ref|ZP_05340648.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Thalassiobium sp.
           R2A62]
 gi|255103641|gb|EET46315.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Thalassiobium sp.
           R2A62]
          Length = 409

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/408 (53%), Positives = 299/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GI+S +GN+ +EV  +L+   SG+  S + A+ GFR Q+ G   +N AE I
Sbjct: 1   MRRVVVTGLGIISPLGNSTAEVTTALKSGTSGVEASPEMAEHGFRSQIAGTLKINPAEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ MRF+  G  + +L+M++AI D+ L   ++ +  TGLIAGSGGPST  +++A     
Sbjct: 61  DKRRMRFMGPGAAYAYLSMEQAIADAGLSEDQVVNPMTGLIAGSGGPSTSAMLAAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T F+I+G ++SI+SAC+TS HCIG AA+ +  G 
Sbjct: 121 KSGATKRIGPFAVPKTMSSTVSANLATAFQIKGMNFSITSACSTSLHCIGMAAQQVALGA 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI+GG A++VLE
Sbjct: 181 QDIMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPTKASRAFDAGRDGFVIAGGGAMVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
            ++ A ARGAKIY E+TG+G+T DG DMV+PSGEG  R MR AL+++ E   + YIN HG
Sbjct: 241 SLDSALARGAKIYGEVTGFGATSDGADMVAPSGEGGERAMRLALNTLPEGRKISYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G+ P I STKS+TGHS GA GA EAIYCL+M+Q+ FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGSTPPISSTKSMTGHSQGATGASEAIYCLLMLQDDFIAPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+E +DPE     I  + ++N  +DT+++NSFGFGGTN +++  +Y+
Sbjct: 361 INVETLDPELAPAEIATETVENTGLDTLMTNSFGFGGTNGSMLLSKYQ 408


>gi|326624202|gb|EGE30547.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
          Length = 404

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 295/405 (72%), Gaps = 4/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R QVWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDITGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADL 118
           DRK +RF+S    + +L+M++A+ D+ L P E+   + R GLIAGSGG S K  V  AD 
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAP-EVYQNNPRVGLIAGSGGGSPKFQVFGADA 119

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ 
Sbjct: 120 MRSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQL 179

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V
Sbjct: 180 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVV 239

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HG
Sbjct: 240 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHG 299

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S 
Sbjct: 300 TSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSI 359

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           NIEE+D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 NIEELDEQAAGLNIVTET-TERELTTVMSNSFGFGGTNATLVMRK 403


>gi|293415616|ref|ZP_06658259.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli B185]
 gi|291433264|gb|EFF06243.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli B185]
          Length = 406

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSAEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|58580384|ref|YP_199400.1| beta-ketoacyl- synthase I [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84622348|ref|YP_449720.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58424978|gb|AAW74015.1| beta-ketoacyl- synthase I [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366288|dbj|BAE67446.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 402

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/403 (55%), Positives = 294/403 (72%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGMGINSCLGNDLDTVSSALREGRSGITALPDHAEAGLRSQVGGAVALDLDSLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L    ++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAEHVSGLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCMR A+  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMRMAIQGLDRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK L+GHSLGAA   EA+Y L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAVYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           EE+DP  +G PI+R+    A ++TV+SNSFGFGGTN  LVF R
Sbjct: 360 EELDPRAEGFPILRQ-TQEATLNTVMSNSFGFGGTNGALVFGR 401


>gi|254510566|ref|ZP_05122633.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Rhodobacteraceae
           bacterium KLH11]
 gi|221534277|gb|EEE37265.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Rhodobacteraceae
           bacterium KLH11]
          Length = 409

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/409 (54%), Positives = 296/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTG+GIVSSIGNN  EV  SL+  +SGI  +E   + GFR Q+ G   ++  E +
Sbjct: 1   MRRVVVTGLGIVSSIGNNAQEVLASLKAGKSGIEANEQMVEHGFRSQIAGSLKIDVTEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI DS L   ++ + RTGL+AGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMSQAIADSGLTEDQVVNPRTGLVAGSGGPSTSAMLTAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           ++ +T+RIGPFAVPK M ST +A L+T FKI+G +YSI+SAC+TS HCIGNAAE I  GK
Sbjct: 121 KNGATKRIGPFAVPKCMCSTIAANLATAFKIKGINYSITSACSTSLHCIGNAAEQIMLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+S LFDAMGAMSS +N  P  ASR +D  RDGFVISGG  ++VLE
Sbjct: 181 QDVVFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDQNRDGFVISGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
           +++ A ARGAKIYAE+TGY +T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 DLDHALARGAKIYAEVTGYAATSDGHDMVAPSGEGGERAMRLALSTLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R +F +GN+P I STKS+TGH+ GAAGA E I+CL+M+   FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRIFGEGNVPPISSTKSMTGHAQGAAGALETIFCLLMLDSDFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N++ +        I  + ++NA +D+V++NSFGFGGTN ++V  +Y G
Sbjct: 361 INVDTLADGILPGEIATQVVENAGLDSVMTNSFGFGGTNGSMVLSKYNG 409


>gi|218548222|ref|YP_002382013.1| 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia fergusonii
           ATCC 35469]
 gi|218355763|emb|CAQ88376.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia fergusonii
           ATCC 35469]
          Length = 406

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSSEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|294669575|ref|ZP_06734642.1| hypothetical protein NEIELOOT_01476 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308488|gb|EFE49731.1| hypothetical protein NEIELOOT_01476 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 404

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/404 (56%), Positives = 296/404 (73%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVSS+GNN  EV  SL+  +SGI+F E + + G R  V G   ++  E I
Sbjct: 1   MKRVVVTGIGIVSSLGNNCREVLESLKNLKSGISFDESYREMGLRSNVAGNIKIDTKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AM+EAI ++ L   ++++ RTG++ GSGG S    V AAD  R
Sbjct: 61  DRKILRFMGDAAAYAYIAMKEAIANAGLTEEQVSNIRTGIVTGSGGASPASQVEAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+ V K M+ST +A L+T FKI+G +YSISSAC+TSAHCIG+AAELIQ GK
Sbjct: 121 A-SGVKRIGPYGVTKTMASTVAACLATPFKIKGVNYSISSACSTSAHCIGHAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W MS+LFDAMGA+SS +N  P  ASR YD+ RDGFVISGG +++V+E
Sbjct: 180 QDIVFAGGGEEVSWHMSSLFDAMGALSSKYNDTPEQASRAYDADRDGFVISGGGSILVME 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I  ELTGYG+T DG DMV PSGEGA+RCM+ AL+     VDYIN HGT+
Sbjct: 240 EYEHAKARGANILCELTGYGATSDGYDMVQPSGEGAVRCMQMALAQHGGKVDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGN-IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD KE+ AIREVF G  IP I STKSL+GH+LGAAG+ EAIY ++MMQ  F   S N
Sbjct: 300 TPVGDTKELGAIREVFAGQEIPLISSTKSLSGHALGAAGSNEAIYSILMMQNDFACASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I  +D + +G+PI+R+  +  K++ V+SNSFGFGGTNATL+F R
Sbjct: 360 IRNLDEQAEGLPILRENRE-MKLNAVMSNSFGFGGTNATLIFSR 402


>gi|21244350|ref|NP_643932.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21110005|gb|AAM38468.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 402

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/403 (55%), Positives = 297/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LRE+RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGMGITSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVALDLDSLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L    ++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAELVSGLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S+ SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSSVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+  N  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGSNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCMR A+  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMRMAMQGLQRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK L+GHSLGAA   EAIY L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAIYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +++DP  +G PI+R+  D A ++TV+SNSFGFGGTNA LVF R
Sbjct: 360 DDLDPRAEGFPILRQTQD-ATLNTVMSNSFGFGGTNAALVFGR 401


>gi|118594681|ref|ZP_01552028.1| 3-oxoacyl-(acyl carrier protein) synthase [Methylophilales
           bacterium HTCC2181]
 gi|118440459|gb|EAV47086.1| 3-oxoacyl-(acyl carrier protein) synthase [Methylophilales
           bacterium HTCC2181]
          Length = 409

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/408 (56%), Positives = 301/408 (73%), Gaps = 7/408 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSS+GNNV EV  SL++++SGITF  ++ + G R Q+ G   ++  +LI
Sbjct: 1   MRRVVVTGMGIVSSLGNNVQEVEKSLQDSKSGITFQPEYEEHGLRSQIAGSMNIDVNQLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+++G  +  +AMQEAI DS+L   ++++ RTG+I G+GG ST+ ++   +  +
Sbjct: 61  DRKLLRFMAKGHAYAWIAMQEAIADSQLNEDQVSNFRTGIIVGAGGTSTESMLQGTETLK 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ V K MS+  +A L+T  KI+G +YSI+SAC+TSAHCIGNA ELIQ GK
Sbjct: 121 EK-GIRRVGPYMVTKTMSNGVAACLATGSKIKGINYSITSACSTSAHCIGNAYELIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMFAGG E+  WTMS LFDAMGAMSS +N  P  ASR +D+ RDGFVISGG +V+VLE
Sbjct: 180 QDIMFAGGAEEEHWTMSYLFDAMGAMSSKYNDHPEKASRTFDTSRDGFVISGGGSVLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP-VDYINTHGT 299
           E E A  RGAKIYAE+ GYG+T DG DMV+PSGEGA RCM  AL+      VDYINTHGT
Sbjct: 240 EYEHAVQRGAKIYAEIVGYGATSDGHDMVAPSGEGAQRCMEVALAEKNTTNVDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVF----KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIG 355
           +TP GD  E+EAI+ VF     G IP I STKSL+GH+LGAAG+ EAIY LIMM + F+ 
Sbjct: 300 STPVGDSVELEAIKRVFGEGKYGAIPAIASTKSLSGHALGAAGSNEAIYSLIMMNKGFLT 359

Query: 356 ESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            S NI+E+DP  +G+PI+ K+ +   I + +SNSFGFGG NA+++F +
Sbjct: 360 PSINIDELDPAAEGLPILLKK-EKRVITSAMSNSFGFGGVNASILFSK 406


>gi|50121986|ref|YP_051153.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pectobacterium
           atrosepticum SCRI1043]
 gi|49612512|emb|CAG75962.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Pectobacterium
           atrosepticum SCRI1043]
          Length = 405

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 292/404 (72%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++AI DS L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAIKDSGLSDEVYQNNPRVGLIAGSGG-SARYQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V K+M S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKSMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W +S  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGAEELCWELSCEFDAMGALSTKYNETPEKASRTYDTGRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A++ V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMRMAMNGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  F+  S N
Sbjct: 300 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHSFVAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +D +  G+ IV + ++  K+ TV+SNSFGFGGTNATLV R+
Sbjct: 360 IENLDEQAAGLNIVTEPMER-KLTTVMSNSFGFGGTNATLVMRK 402


>gi|66769951|ref|YP_244713.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188993164|ref|YP_001905174.1| 3-oxoacyl-[acyl-carrier protein] synthase II [Xanthomonas
           campestris pv. campestris str. B100]
 gi|66575283|gb|AAY50693.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734924|emb|CAP53136.1| 3-oxoacyl-[acyl-carrier protein] synthase II [Xanthomonas
           campestris pv. campestris]
          Length = 402

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/403 (55%), Positives = 296/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI S +GN++  V+ +LRE+RSGIT   D A+ G R QV G   ++   LI
Sbjct: 1   MRRVVVTGMGINSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVDIDLDGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L P +++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLSPEQVSDLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 AR-GVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMQGLDRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK+L+GHSLGAA   EAIY ++M+++ F+  S +I
Sbjct: 300 TPLGDATELGAVREVFGDNVPPLSSTKALSGHSLGAASVHEAIYSMLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R     A ++TV+SNSFGFGGTN  LVF R
Sbjct: 360 DELDPRAEGFPILRA-TREATLNTVMSNSFGFGGTNGVLVFGR 401


>gi|78049298|ref|YP_365473.1| 3-oxoacyl-[acyl-carrier protein] synthase II [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78037728|emb|CAJ25473.1| 3-oxoacyl-[acyl-carrier protein] synthase II [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 402

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/403 (55%), Positives = 296/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGI S +GN++  V+ +LR +RSGIT   D A+ G R QV G   L+   LI
Sbjct: 1   MRRVVITGMGITSCLGNDLDTVSSALRVSRSGITALPDHAEAGLRSQVGGAVALDLDSLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L   +++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLDAEQVSGLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S+ SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G 
Sbjct: 121 NR-GVRKVGPYMVPRTMCSSVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGA 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + E A ARGA+I+AEL GYG T DG DMV+PSGEGA+RCM  A+  ++ P+DY+NTHGT+
Sbjct: 240 DYEHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMQGLQRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF   +P + STK L+GHSLGAA   EAIY L+M+++ F+  S +I
Sbjct: 300 TPLGDVTELGAVREVFGDYVPPLSSTKGLSGHSLGAASVHEAIYSLLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R+  D A ++TV+SNSFGFGGTNA LVF R
Sbjct: 360 DELDPSAEGFPILRQTQD-ATLNTVMSNSFGFGGTNAALVFGR 401


>gi|85708763|ref|ZP_01039829.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Erythrobacter sp. NAP1]
 gi|85690297|gb|EAQ30300.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Erythrobacter sp. NAP1]
          Length = 409

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/409 (54%), Positives = 298/409 (72%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVSSIGNN  EV  SL+  +SGI+F+E+ A+ GFR Q+ G   L+  E +
Sbjct: 1   MRRVVITGLGIVSSIGNNADEVLASLKAGKSGISFNEEMAEHGFRSQIAGAIDLDVKEHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L+  ++ +  TG+IAGSGGPST  +++A     
Sbjct: 61  DKRTLRFMGPGAAYAHIAMGQAIADAGLEEKDVINPMTGVIAGSGGPSTSAMLAAHQSVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +   T+RIGPFAVPK MSST SA L+T ++I+G ++SI+SAC+TS HCIG AA+ I  G 
Sbjct: 121 KTGGTKRIGPFAVPKTMSSTVSANLATAYQIKGMNFSITSACSTSLHCIGMAAQQIALGT 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MF GG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI GG A++VLE
Sbjct: 181 QDVMFGGGGEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDADRDGFVIGGGGAMVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
            +E A+ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR A+ ++ E   V YIN HG
Sbjct: 241 SLEHAQARGAKIYAEVTGFAATSDGADMVAPSGEGGERAMRGAIRTLGEDRKVSYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  E+EA+R VF  G+ P + STKS+TGHS GA GAQEA+YCL+ ++  FI  S
Sbjct: 301 TSTPVGDVGEIEAVRRVFGDGSTPPVSSTKSMTGHSQGATGAQEAVYCLLALENDFIIPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP  K   I  K ++NA +DTV++NSFGFGGTN +++  ++ G
Sbjct: 361 INVETLDPALKPEEIATKLVENAGLDTVMTNSFGFGGTNGSMLLSKFHG 409


>gi|121996828|ref|YP_001001615.1| beta-ketoacyl synthase [Halorhodospira halophila SL1]
 gi|121588233|gb|ABM60813.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Halorhodospira
           halophila SL1]
          Length = 405

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/406 (55%), Positives = 290/406 (71%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGN+  EV  SLR  +SGI +  ++ + G R  V G   ++   LI
Sbjct: 1   MRRVVITGLGIVSCIGNSRDEVTASLRAGKSGIRYQPEYEEVGLRSLVAGSCDVDVQALI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            RK++RF+     + ++AM +AI D+ L    I+  R GLIAGSGG ST  IVSA +  R
Sbjct: 61  PRKSLRFMGDAAAYSYIAMDQAIADAGLDYAAISSPRVGLIAGSGGASTANIVSATETLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R+IGP+ V + M ST SA L+T F+I+G +YSI+SACATSAHC+G A E IQ GK
Sbjct: 121 TR-GVRKIGPYGVTRTMGSTVSACLATPFQIKGLNYSITSACATSAHCVGAAMEQIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+  W+++ LFD MGA+S+ +N  P  ASRPYD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVIFAGGGEEEHWSLTQLFDGMGALSTKYNDTPEQASRPYDASRDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I AEL G+G+T DG DMV+PSGEGA RCMRQAL  VE PVDYINTHGT+
Sbjct: 240 ALEHAQARGAPILAELVGFGATSDGYDMVAPSGEGAARCMRQALEGVEGPVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+EA REVF   +P + STKSLTGHSLGA G QEAIY L+MM+  FI  S NI
Sbjct: 300 TPAGDIAELEATREVFGECMPPMSSTKSLTGHSLGATGVQEAIYSLLMMEHGFISPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E++DPE   +P+V +  +   ++TVL+NSFGFGGTNATL  RR+ G
Sbjct: 360 EQLDPEAGDVPMVTETREGVTLNTVLTNSFGFGGTNATLALRRFDG 405


>gi|332090208|gb|EGI95307.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           dysenteriae 155-74]
          Length = 402

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/401 (57%), Positives = 289/401 (72%), Gaps = 2/401 (0%)

Query: 6   VTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAM 65
           +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LIDRK +
Sbjct: 2   ITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVV 61

Query: 66  RFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLTREHCS 124
           RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  R    
Sbjct: 62  RFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRG 121

Query: 125 TRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIM 184
            + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ GKQDI+
Sbjct: 122 LKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIV 181

Query: 185 FAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMER 244
           FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+EE+E 
Sbjct: 182 FAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEH 241

Query: 245 AKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKG 304
           A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT+TP G
Sbjct: 242 ALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGTSTPVG 301

Query: 305 DKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEID 364
           D KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S NIEE+D
Sbjct: 302 DVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELD 361

Query: 365 PEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 362 EQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 401


>gi|146279936|ref|YP_001170094.1| hypothetical protein Rsph17025_3935 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145558177|gb|ABP72789.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 409

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/408 (58%), Positives = 303/408 (74%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  SLR  RSGI+FSE++A  GFR QV G P +   + I
Sbjct: 1   MRRVVITGIGIVSPIGNNAAEVEASLRAGRSGISFSEEYAGHGFRSQVHGMPKIVLEDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AM++AI DS L+  ++++ R+GL+ GSGGPST     A  +  
Sbjct: 61  DKRDLRFMGSGAAYNFIAMEQAIKDSGLEESDVSNPRSGLVMGSGGPSTSNFFQAHKIVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGSPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGTELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+LDWT+S LFDAMGAMSS +N  P +ASR +D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDVVFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRAFDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+E A+ARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR ALS++ E   +DYIN HG
Sbjct: 241 ELEHARARGAKIYAEVTGYGATSDGADMVAPSGEGGERSMRLALSTLPEGRRIDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EV+AIR +F +GN+P I STKSLTGHSLGA G  EAIY ++MMQ  FI  S
Sbjct: 301 TSTPAGDVTEVKAIRRIFGEGNVPPISSTKSLTGHSLGATGVHEAIYSMLMMQGGFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DPE +   I     +  +ID+VLSNSFGFGGTNATLV  ++ 
Sbjct: 361 ANVSQLDPEIRPDEIATSLREGVEIDSVLSNSFGFGGTNATLVLSKFN 408


>gi|84688010|ref|ZP_01015873.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84663991|gb|EAQ10492.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Rhodobacterales
           bacterium HTCC2654]
          Length = 409

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/409 (55%), Positives = 294/409 (71%), Gaps = 3/409 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+G+VS IG N  EV  SL+  RSGIT + D A++GFR Q+ G   ++  E +
Sbjct: 1   MQRVVVTGLGVVSPIGLNTEEVTQSLKAGRSGITANADMAEYGFRSQIAGAVDIDLKENV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++A+RF+  G  + +LAM +AI D+ L   ++ +ERTGLIAGSGGPST  +  A     
Sbjct: 61  DKRALRFMGPGAAYAYLAMGQAIADAGLDDSDVVNERTGLIAGSGGPSTSSMFQAHQTVL 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  S +RIGP AVPK MSST SA L+T +KI+G +YSI+SAC+TS HCIG+AAE I  GK
Sbjct: 121 KSGSPKRIGPLAVPKCMSSTISANLATQYKIKGINYSITSACSTSLHCIGSAAEQIMMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+LDWT+S LFDAMGAMSS FN  P  ASR +D  RDGFVI+GG  ++VLE
Sbjct: 181 QDVMFAGGAEELDWTLSCLFDAMGAMSSKFNDTPDKASRAFDKDRDGFVIAGGGGIVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
            ++ A ARGAKIY E+TG+ +T DG DMV+PSGEG  R MR ALS++ E   V YIN HG
Sbjct: 241 SLDHALARGAKIYGEVTGFAATSDGHDMVAPSGEGGERAMRLALSTLPEGRKVGYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF +G+ P I STKS+TGH+ GAAGA EAI+ ++M+ + FI  S
Sbjct: 301 TSTPVGDVGEVEAVRRVFGEGSTPLISSTKSMTGHAQGAAGAMEAIFSILMLDQHFITPS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
            N+E +DP      I    ++NA +DTV++NSFGFGGTN +++  +Y G
Sbjct: 361 INVETLDPAIHEGEIATTLVENAGLDTVMTNSFGFGGTNGSMLISKYNG 409


>gi|262043371|ref|ZP_06016498.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259039283|gb|EEW40427.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 406

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/406 (57%), Positives = 294/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++A+ D+ L P     + R GLIAGSGG S K  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAVADAGLAPEAYQNNPRVGLIAGSGGGSPKFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDANRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E +E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EGLEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +EE+D +  G+ IV K  D AK+ TV+SNSFGFGGTNATLV R+Y 
Sbjct: 361 VEELDEQAAGLNIVTKPTD-AKLTTVMSNSFGFGGTNATLVMRKYN 405


>gi|21230056|ref|NP_635973.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|21111579|gb|AAM39897.1| beta-ketoacyl-[ACP] synthase I [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
          Length = 402

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/403 (55%), Positives = 297/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGI S +GN++  V+ +LRE+RSGIT   D A+ G R QV G   ++   LI
Sbjct: 1   MRRVVVTGMGINSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVDIDLDGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM++AI D+ L P +++  RTG+IAGSGG S++  V  ADL R
Sbjct: 61  DRKLKRFMGDASAYAYLAMRDAIADAGLSPEQVSDLRTGVIAGSGGGSSQWQVETADLLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G+
Sbjct: 121 AR-GVRKVGPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGE 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE
Sbjct: 180 QDVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + + A ARGA+I+AEL GYG + DG DMV+PSGEGA+RCM  A+  ++ P+DY+NTHGT+
Sbjct: 240 DYDHAIARGARIHAELLGYGVSSDGADMVAPSGEGAVRCMHMAMQGLDRPIDYLNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ A+REVF  N+P + STK+L+GHSLGAA   EAIY ++M+++ F+  S +I
Sbjct: 300 TPLGDATELGAVREVFGDNVPPLSSTKALSGHSLGAASVHEAIYSMLMLRDGFMAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E+DP  +G PI+R     A ++TV+SNSFGFGGTN  LVF R
Sbjct: 360 DELDPRAEGFPILRA-TREATLNTVMSNSFGFGGTNGVLVFGR 401


>gi|77465190|ref|YP_354693.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389608|gb|ABA80792.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodobacter
           sphaeroides 2.4.1]
          Length = 409

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 238/408 (58%), Positives = 300/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  SLR  RSGI+FSED+A  GFR Q+ G P L   + +
Sbjct: 1   MRRVVITGIGIVSPIGNNAAEVEASLRAGRSGISFSEDYAHHGFRSQIHGMPDLVLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AM++AI DS L+  E+++ RTGL+ GSGGPST     A  +  
Sbjct: 61  DKRDLRFMGAGAAYNFIAMEQAIKDSGLEATEVSNPRTGLVMGSGGPSTSNFFQAHKIVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGSPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGTELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +ASRP+D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIVFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRPFDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+E A ARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR AL ++ E   VDYIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGYGATSDGADMVAPSGEGGERSMRLALGTLPEGRRVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EV AIR +F +G +P I STKSLTGHSLGA G  EAIY ++MMQ  FI  S
Sbjct: 301 TSTPAGDVTEVRAIRRIFGEGKVPPISSTKSLTGHSLGATGVHEAIYSILMMQGDFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DPE +   I     +  +ID+VLSNSFGFGGTNA+L+  ++ 
Sbjct: 361 ANVTQLDPEIQPDEIATTLREGVEIDSVLSNSFGFGGTNASLLLSKFN 408


>gi|78486284|ref|YP_392209.1| Beta-ketoacyl synthase [Thiomicrospira crunogena XCL-2]
 gi|78364570|gb|ABB42535.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Thiomicrospira
           crunogena XCL-2]
          Length = 406

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 299/407 (73%), Gaps = 2/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M+RV +TG+G+VSS+GNN  EV  SLR  RSGI ++ ++ + G R  V G    L+ AE 
Sbjct: 1   MKRVVITGLGVVSSLGNNKEEVTDSLRNGRSGIVYAPEYEENGLRSHVHGAVKNLDFAEH 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           I+RK++RF+     + ++AM +A+ D+ L   ++++ RTGL+AGSGG S      A ++ 
Sbjct: 61  INRKSLRFMGDAAAYTYIAMDQAVKDAGLTEDQVSNVRTGLVAGSGGGSNSNSTQAVEVA 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           RE    +R+GP+ V + M ST SA L+T FKI+G +YSISSAC+TSAHCIG A E IQ G
Sbjct: 121 REK-GVKRVGPYMVTRTMGSTVSACLATPFKIKGINYSISSACSTSAHCIGTAVEQIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L WTMS LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELHWTMSVLFDAMGALSTKYNDTPAKASRAYDANRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGAKIYAE+TGYG+  DG DMV+PSGEGA+RCM  ALS+V+  VDYIN HGT
Sbjct: 240 EELEHALARGAKIYAEITGYGANSDGYDMVAPSGEGAVRCMNLALSTVKGDVDYINPHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE  AIREVF   +P I STKS++GHSLGAAG  E IY L+M++  FI  S N
Sbjct: 300 STPVGDTKEAAAIREVFGAKVPKISSTKSMSGHSLGAAGVHEFIYSLMMLENDFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           IE +DPE +G+PIV +  +NA +  ++SNSFGFGGTNA+LVF +YKG
Sbjct: 360 IETMDPECEGMPIVTELEENAGLTRMMSNSFGFGGTNASLVFEKYKG 406


>gi|300717702|ref|YP_003742505.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Erwinia billingiae
           Eb661]
 gi|299063538|emb|CAX60658.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Erwinia billingiae
           Eb661]
          Length = 407

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 233/407 (57%), Positives = 294/407 (72%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAE-- 58
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+  E  
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLSKDEIS 60

Query: 59  -LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAA 116
            LIDRK +RF+S    + +++M EA+ DS L   +  +  R GL+AGSGG S     ++ 
Sbjct: 61  ALIDRKVLRFMSDASIYAYISMLEAVKDSGLTAEQYQNNPRVGLVAGSGGGSPYNQAASV 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D  R     R +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E I
Sbjct: 121 DGMRAK-GLRGVGPYMVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQI 179

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQD++FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  +
Sbjct: 180 QLGKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNETPEKASRTYDTSRDGFVIAGGGGM 239

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A++ V+ P+DY+NT
Sbjct: 240 VVVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAMRCMRLAMADVDTPIDYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AI EVF  N+P + +TK++TGHSLGAAG QEAIY L+M++  FI  
Sbjct: 300 HGTSTPVGDVKELGAICEVFSENMPAMSATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S NI+E+DP  KG+ IV K  +  K+ TV+SNSFGFGGTNATLV R+
Sbjct: 360 SINIDELDPAAKGLNIVTKPTEQ-KLKTVMSNSFGFGGTNATLVMRK 405


>gi|223041711|ref|ZP_03611905.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Actinobacillus minor
           202]
 gi|223017455|gb|EEF15872.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Actinobacillus minor
           202]
          Length = 405

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 302/406 (74%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GI+SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGIGIISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEEQVSNDRTGLVIGAGTGSAHSQLVACDAAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + IGP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 SPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+  ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVKGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF  N P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGENTPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNGFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EE+D + KG+ IV +R D A + TV+SNSFGFGGTNA LVF++Y+G
Sbjct: 361 EELDEQAKGLNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYQG 405


>gi|271501302|ref|YP_003334327.1| beta-ketoacyl synthase [Dickeya dadantii Ech586]
 gi|270344857|gb|ACZ77622.1| Beta-ketoacyl synthase [Dickeya dadantii Ech586]
          Length = 406

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/407 (56%), Positives = 293/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+ A LI
Sbjct: 1   MKRAVITGLGILSSIGNNKEEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE---RTGLIAGSGGPSTKCIVSAAD 117
           +RK +RF+S    + +L M+EA+ DS L   E T++   R GLI GSGG S +  V  AD
Sbjct: 61  ERKIVRFMSDASIYAYLCMEEAVKDSGL--AEETYQNNPRVGLIVGSGGGSPRFQVFGAD 118

Query: 118 LTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQ 177
             R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ
Sbjct: 119 AMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQ 178

Query: 178 SGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVI 237
            GKQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++
Sbjct: 179 MGKQDIVFAGGGEELCWELACEFDAMGALSTKYNETPTRASRTYDADRDGFVIAGGGGMV 238

Query: 238 VLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTH 297
           V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL  V+ PVDYINTH
Sbjct: 239 VVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMKLALQDVDTPVDYINTH 298

Query: 298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           GT+TP GD KE+ AIR+VF  N+P I STK++TGHSLGAAG QEAIY L+M++  FI  S
Sbjct: 299 GTSTPVGDVKELWAIRQVFGDNVPPISSTKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPS 358

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
            N+E +D +  G+ +V +  +  ++ TV+SN FGFGGTNA LV R+Y
Sbjct: 359 INVETLDEQAVGMNVVTEPTER-ELTTVMSNGFGFGGTNAVLVMRKY 404


>gi|254436866|ref|ZP_05050360.1| Beta-ketoacyl synthase, N-terminal domain protein [Octadecabacter
           antarcticus 307]
 gi|198252312|gb|EDY76626.1| Beta-ketoacyl synthase, N-terminal domain protein [Octadecabacter
           antarcticus 307]
          Length = 413

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/408 (54%), Positives = 293/408 (71%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVS IGNN++EV  +LR   SGI  SED  + GFR Q+ G   ++ A+ +
Sbjct: 5   MRRVVITGMGIVSPIGNNITEVDANLRAGNSGIVASEDMKEHGFRSQIAGTLKIDVADHV 64

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  + H+AM +AI D+ L   ++ +  TGLIAGSGGPST  + +A  +  
Sbjct: 65  DKRTLRFMGAGAAYAHIAMGQAIADAGLSEDDVVNPMTGLIAGSGGPSTSAMFAAHQVVL 124

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +  +T+RIGPFAVPK MSST SA L+T +KI+G ++SI+SAC+TS HCIG AA+ +  G 
Sbjct: 125 KTGATKRIGPFAVPKTMSSTVSANLATAYKIKGMNFSITSACSTSLHCIGMAAQQVALGT 184

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDIMF GG E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI+GG A++VLE
Sbjct: 185 QDIMFGGGGEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDANRDGFVIAGGGAMVVLE 244

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHG 298
            ++ A ARGAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++ E   + YIN HG
Sbjct: 245 SLDGALARGAKIYAEVTGFAATSDGADMVAPSGEGGERAMRGALKTLPEGRKISYINAHG 304

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EVEA+R VF  G  P I STKS+TGHS GA GAQEAIYCL+ +Q  +I  S
Sbjct: 305 TSTPVGDVGEVEAVRRVFGTGTTPPISSTKSMTGHSQGATGAQEAIYCLLALQGDYIIPS 364

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+E +DP      I    ++NA +DTV++NSFGFGGTN +++  +Y+
Sbjct: 365 INVETLDPAINAGEIATTLVENAGLDTVMTNSFGFGGTNGSMLLSKYQ 412


>gi|258546014|ref|ZP_05706248.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Cardiobacterium
           hominis ATCC 15826]
 gi|258518743|gb|EEV87602.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Cardiobacterium
           hominis ATCC 15826]
          Length = 405

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 227/406 (55%), Positives = 299/406 (73%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTGMGIVSSIGNN  EV  SL++ +SGI  S  +A+ G R QV G   ++    I
Sbjct: 1   MKRVVVTGMGIVSSIGNNCKEVLASLQQLQSGIKHSPVYAEMGLRSQVEGSINIDTKAHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AM+EAI  +RL P  I++ RTGL+ G+GG +    V AAD  R
Sbjct: 61  DRKILRFMGDAAAYCYIAMKEAIEQARLLPEHISNIRTGLVVGTGGATPSAQVEAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+AV K M+ST SA L+T F+I+G +YSISSAC+TSAHCIG+AAE+IQ GK
Sbjct: 121 A-SGVKRIGPYAVTKTMASTTSACLATPFQIKGVNYSISSACSTSAHCIGHAAEVIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W ++++FDAMGA+S+++N  P +ASR YD+ RDGFVISGG +++VLE
Sbjct: 180 QDIVFAGGGEEVHWALTSMFDAMGALSTNYNATPETASRAYDANRDGFVISGGGSILVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I AELTGYG+T DG DMV PSGEGA+RCM+ AL+     V YIN HGT+
Sbjct: 240 EYEHAKARGATIIAELTGYGATSDGYDMVQPSGEGAVRCMQMALAEHGGDVGYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKG-NIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD +E+EAI+  F G  +P I STKSLTGH+LGAAG+ EAIY L+M+Q +F+  S +
Sbjct: 300 TPVGDTRELEAIKTAFAGKTVPPISSTKSLTGHALGAAGSNEAIYSLLMLQNQFLAASAH 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +DP    +PI+R+  +   ++ V+SNSFGFGGTNATL+F R +
Sbjct: 360 IETLDPNAGDLPILRESREQ-PLNAVMSNSFGFGGTNATLIFSRVQ 404


>gi|307131854|ref|YP_003883870.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Dickeya dadantii 3937]
 gi|306529383|gb|ADM99313.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Dickeya dadantii 3937]
          Length = 405

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/405 (56%), Positives = 291/405 (71%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+ A LI
Sbjct: 1   MKRAVITGLGILSSIGNNKEEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           +RK +RF+S    + +L M+EA+ DS L +     + R GLI GSGG S +  V  AD  
Sbjct: 61  ERKVVRFMSDVSIYAYLCMEEAVKDSGLAEEAYQNNPRVGLIVGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 121 RSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQMG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWELACEFDAMGALSTKYNETPERASRTYDADRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL  V+ PVDYINTHGT
Sbjct: 241 EELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMKLALQDVDTPVDYINTHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIR+VF  N+P I STK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELWAIRQVFGDNVPPISSTKAMTGHSLGAAGVQEAIYTLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           +E +D + +G+ +V +  +   + TV+SN FGFGGTNA LV R+Y
Sbjct: 361 VETLDEQAQGMNVVTEPTER-NLTTVMSNGFGFGGTNAVLVMRKY 404


>gi|332754973|gb|EGJ85338.1| beta-ketoacyl synthase, C-terminal domain protein [Shigella
           flexneri 4343-70]
          Length = 409

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/401 (57%), Positives = 289/401 (72%), Gaps = 2/401 (0%)

Query: 6   VTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAM 65
           +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LIDRK +
Sbjct: 2   ITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNIKLDTTGLIDRKVV 61

Query: 66  RFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLTREHCS 124
           RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  R    
Sbjct: 62  RFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRG 121

Query: 125 TRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIM 184
            + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ GKQDI+
Sbjct: 122 LKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIV 181

Query: 185 FAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMER 244
           FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+EE+E 
Sbjct: 182 FAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEH 241

Query: 245 AKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKG 304
           A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT+TP G
Sbjct: 242 ALARGAYIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGTSTPVG 301

Query: 305 DKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEID 364
           D KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S NIEE+D
Sbjct: 302 DVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELD 361

Query: 365 PEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 362 EQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 401


>gi|251788979|ref|YP_003003700.1| beta-ketoacyl synthase [Dickeya zeae Ech1591]
 gi|247537600|gb|ACT06221.1| Beta-ketoacyl synthase [Dickeya zeae Ech1591]
          Length = 406

 Score =  457 bits (1177), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 232/407 (57%), Positives = 293/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+ A LI
Sbjct: 1   MKRAVITGLGILSSIGNNKEEVLASLREGRSGITFSQEMKDSGMRSHVWGNVKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE---RTGLIAGSGGPSTKCIVSAAD 117
           +RK +RF+S    + +L M+EA+ DS L   E T++   R GLIAGSGG S +  V  AD
Sbjct: 61  ERKIVRFMSDASIYAYLCMEEAVKDSGL--AEETYQNNPRVGLIAGSGGGSPRFQVFGAD 118

Query: 118 LTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQ 177
             R     + +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ
Sbjct: 119 AMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQ 178

Query: 178 SGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVI 237
            GKQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++
Sbjct: 179 MGKQDIVFAGGGEELCWELACEFDAMGALSTKYNETPERASRTYDADRDGFVIAGGGGMV 238

Query: 238 VLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTH 297
           V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA RCM+ AL  V+ PVDYINTH
Sbjct: 239 VVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAARCMKLALQDVDTPVDYINTH 298

Query: 298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           GT+TP GD KE+ AIR+VF  N+P I +TK++TGHSLGAAG QEAIY L+M++  FI  S
Sbjct: 299 GTSTPVGDVKELWAIRQVFGDNVPPISATKAMTGHSLGAAGVQEAIYTLLMLEHGFIAPS 358

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
            N+E +D + +G+ IV +  +   + TV+SN FGFGGTNA LV R+Y
Sbjct: 359 INVETLDEQAQGMNIVTEPTER-NLTTVMSNGFGFGGTNAVLVMRKY 404


>gi|261820759|ref|YP_003258865.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pectobacterium
           wasabiae WPP163]
 gi|261604772|gb|ACX87258.1| Beta-ketoacyl synthase [Pectobacterium wasabiae WPP163]
          Length = 405

 Score =  457 bits (1177), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 291/404 (72%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++AI DS L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAIQDSGLSDEVYQNNPRVGLIAGSGG-SARYQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V K+M S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKSMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGAEELCWELACEFDAMGALSTKYNETPEKASRTYDAGRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMKMAMNGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  F+  S N
Sbjct: 300 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHSFVAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E +D +  G+ IV +  +  K+ TV+SNSFGFGGTNATLV R+
Sbjct: 360 VENLDEQAAGLNIVTEPTER-KLTTVMSNSFGFGGTNATLVMRK 402


>gi|319944476|ref|ZP_08018750.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Lautropia mirabilis
           ATCC 51599]
 gi|319742437|gb|EFV94850.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Lautropia mirabilis
           ATCC 51599]
          Length = 403

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/404 (58%), Positives = 299/404 (74%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVSS+GNN  EV  SLR  +SGITF   +   G R QV G   L+  E I
Sbjct: 1   MKRVVVTGIGIVSSLGNNCQEVLASLRALKSGITFDPVYRDMGLRSQVAGNIALDPKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++A+QEAIT S L P ++++ RTG++AGSGG S+   V  AD+ R
Sbjct: 61  DRKILRFMGPAAAYSYIALQEAITQSGLTPEQVSNLRTGIVAGSGGASSSSQVELADVLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+ V K M ST SA L+T F+I+G +YSISSAC+TSAHCIGNAAELIQ GK
Sbjct: 121 AS-GIKRVGPYGVTKCMGSTVSACLATPFQIKGVNYSISSACSTSAHCIGNAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W MS LFD MGAMSS +N  P  ASR YD+ RDGFVISGG +++VLE
Sbjct: 180 QDIVFAGGGEEVSWQMSMLFDGMGAMSSRYNDTPELASRAYDADRDGFVISGGGSMLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I  ELTGYG+T DG DMV PSGEGA+RCM+ AL+     +DYIN HGT+
Sbjct: 240 EYEHAKARGANILCELTGYGATSDGYDMVQPSGEGAVRCMQMALAQHGGKIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD +E+EAIR  F  G+IP I STKSL+GH+LGAAG+ EAIY ++MMQ+ F+  S N
Sbjct: 300 TPVGDTRELEAIRTTFANGDIPLISSTKSLSGHALGAAGSNEAIYSILMMQDGFVCGSAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I+++D + +G+PI+R+  D  K+D ++SNSFGFGGTNATL+F R
Sbjct: 360 IQKLDEKAEGMPILRENRD-MKLDAIMSNSFGFGGTNATLIFSR 402


>gi|221369188|ref|YP_002520284.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Rhodobacter
           sphaeroides KD131]
 gi|221162240|gb|ACM03211.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Rhodobacter
           sphaeroides KD131]
          Length = 409

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/408 (58%), Positives = 300/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  SLR  RSGI+FSE++A  GFR Q+ G P L   + +
Sbjct: 1   MRRVVITGIGIVSPIGNNAAEVEASLRAGRSGISFSEEYAHHGFRSQIHGMPDLVLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AM++AI DS L+  E+++ RTGL+ GSGGPST     A  +  
Sbjct: 61  DKRDLRFMGPGAAYNFIAMEQAIKDSGLEAAEVSNPRTGLVMGSGGPSTSNFFQAHKIVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGSPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGTELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +ASRP+D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIVFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRPFDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+E A ARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR AL ++ E   VDYIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGYGATSDGADMVAPSGEGGERSMRLALGTLPEGRRVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EV AIR +F +G +P I STKSLTGHSLGA G  EAIY ++MMQ  FI  S
Sbjct: 301 TSTPAGDVTEVRAIRRIFGEGKVPPISSTKSLTGHSLGATGVHEAIYSILMMQGDFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DPE +   I     +  +ID+VLSNSFGFGGTNA+L+  ++ 
Sbjct: 361 ANVTQLDPEIQPDEIATTLREGVEIDSVLSNSFGFGGTNASLLLSKFN 408


>gi|126464651|ref|YP_001045764.1| beta-ketoacyl synthase [Rhodobacter sphaeroides ATCC 17029]
 gi|126106462|gb|ABN78992.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 409

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/408 (58%), Positives = 300/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  SLR  RSGI+FSE++A  GFR Q+ G P L   + +
Sbjct: 1   MRRVVITGIGIVSPIGNNAAEVEASLRAGRSGISFSEEYAHHGFRSQIHGMPDLVLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AM++AI DS L+  E+++ RTGL+ GSGGPST     A  +  
Sbjct: 61  DKRDLRFMGAGAAYNFIAMEQAIKDSGLEATEVSNPRTGLVMGSGGPSTSNFFQAHKIVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGSPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGTELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +ASRP+D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIVFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRPFDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+E A ARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR AL ++ E   VDYIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGYGATSDGADMVAPSGEGGERSMRLALGTLPEGRRVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EV AIR +F +G +P I STKSLTGHSLGA G  EAIY ++MMQ  FI  S
Sbjct: 301 TSTPAGDVTEVRAIRRIFGEGKVPPISSTKSLTGHSLGATGVHEAIYSILMMQGDFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DPE +   I     +  +ID+VLSNSFGFGGTNA+L+  ++ 
Sbjct: 361 ANVTQLDPEIQPDEIATTLREGVEIDSVLSNSFGFGGTNASLLLSKFN 408


>gi|320540360|ref|ZP_08040011.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I [Serratia
           symbiotica str. Tucson]
 gi|320029581|gb|EFW11609.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase I [Serratia
           symbiotica str. Tucson]
          Length = 404

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/403 (58%), Positives = 299/403 (74%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SL+E RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVRESLQEGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    + +L+M+EAI D+ L   +++++RTGL+ GSGG S +  V+ +D  R
Sbjct: 61  DRKVMRFMSDASVYAYLSMEEAIKDAGLTADQVSNDRTGLVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W M+  FDAMGA+S+++N  P  ASR YD+ RDGF+I+GG  ++V+E
Sbjct: 180 QDIVFAGGGEELCWEMACEFDAMGALSTNYNDTPEKASRTYDAARDGFIIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL  ++ P+DY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIIGYGATSDGADMVAPSGEGAVRCMKMALQGIDTPIDYMNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF  NIP I STK++TGHSLGAAG QEAIYCL+M++  FI  S NI
Sbjct: 300 TPVGDVKELGAIREVFGDNIPAISSTKAMTGHSLGAAGVQEAIYCLLMVEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           E +D    GI IV +     ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 ENLDAHAVGINIVTQPTQR-QLTTVMSNSFGFGGTNATLVMRK 401


>gi|332560795|ref|ZP_08415113.1| 3-oxoacyl-(acyl carrier protein) synthase II [Rhodobacter
           sphaeroides WS8N]
 gi|332274593|gb|EGJ19909.1| 3-oxoacyl-(acyl carrier protein) synthase II [Rhodobacter
           sphaeroides WS8N]
          Length = 409

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/408 (58%), Positives = 300/408 (73%), Gaps = 3/408 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+GIVS IGNN +EV  SLR  RSGI+FSE++A  GFR Q+ G P L   + +
Sbjct: 1   MRRVVITGIGIVSPIGNNAAEVEASLRAGRSGISFSEEYAHHGFRSQIHGMPDLVLEDHV 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D++ +RF+  G  +  +AM++AI DS L+  E+++ RTGL+ GSGGPST     A  +  
Sbjct: 61  DKRDLRFMGPGAAYNFIAMEQAIKDSGLEAAEVSNPRTGLVMGSGGPSTSNFFQAHKIVI 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E  S +R+GPF V + MSST SA L+T FKI+G +YSI+SAC+TSAHCIGN  ELIQ GK
Sbjct: 121 EKGSPKRMGPFMVTRCMSSTNSACLATPFKIKGVNYSITSACSTSAHCIGNGTELIQMGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+LDWT+S LFDAMGAMSS +N  P +ASRP+D+ RDGFVI+GG  V+VLE
Sbjct: 181 QDIVFAGGGEELDWTLSCLFDAMGAMSSKYNDAPETASRPFDATRDGFVIAGGGGVVVLE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEP--VDYINTHG 298
           E+E A ARGAKIYAE+TGYG+T DG DMV+PSGEG  R MR AL ++ E   VDYIN HG
Sbjct: 241 ELEHALARGAKIYAEVTGYGATSDGADMVAPSGEGGERSMRLALGTLPEGRRVDYINAHG 300

Query: 299 TATPKGDKKEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           T+TP GD  EV AIR +F +G +P I STKSLTGHSLGA G  EAIY ++MMQ  FI  S
Sbjct: 301 TSTPAGDVTEVRAIRRIFGEGKVPPISSTKSLTGHSLGATGVHEAIYSILMMQGDFIAAS 360

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            N+ ++DPE +   I     +  +ID+VLSNSFGFGGTNA+L+  ++ 
Sbjct: 361 ANVTQLDPEIEPDEIATTLREGVEIDSVLSNSFGFGGTNASLLLSKFN 408


>gi|311695872|gb|ADP98745.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [marine bacterium HP15]
          Length = 403

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 225/403 (55%), Positives = 293/403 (72%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSS+G N  EVA SLRE+RSGI FSE+    G R  + G+  LN  ELI
Sbjct: 1   MRRVVITGMGIVSSLGTNQKEVAQSLRESRSGIGFSEEARDNGLRSHICGQINLNLPELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +LAM EAI  + L    I  + TG+I G GG ST  ++ + D  R
Sbjct: 61  DRKLWRFMCPASGYTYLAMLEAIEQAGLTDEHIKADTTGIIFGQGGASTVELLDSIDTHR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    RR+GP+ VP+ M S  +A+L+T F IRG +Y I+SACATSAH IG+AA+LI  G+
Sbjct: 121 DR-GIRRVGPYRVPRTMGSAINASLATGFGIRGINYGITSACATSAHSIGHAADLIALGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG ED+ WT+S LFDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  V+ LE
Sbjct: 180 QDVMFAGGGEDIHWTLSLLFDAMGALSTKYNDTPELASRTYDANRDGFVISGGGGVLALE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I AEL G+G+T DG DMV+PSGEGA+RCM+QA+ +++  + Y+NTHGT+
Sbjct: 240 ALEHAEARGANILAELVGFGATSDGADMVAPSGEGAVRCMKQAMKNLDGEISYVNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A++E F   IP + STK L GH+LGAAG  EAIY LIM++E FI  S NI
Sbjct: 300 TPAGDITELKALKETFGDKIPPLSSTKPLCGHALGAAGVHEAIYSLIMLREGFIAPSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +++D   +G PIVR+R+DN K+D V+SNSFGFGGTNA+LVF++
Sbjct: 360 QDLDEGAEGYPIVRERMDNQKLDLVMSNSFGFGGTNASLVFKK 402


>gi|183599674|ref|ZP_02961167.1| hypothetical protein PROSTU_03163 [Providencia stuartii ATCC 25827]
 gi|188021928|gb|EDU59968.1| hypothetical protein PROSTU_03163 [Providencia stuartii ATCC 25827]
          Length = 404

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 303/406 (74%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE+F + G R  VWG   ++   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLKEGRSGITFSEEFKEAGLRSHVWGNVKMDTDGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M++AI+DS L   ++++ RTGL+ GSGG S +  V+ +D  R
Sbjct: 61  DRKIRRFMSDCSVYAYLSMEQAISDSGLTDEQVSNLRTGLVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTRAMASGISACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELSWEMTCEFDAMGALSTKYNDTPSKASRTYDTDRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++  VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGIDGKVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+EVF  + P I +TK++TGHSLGAAG  EAIY L+M++  FI  S N+
Sbjct: 300 TPVGDTKELEAIQEVFGNDSPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINV 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E +DP+ +G+ IV K  + A ++TV+SNSFGFGGTNATLV  +YKG
Sbjct: 360 ENLDPKAQGLNIVTKPTEQA-LETVMSNSFGFGGTNATLVMSKYKG 404


>gi|330823214|ref|YP_004386517.1| beta-ketoacyl-acyl-carrier-protein synthase I [Alicycliphilus
           denitrificans K601]
 gi|329308586|gb|AEB83001.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Alicycliphilus
           denitrificans K601]
          Length = 405

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/404 (54%), Positives = 288/404 (71%), Gaps = 2/404 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           RRV +TG GIVS IGN++  V  +LRE RSGI     F + G R QV G P ++    ID
Sbjct: 4   RRVVITGAGIVSCIGNDLQTVESALREGRSGIKAVPKFTELGLRSQVAGVPEIDIEARID 63

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     +  +A+++AI  + L P +++H RTGLI GSGG S    + AAD  RE
Sbjct: 64  RKQLRFMGDAAAYAQIALEDAIAQAGLTPSQVSHPRTGLIMGSGGGSPANQIEAADTLRE 123

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA L+T FK++G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 124 K-GIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSACSTSAHCIGAAAQQIAWGMQ 182

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E+L W M+ LFD MGAMS+ +N  P  A+R YD+ RDGFVI+GG   +VLE 
Sbjct: 183 DVMFAGGGEELSWGMALLFDGMGAMSAKYNATPEKAARAYDANRDGFVIAGGGGAVVLES 242

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGA I AE+ G+G+T DG+DMV+PSG+GAI CMRQA+  ++ P+DYINTHGT+T
Sbjct: 243 LEHAQARGATILAEVVGFGATSDGEDMVAPSGDGAIACMRQAMEGLDGPIDYINTHGTST 302

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD +EV A++ VF   +P   STKSLTGHSLGA G QEAIYCLIM+ + FI  S N+E
Sbjct: 303 PVGDMQEVRAMQAVFGDAVPPFSSTKSLTGHSLGATGVQEAIYCLIMLNKGFIAGSVNVE 362

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             DP+  G+P+V +  D A + +VLSNSFGFGGTNA+LV RR+K
Sbjct: 363 TPDPQLGGMPLVMQTRD-ADLTSVLSNSFGFGGTNASLVLRRWK 405


>gi|85059601|ref|YP_455303.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Sodalis glossinidius
           str. 'morsitans']
 gi|84780121|dbj|BAE74898.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Sodalis glossinidius
           str. 'morsitans']
          Length = 403

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 291/404 (72%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGN+  EV  SL+E RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGILSSIGNDQKEVLASLQEGRSGITFSQELKDSGMRSHVWGNIKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    +  L+M++AI D+ L P  ++++R+GLI GSGG S +  V+ +D  R
Sbjct: 61  DRKMARFMSDASVYAFLSMEQAIADAGLTPDMVSNDRSGLIVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSAC+TSAHCIGNA E+IQ GK
Sbjct: 121 AR-GLRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACSTSAHCIGNAVEMIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  AS  YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELCWEMACEFDAMGALSTRYNETPTKASCTYDVNRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL  V+ PVDY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIIGYGATSDGADMVAPSGEGAIRCMQMALKDVDTPVDYLNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIRE F    P   STK++TGHSLGAAG  E I+ L+M++  FI  S NI
Sbjct: 300 TPVGDVKELWAIRETFGSQHPAFSSTKAMTGHSLGAAGVHETIFTLLMLEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E++DP+ +G+ ++ +    A + TV+SNSFGFGGTNATLV R+Y
Sbjct: 360 EQLDPQAEGMNVITEPTRRA-LTTVMSNSFGFGGTNATLVMRKY 402


>gi|148245034|ref|YP_001219728.1| 3-oxoacyl-[acyl-carrier-protein] synthase I/II [Candidatus
           Vesicomyosocius okutanii HA]
 gi|146326861|dbj|BAF62004.1| 3-oxoacyl-[acyl-carrier-protein] synthase I/II [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 404

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 225/406 (55%), Positives = 292/406 (71%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M RV VTGMG+VSS+G N +EV  SL+ ++SGI F++     G R  + G    +N+ E+
Sbjct: 1   MHRVVVTGMGVVSSLGVNCAEVLNSLKTSKSGIKFNKTQENIGLRSHLSGTISEINSDEI 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK  RF++    +  +A+ EAI  S L   +I++ERTGLI GSGG S + IV A D+ 
Sbjct: 61  IDRKMKRFMADAAIYNAVALDEAIKQSGLTKVQISNERTGLIMGSGGASNQNIVEATDIL 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R+    +R+GP+ VP+ M ST SA LST FKI+G +YSISSAC+TSAHCIGNA E IQ G
Sbjct: 121 RKK-GIKRVGPYRVPRTMGSTTSACLSTLFKIKGINYSISSACSTSAHCIGNAMEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+LDW+++ LFDAMGA+SS +N  P  ASR +D  RDGF+ISGG   + L
Sbjct: 180 KQDVVFAGGGEELDWSLTMLFDAMGALSSKYNKFPEQASRAFDKGRDGFIISGGGGALAL 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           E +E A+ARGA I AELTGYG+T DG DMV PSG+GA RCM  A+S+V  P++YIN HGT
Sbjct: 240 ESLEYAQARGATILAELTGYGATSDGYDMVVPSGDGAKRCMEIAISTVNGPINYINAHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AI+EVF  NIP I STKSL+GH+LGAAG  E+IY L+M+Q  F+ +S N
Sbjct: 300 STPIGDIKELNAIKEVFGDNIPNISSTKSLSGHALGAAGVNESIYSLLMLQNNFMTKSVN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           I  +D   KG+PI++  I     + V+SNSFGFGGTNA LVF ++K
Sbjct: 360 INILDEAAKGMPIIQTTIKQT-FNRVMSNSFGFGGTNACLVFEKFK 404


>gi|221065016|ref|ZP_03541121.1| Beta-ketoacyl synthase [Comamonas testosteroni KF-1]
 gi|220710039|gb|EED65407.1| Beta-ketoacyl synthase [Comamonas testosteroni KF-1]
          Length = 407

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/405 (54%), Positives = 291/405 (71%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV +TG GIVS IGN+++ V  SLRE +SGI    +F + G R QV G P ++    ID
Sbjct: 4   KRVVITGAGIVSCIGNDLATVEASLREGKSGIKAMPEFTELGMRSQVAGIPEIDIEARID 63

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     +  +A+++AI  + L P ++++ RTGLI GSGG S    + AAD  RE
Sbjct: 64  RKQLRFMGDAAAYSQIALEDAIQQAGLTPEQVSNPRTGLIMGSGGGSPANQIEAADTLRE 123

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA L+T FK++G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 124 K-GIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSACSTSAHCIGAAAQQIAWGMQ 182

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E+L W MS LFD MGAMSS +N  P  ASR YD+ RDGFVI+GG   +VLE 
Sbjct: 183 DVMFAGGGEELSWGMSLLFDGMGAMSSKYNETPEKASRAYDAHRDGFVIAGGGGAVVLES 242

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A ARGA I AE+ G+G+T DG+DMV+PSG+GAI CM+QA+ +V+ P+DYINTHGT+T
Sbjct: 243 LEHALARGANILAEVVGFGATSDGEDMVAPSGDGAIACMKQAMETVDAPIDYINTHGTST 302

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD +EV A+RE+F   +P   STKSLTGHSLGA G QEAIYCLIM+ + FI  S N++
Sbjct: 303 PVGDMQEVRAMRELFGDQVPAFSSTKSLTGHSLGATGVQEAIYCLIMLNKGFIAGSVNVD 362

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             DP    +P+V  R  +A++ TVLSNSFGFGGTNA+LV +R++G
Sbjct: 363 TPDPLLGDMPLV-TRTRDAELKTVLSNSFGFGGTNASLVLKRWEG 406


>gi|160896721|ref|YP_001562303.1| beta-ketoacyl synthase [Delftia acidovorans SPH-1]
 gi|160362305|gb|ABX33918.1| Beta-ketoacyl synthase [Delftia acidovorans SPH-1]
          Length = 407

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 287/405 (70%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           RRV +TG GIVS IGN++  V  SLRE R+GI     F + G R QV G P ++    ID
Sbjct: 4   RRVVITGAGIVSCIGNDLDTVETSLREGRTGIKAMPKFTELGMRSQVAGVPEIDVEARID 63

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     +  +A+++AI  + L P +++H RTGLI GSGG S    + AAD  RE
Sbjct: 64  RKQLRFMGDAAAYAQIALEDAIAQAGLAPEQVSHPRTGLIMGSGGGSPANQIEAADTLRE 123

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA L+T FK++G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 124 K-GIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSACSTSAHCIGAAAQQIAWGMQ 182

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E+L W M+ LFD MGAMSS  N  P  ASR YD+ RDGFVI+GG   +VLE 
Sbjct: 183 DVMFAGGGEELSWGMALLFDGMGAMSSKHNDQPEKASRAYDANRDGFVIAGGGGAVVLES 242

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGA I AE+ G+G+T DG+DMV+PSG+GAI CM+QAL  +E  VDYINTHGT+T
Sbjct: 243 LEHAQARGANILAEVVGFGATSDGEDMVAPSGDGAIACMQQALEGIEGGVDYINTHGTST 302

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD +EV A+R +F   +P   STKSLTGHSLGA G QEAIYC+IMM + FI  S N++
Sbjct: 303 PVGDMQEVRAMRALFGDQVPPFSSTKSLTGHSLGATGVQEAIYCMIMMNKGFIAGSVNVD 362

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             DP    +P+V  R  +A+++TVLSNSFGFGGTNA+LV RR++G
Sbjct: 363 TPDPALGDMPLV-TRTRDAQLNTVLSNSFGFGGTNASLVLRRWQG 406


>gi|319761339|ref|YP_004125276.1| beta-ketoacyl synthase [Alicycliphilus denitrificans BC]
 gi|317115900|gb|ADU98388.1| Beta-ketoacyl synthase [Alicycliphilus denitrificans BC]
          Length = 405

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/404 (54%), Positives = 288/404 (71%), Gaps = 2/404 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           RRV +TG GIVS IGN++  V  +LRE +SGI     F + G R QV G P ++    ID
Sbjct: 4   RRVVITGAGIVSCIGNDLQTVESALREGKSGIKAVPKFTELGLRSQVAGVPEIDIEARID 63

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     +  +A+++AI  + L P +++H RTGLI GSGG S    + AAD  RE
Sbjct: 64  RKQLRFMGDAAAYAQIALEDAIAQAGLTPSQVSHPRTGLIMGSGGGSPANQIEAADTLRE 123

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA L+T FK++G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 124 K-GIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSACSTSAHCIGAAAQQIAWGMQ 182

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E+L W M+ LFD MGAMS+ +N  P  A+R YD+ RDGFVI+GG   +VLE 
Sbjct: 183 DVMFAGGGEELSWGMALLFDGMGAMSAKYNATPEKAARAYDANRDGFVIAGGGGAVVLES 242

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGA I AE+ G+G+T DG+DMV+PSG+GAI CMRQA+  ++ P+DYINTHGT+T
Sbjct: 243 LEHAQARGATILAEVVGFGATSDGEDMVAPSGDGAIACMRQAMEGLDGPIDYINTHGTST 302

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD +EV A++ VF   +P   STKSLTGHSLGA G QEAIYCLIM+ + FI  S N+E
Sbjct: 303 PVGDMQEVRAMQAVFGDAVPPFSSTKSLTGHSLGATGVQEAIYCLIMLNKGFIAGSVNVE 362

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
             DP+  G+P+V +  D A + +VLSNSFGFGGTNA+LV RR+K
Sbjct: 363 TPDPQLGGMPLVTQTRD-ADLTSVLSNSFGFGGTNASLVLRRWK 405


>gi|227327263|ref|ZP_03831287.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 405

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 290/404 (71%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++AI DS L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKIVRFMSDASIYAYLSMEQAIQDSGLSDEVYQNNPRVGLIAGSGG-SARYQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V K+M S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKSMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGAEELCWELACEFDAMGALSTKYNETPEKASRTYDAGRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  F+  S N
Sbjct: 300 STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFVAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E +D +  G+ IV +  +  ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 VENLDEQAAGLNIVTEPTER-ELTTVMSNSFGFGGTNATLVMRK 402


>gi|253689181|ref|YP_003018371.1| Beta-ketoacyl synthase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755759|gb|ACT13835.1| Beta-ketoacyl synthase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 405

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 289/404 (71%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++AI DS L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKIVRFMSDASIYAYLSMEQAIQDSGLSDEVYQNNPRVGLIAGSGG-SARYQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V K+M S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKSMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGAEELCWELACEFDAMGALSTKYNETPEKASRTYDADRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N+HGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMNGVDTPIDYLNSHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  F+  S N
Sbjct: 300 STPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFVAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +E +D +  G+ IV    +  K+ TV+SNSFGFGGTNATLV R+
Sbjct: 360 VENLDEQAAGLNIVTTPTER-KLTTVMSNSFGFGGTNATLVMRK 402


>gi|121609119|ref|YP_996926.1| beta-ketoacyl synthase [Verminephrobacter eiseniae EF01-2]
 gi|121553759|gb|ABM57908.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Verminephrobacter
           eiseniae EF01-2]
          Length = 410

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/405 (56%), Positives = 291/405 (71%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG GIVS IGN+++ V  SLR  RSGI     F++ G R QV G P ++    I
Sbjct: 1   MKRVVITGTGIVSCIGNDMATVTQSLRAGRSGIRAMPQFSELGMRSQVAGVPQIDLEAQI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + H+A+  A+ +S L P +++H RTGLI GSGG S    + AAD+ R
Sbjct: 61  DRKQLRFMGDAAAYAHIALARAVAESGLAPGQVSHPRTGLIMGSGGGSPANQIEAADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RR+GP+ V + M ST SA LST F I+G +YSI+SAC+TSAHCIG AA+ I  G 
Sbjct: 121 SK-GIRRVGPYQVTRCMGSTVSACLSTHFGIKGINYSITSACSTSAHCIGAAAQQIAWGM 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E++ W M  LFDAMGAMSS +N  P  ASR YD+RRDGFV+SGG   +VLE
Sbjct: 180 QDVMFAGGGEEVTWGMGLLFDAMGAMSSAYNATPEKASRAYDARRDGFVLSGGGGAVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I  EL G+G+T DG DMV+PSG+GA+ CMRQA+++V+EP+DYINTHGT+
Sbjct: 240 SLEHAQARGATILGELIGFGATSDGADMVAPSGDGAVACMRQAIATVQEPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIR VF   IP   STKSLTGHSLGA G QEAIYCL+M+++ FI  S NI
Sbjct: 300 TPVGDVPELRAIRTVFGAAIPPFSSTKSLTGHSLGATGVQEAIYCLLMLRQGFIAGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E ++PE +G+P+VR   D A I T LSNSFGFGGTNA+LV RR++
Sbjct: 360 ETLEPEAEGMPLVRATRD-APIRTALSNSFGFGGTNASLVLRRWE 403


>gi|88704343|ref|ZP_01102057.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Congregibacter
           litoralis KT71]
 gi|88701394|gb|EAQ98499.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Congregibacter
           litoralis KT71]
          Length = 408

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 302/406 (74%), Gaps = 3/406 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           RRV VTG+GIVS +GN+   V  +L + RSGI+ ++     G R  V G P ++  E ID
Sbjct: 3   RRVVVTGLGIVSCLGNDAETVTQALHDGRSGISTNQAQIDAGMRSHVAGAPDIDFKEHID 62

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     + ++AMQ  I D+ L   EI+++RTG+IAGSGG S+     AAD+ RE
Sbjct: 63  RKQLRFMGAAAAYAYIAMQRCIADAGLSDSEISNDRTGIIAGSGGASSASQTEAADILRE 122

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + M ST SA L+T FKIRG +YSISSAC+TSAHCIGNA E IQ GKQ
Sbjct: 123 R-GLRRVGPYRVTQTMGSTVSACLATPFKIRGVNYSISSACSTSAHCIGNAMEQIQLGKQ 181

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D +FAGG E+L WTMS+LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++VLE 
Sbjct: 182 DRVFAGGGEELHWTMSSLFDAMGALSTKYNDTPEKASRAYDADRDGFVIAGGGGMVVLEA 241

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGAKIYAEL GYG+T DG DMV+PSGEGA+RCM+QAL++VE P+DYIN HGT+T
Sbjct: 242 LEVAQARGAKIYAELVGYGATSDGYDMVAPSGEGAVRCMQQALATVEGPIDYINAHGTST 301

Query: 302 PKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           P GD +E++A+RE F  KG  P I STKSL+GHSLGAAG QEAIY L+M +  FI  S N
Sbjct: 302 PAGDIQELKAVREAFSDKGYTPVIGSTKSLSGHSLGAAGVQEAIYSLLMQKAGFIAASAN 361

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +DPE +G+PI R+R DN ++  V+SNSFGFGGTNA+LVF+ +K
Sbjct: 362 IENLDPEAEGMPIARERHDNQELQRVMSNSFGFGGTNASLVFQAFK 407


>gi|238020229|ref|ZP_04600655.1| hypothetical protein GCWU000324_00104 [Kingella oralis ATCC 51147]
 gi|237868623|gb|EEP69627.1| hypothetical protein GCWU000324_00104 [Kingella oralis ATCC 51147]
          Length = 407

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 297/404 (73%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVSS+GNN  EV  SL+  +SGI F E + + G R  V G   ++  E I
Sbjct: 4   MKRVVVTGIGIVSSLGNNCREVLASLQNLKSGIAFDESYREMGLRSNVAGNINIDLKEHI 63

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQEAI ++ L   ++++ RTG++AGSGG S+   V AAD+ R
Sbjct: 64  DRKILRFMGSAPAYAYIAMQEAIENAGLTEAQVSNIRTGIVAGSGGASSASQVEAADVLR 123

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +R+GP+AV K M ST +A L+T FKI+G +YSISSAC+TSAHCIG+AAELIQ GK
Sbjct: 124 A-SGIKRVGPYAVTKTMGSTVAACLATPFKIKGVNYSISSACSTSAHCIGHAAELIQLGK 182

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W MS+LFDAMGA+SS +N  P  ASR YD+ RDGFVISGG +++VLE
Sbjct: 183 QDIVFAGGGEEVSWQMSSLFDAMGALSSKYNDTPERASRAYDANRDGFVISGGGSILVLE 242

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I  ELTGYG+T DG DMV PSGEGA+RCM+ AL+     VDYIN HGT+
Sbjct: 243 EYEHAKARGANIICELTGYGATSDGYDMVQPSGEGAVRCMQMALAQHGGSVDYINAHGTS 302

Query: 301 TPKGDKKEVEAIREVFKGN-IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD +E+ AIRE F G  +P I STKSL+GH+LGAAG+ EAIY ++MMQ  F+  S N
Sbjct: 303 TPVGDTRELGAIREAFAGQTVPMISSTKSLSGHALGAAGSNEAIYSILMMQNDFVCASAN 362

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           IE +D   +G+PIVR+     K++ V+SNSFGFGGTNATL+F R
Sbjct: 363 IETLDELAEGLPIVREN-RQVKLNAVMSNSFGFGGTNATLIFSR 405


>gi|225025314|ref|ZP_03714506.1| hypothetical protein EIKCOROL_02212 [Eikenella corrodens ATCC
           23834]
 gi|224941932|gb|EEG23141.1| hypothetical protein EIKCOROL_02212 [Eikenella corrodens ATCC
           23834]
          Length = 403

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 297/404 (73%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVSS+GNN  EV  SLR+ +SGI F E + + G R  V G   ++  E I
Sbjct: 1   MKRVVVTGIGIVSSLGNNCREVLESLRQLKSGIAFDESYREMGLRSHVAGNIKIDTKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AM+EAI  + L   ++++ RTG++AGSGG S+   V AAD  R
Sbjct: 61  DRKILRFMGNAAAYAYIAMKEAIAHAGLTEEQVSNVRTGIVAGSGGASSASQVEAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+ V K M+ST +A L+T FKI+G +YSISSAC+TSAHCIG+AAELIQ GK
Sbjct: 121 E-SGVKRIGPYGVTKTMASTVAACLATPFKIKGVNYSISSACSTSAHCIGHAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W MS+LFDAMGA+SS +N  P  ASR YD+ RDGFVISGG +++V+E
Sbjct: 180 QDIVFAGGGEEVSWQMSSLFDAMGALSSKYNDTPEQASRAYDADRDGFVISGGGSILVME 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I  ELTGYG+T DG DMV PSGEGA+RCM+ AL+     VDYIN HGT+
Sbjct: 240 EYEHAKARGANILCELTGYGATSDGHDMVQPSGEGAVRCMQMALAQHGGSVDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGN-IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD KE+ AIRE F+G  +P I STKSL+GH+LGAAG+ EAIY ++MM   F+  S N
Sbjct: 300 TPVGDTKELGAIRETFEGKEVPLISSTKSLSGHALGAAGSNEAIYSILMMLNDFVCASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           +  +D +  G+PIVR+ I   K++ V+SNSFGFGGTNATL+F R
Sbjct: 360 VLNLDEKAAGLPIVRENIAK-KLNAVMSNSFGFGGTNATLIFSR 402


>gi|329119532|ref|ZP_08248217.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327464465|gb|EGF10765.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 404

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 296/406 (72%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GIVSS+GNN  EV  SL+  +SGI+F E + + G R  V G   ++  + I
Sbjct: 1   MKRVVVTGIGIVSSLGNNCREVLSSLQNLKSGISFDESYREMGMRSHVAGNIKIDPKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AMQEAI  + L   ++++ RTG++ GSGG S+   V AAD  R
Sbjct: 61  DRKILRFMGNAAAYAYIAMQEAIAHAGLTEEQVSNIRTGIVTGSGGASSSSQVEAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+ V K M+ST SA L+T FKI+G +YSISSAC+TSAHCIG+AAELIQ GK
Sbjct: 121 A-SGVKRIGPYGVTKCMASTVSACLATPFKIKGVNYSISSACSTSAHCIGHAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W MS+LFDAMGA+SS +N  P  ASR YD+ RDGFVISGG +++V+E
Sbjct: 180 QDIVFAGGGEEVHWAMSSLFDAMGALSSKYNDTPEKASRAYDANRDGFVISGGGSILVME 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I  ELTGYG+T DG DMV PSGEGA+RCM+ AL+     VDYIN HGT+
Sbjct: 240 EYEHAKARGANILCELTGYGATSDGYDMVQPSGEGAVRCMQMALAQHGGKVDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGN-IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD KE+ AIREVF G  IP+I STKSL+GH+ GAAG+ EAIY ++MMQ  F   S N
Sbjct: 300 TPVGDTKELGAIREVFAGQEIPFISSTKSLSGHAQGAAGSNEAIYSILMMQNDFACASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +D    G+PIVR+    AK++ V+SNSFGFGGTNATL+F R K
Sbjct: 360 IETLDEHATGLPIVREN-RPAKLNAVMSNSFGFGGTNATLIFSRVK 404


>gi|254516944|ref|ZP_05129002.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [gamma proteobacterium
           NOR5-3]
 gi|219674449|gb|EED30817.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [gamma proteobacterium
           NOR5-3]
          Length = 408

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/406 (57%), Positives = 299/406 (73%), Gaps = 3/406 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           RRV VTG+GIVS +GN+   V  +LR+ RSGI+ ++     G R  + G P ++  E ID
Sbjct: 3   RRVVVTGLGIVSCLGNDADTVTQALRDGRSGISTNQSQIDIGMRSHISGCPDIDFKEHID 62

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     + ++AMQ  I D+ L   E ++ERTG+IAGSGG S      AAD+ RE
Sbjct: 63  RKQLRFMGDAAAYAYIAMQRCIEDAALTESETSNERTGIIAGSGGASAASQTEAADILRE 122

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + M ST SA L+T F+IRG +YSISSAC+TSAHCIGNA E IQ GKQ
Sbjct: 123 R-GLRRVGPYRVTQTMGSTVSACLATPFRIRGINYSISSACSTSAHCIGNAMEQIQLGKQ 181

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D +FAGG E+L WTMS+LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++VLE 
Sbjct: 182 DRVFAGGGEELHWTMSSLFDAMGALSTKYNDTPERASRAYDADRDGFVIAGGGGMVVLEA 241

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGAKIYAEL GYG+T DG DMV+PSGEGA+RCM+QAL++VE PVDYIN HGT+T
Sbjct: 242 LEVAQARGAKIYAELVGYGATSDGYDMVAPSGEGAVRCMQQALATVEGPVDYINAHGTST 301

Query: 302 PKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           P GD +E++A+REVF  K + P I STKSL+GHSLGAAG QEAIY L+M Q  FI  S N
Sbjct: 302 PVGDIQELKAVREVFSTKDHTPIIGSTKSLSGHSLGAAGVQEAIYSLLMQQAGFIAASAN 361

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +D E +G+PI  +R D+  +  V+SNSFGFGGTNA+LVF+++ 
Sbjct: 362 IETLDAEAEGMPIAIERHDDVDLQRVMSNSFGFGGTNASLVFQKFN 407


>gi|264680372|ref|YP_003280282.1| beta-ketoacyl synthase [Comamonas testosteroni CNB-2]
 gi|299532663|ref|ZP_07046051.1| beta-ketoacyl synthase [Comamonas testosteroni S44]
 gi|262210888|gb|ACY34986.1| beta-ketoacyl synthase [Comamonas testosteroni CNB-2]
 gi|298719298|gb|EFI60267.1| beta-ketoacyl synthase [Comamonas testosteroni S44]
          Length = 407

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/405 (54%), Positives = 289/405 (71%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV +TG GIVS IGN+++ V  SLRE +SGI     F + G R QV G P ++    ID
Sbjct: 4   KRVVITGAGIVSCIGNDLATVEASLREGKSGIKAMPQFTELGMRSQVAGIPEIDIEARID 63

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     +  +A+++AI  + L P +++  RTGLI GSGG S    + AAD  RE
Sbjct: 64  RKQLRFMGDAAAYSQIALEDAIKQAGLTPEQVSSPRTGLIMGSGGGSPANQIEAADTLRE 123

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA L+T FK++G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 124 K-GIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSACSTSAHCIGAAAQQIAWGMQ 182

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E+L W MS LFD MGAMSS +N  P  ASR YD+ RDGFVI+GG   +VLE 
Sbjct: 183 DVMFAGGGEELSWGMSLLFDGMGAMSSKYNETPEKASRAYDANRDGFVIAGGGGAVVLES 242

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           ++ A ARGA I AE+ G+G+T DG+DMV+PSG+GAI CM+QA+ +V+ P+DYINTHGT+T
Sbjct: 243 LDHALARGANILAEVVGFGATSDGEDMVAPSGDGAIACMKQAMETVDAPIDYINTHGTST 302

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD +EV A+RE+F   +P   STKSLTGHSLGA G QEAIYCLIM+ + FI  S N+E
Sbjct: 303 PVGDMQEVRAMRELFGDQVPPFSSTKSLTGHSLGATGVQEAIYCLIMLNKGFIAGSVNVE 362

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             DP    +P+V +  D A++ TVLSNSFGFGGTNA+LV +R++G
Sbjct: 363 TPDPLLGDMPLVTQTRD-AELKTVLSNSFGFGGTNASLVLKRWEG 406


>gi|240948528|ref|ZP_04752901.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus minor
           NM305]
 gi|240297036|gb|EER47607.1| 3-oxoacyl-(acyl carrier protein) synthase I [Actinobacillus minor
           NM305]
          Length = 405

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 300/405 (74%), Gaps = 1/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GI+SSIGNN  EV  SL+E +SGI F  +FA+ G R QV G   LN AELI
Sbjct: 1   MKRVVITGIGIISSIGNNKEEVLASLKEGKSGIEFVPEFAEVGMRSQVAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKIYRFMGDAAAYAYLSMKEAIEDSGLTEEQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+  ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVKGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKTPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+D + +G+ IV +R D A + TV+SNSFGFGGTNA LVF++Y+
Sbjct: 361 EELDEQAQGVNIVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYQ 404


>gi|293395111|ref|ZP_06639397.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Serratia odorifera DSM
           4582]
 gi|291422288|gb|EFE95531.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Serratia odorifera DSM
           4582]
          Length = 404

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/403 (58%), Positives = 295/403 (73%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGDVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    +  L+M+EAI DS L   ++++ERTGL+ GSGG S +  V+ +D  R
Sbjct: 61  DRKVMRFMSDASVYAFLSMEEAIKDSGLAADQVSNERTGLVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELCWEMACEFDAMGALSTSYNDTPEKASRTYDAARDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A+  ++ P+DYIN HGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMRMAMQDLDTPIDYINVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF    P I STK++TGHSLGAAG QEAIY L+M++  FI  S NI
Sbjct: 300 TPVGDVKELGAIREVFGDTTPAISSTKAMTGHSLGAAGVQEAIYSLLMVEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           + +D +  G+ IV +  + A + TV+SNSFGFGGTNATLV R+
Sbjct: 360 DNLDEKAAGMDIVTQPTERA-LTTVMSNSFGFGGTNATLVMRK 401


>gi|167854528|ref|ZP_02477309.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus parasuis
           29755]
 gi|167854283|gb|EDS25516.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus parasuis
           29755]
          Length = 405

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/406 (56%), Positives = 299/406 (73%), Gaps = 1/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GI+SSIGNN  EV  SL+E +SGI F   FA+ G R Q+ G   LN AELI
Sbjct: 1   MKRVVITGIGIISSIGNNKEEVLASLKEGKSGIEFVPKFAEVGMRSQIAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEEQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG T DG DMV+PSGEGA RCM+QA+++V+  ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGVTSDGYDMVAPSGEGAERCMKQAMATVKGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKTPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           EE+D + +G+ +V +R D A + TV+SNSFGFGGTNA LVF++Y+G
Sbjct: 361 EELDEQAQGVNVVTERQDKA-LTTVMSNSFGFGGTNACLVFQKYRG 405


>gi|157371605|ref|YP_001479594.1| 3-oxoacyl-(acyl carrier protein) synthase I [Serratia
           proteamaculans 568]
 gi|157323369|gb|ABV42466.1| Beta-ketoacyl synthase [Serratia proteamaculans 568]
          Length = 404

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 297/405 (73%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFSQELKDSGMRSHVWGDVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    + +L+M+EAI DS L   +++++RTGL+ GSGG S +  V+ +D  R
Sbjct: 61  DRKVMRFMSDASVYAYLSMEEAIKDSGLAADQVSNDRTGLVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELCWEMACEFDAMGALSTSYNDTPEKASRTYDAARDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIIGYGATSDGADMVAPSGEGAVRCMKMAMQGVDTPIDYMNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF  N P I STK++TGHSLGAAG QEAIY L+M++  FI  S NI
Sbjct: 300 TPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVQEAIYSLLMVEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+ +
Sbjct: 360 ENLDEKAAGMNIVTQPTQR-ELTTVMSNSFGFGGTNATLVMRKLQ 403


>gi|120556058|ref|YP_960409.1| beta-ketoacyl synthase [Marinobacter aquaeolei VT8]
 gi|120325907|gb|ABM20222.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Marinobacter aquaeolei
           VT8]
          Length = 403

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 291/403 (72%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV VTGMGIVSS+G N  EVA SLRE+RSGI FSE+    G R  V GK  LN +ELI
Sbjct: 1   MRRVVVTGMGIVSSLGTNQKEVAQSLRESRSGIAFSEEARDNGLRSHVAGKIDLNLSELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +LA +EAI  + L   ++    TG + G+GG ST  ++ A D  R
Sbjct: 61  DRKIWRFMSPAAGYCYLAAKEAIEQAGLTDEQLRANTTGAVFGTGGASTVELLDAIDTHR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    RR+GP+ VP+ M S  +A+++T F I G +Y I+SACATSAHCIG+AA+ I  G+
Sbjct: 121 DK-GLRRVGPYRVPRTMGSAINASITTAFGITGINYGITSACATSAHCIGHAADQIALGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+M AGG ED+ WT+S +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG   ++LE
Sbjct: 180 QDVMLAGGGEDIHWTLSLMFDAMGALSTKYNDTPEQASRTYDADRDGFVISGGGGTLILE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I AEL G+G+T DG DMV+PSGEGAIRCM+QA+++++  + YINTHGT+
Sbjct: 240 SLEHAEARGATILAELVGFGATSDGADMVAPSGEGAIRCMKQAMANIDGEISYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A++E F   IP + STK L GH+LGAAG  EAIY LIM +E FI  S NI
Sbjct: 300 TPAGDVTELKALKETFGDKIPPLSSTKPLCGHALGAAGVHEAIYSLIMQRENFIAPSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           + +D   +G PIVR+R+DN  ++ V+SNSFGFGGTNATL+F++
Sbjct: 360 QTLDEGAEGYPIVRERMDNQNLNLVMSNSFGFGGTNATLIFKK 402


>gi|270262874|ref|ZP_06191145.1| hypothetical protein SOD_c04990 [Serratia odorifera 4Rx13]
 gi|270043558|gb|EFA16651.1| hypothetical protein SOD_c04990 [Serratia odorifera 4Rx13]
          Length = 404

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 297/405 (73%), Gaps = 2/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFSQELKDSGMRSHVWGDVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+S    + +L+M+EAI DS L   +++++RTGL+ GSGG S +  V+ +D  R
Sbjct: 61  DRKVMRFMSDASVYAYLSMEEAIKDSGLAADQVSNDRTGLVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V KAM+S  SA L+T FKIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTKAMASGVSACLATPFKIRGVNYSISSACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELCWEMACEFDAMGALSTSYNETPEKASRTYDAARDGFVIAGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL  V+ P+DY+N HGT+
Sbjct: 240 ELEHALARGAHIYAEIIGYGATSDGADMVAPSGEGAVRCMKMALQGVDTPIDYMNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF  N P I STK++TGHSLGAAG QEAIY L+M++  FI  S NI
Sbjct: 300 TPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVQEAIYSLLMVEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+ +
Sbjct: 360 DNLDEKAAGMNIVTQPTKR-ELTTVMSNSFGFGGTNATLVMRKLQ 403


>gi|253988919|ref|YP_003040275.1| 3-oxoacyl-(acyl carrier protein) synthase I [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780369|emb|CAQ83530.1| 3-oxoacyl-[acyl-carrier-protein] synthase i (beta-ketoacyl-ac
           synthase i) (kas i) [Photorhabdus asymbiotica]
          Length = 404

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/406 (56%), Positives = 295/406 (72%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE+F + G R  VWG   L+ A LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQKEVLTSLKEGRSGITFSEEFKEIGMRSHVWGNVKLDTAGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +LAM EA+ DS L   ++++ R+GL+ GSGG S    V  AD  R
Sbjct: 61  DRKIQRFMSDASVYAYLAMDEAVKDSGLTDGQVSNIRSGLVVGSGGGSPYNQVVGADGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V ++M+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AR-GLRGVGPYMVTRSMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEELCWEMSCEFDAMGALSTKYNETPEKASRTYDKNRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV PSGEGA+RCM  AL  V+ P+DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGADMVVPSGEGAVRCMNMALQGVKGPIDYVNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIREVF    P I +TK++TGHSLGAAG  EAIY L+M++  F+  S NI
Sbjct: 300 TPAGDLKELEAIREVFGDTTPAISATKAMTGHSLGAAGVHEAIYTLLMLEHGFVAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           E++D +  G+ I+ +  +  K++TV+SNSFGFGGTNA+LV  +Y G
Sbjct: 360 EDLDDKAAGMNIITEPTEQ-KLNTVMSNSFGFGGTNASLVMSKYLG 404


>gi|238788710|ref|ZP_04632502.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia frederiksenii
           ATCC 33641]
 gi|238723305|gb|EEQ14953.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia frederiksenii
           ATCC 33641]
          Length = 407

 Score =  451 bits (1160), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/407 (56%), Positives = 299/407 (73%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGDVKLASEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAITDS L P ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAITDSGLAPEQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMACEFDAMGALSTKYNETPTKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGNNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NIE +D +  G+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIENLDEQAAGMNIITEPTKR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|326318835|ref|YP_004236507.1| beta-ketoacyl-acyl-carrier-protein synthase I [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323375671|gb|ADX47940.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 408

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 286/405 (70%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV +TG GIVS IGN+++ V  SLRE+R GI     FA+ G R QV G P ++    ID
Sbjct: 5   KRVVITGAGIVSCIGNDLATVEASLRESRPGIRAMPKFAELGMRSQVAGVPDIDLEARID 64

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     + H+A+++AI  + L P +++H RTGLI GSGG S +  + +AD+ R 
Sbjct: 65  RKQLRFMGDAAAYAHVALEDAIAQAGLAPDQVSHPRTGLIMGSGGGSPENQIESADILRS 124

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA LST F I+G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 125 K-GIRRVGPYQVTRCMSSTVSACLSTNFGIKGINYSITSACSTSAHCIGAAAQQIAWGMQ 183

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E++ W M  LFDAMGAMSS +N  P  ASR YD+ RDGFV+SGG   +VLE 
Sbjct: 184 DVMFAGGGEEVTWGMGLLFDAMGAMSSKYNDTPEKASRAYDANRDGFVLSGGGGAVVLES 243

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGA I  E+ G+G+T DG DMV+PSG+GAI CMRQA+  ++ P+DYINTHGT+T
Sbjct: 244 LEHAQARGATILGEVIGFGATSDGADMVAPSGDGAIACMRQAIEGLDLPIDYINTHGTST 303

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD  E+ AIR VF   +P   STKSLTGHSLGA G QEAIYCLIM+Q+ FI  S N+E
Sbjct: 304 PVGDVPELRAIRAVFGDAVPPFSSTKSLTGHSLGATGVQEAIYCLIMLQKGFIAGSANVE 363

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             DP  +G+P+V      A + T LSNSFGFGGTNA+LV RR+ G
Sbjct: 364 TPDPAVEGMPLVTA-TREAPLRTALSNSFGFGGTNASLVLRRWDG 407


>gi|126665186|ref|ZP_01736169.1| 3-oxoacyl-(acyl carrier protein) synthase [Marinobacter sp. ELB17]
 gi|126630556|gb|EBA01171.1| 3-oxoacyl-(acyl carrier protein) synthase [Marinobacter sp. ELB17]
          Length = 394

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 218/395 (55%), Positives = 289/395 (73%), Gaps = 2/395 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGI+S +GN++ EV  SL+  +SGI FSE + + GFR Q+ G P ++ + +IDRK  RF+
Sbjct: 1   MGIISCLGNSLDEVTNSLKTGKSGIRFSETYKELGFRSQICGAPDVDTS-VIDRKVRRFM 59

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
           +    + +L+MQ+AI  + L    ++++RTGLIAGSGG S      A D+ R     +RI
Sbjct: 60  ADSAMYSYLSMQQAIAQAGLTDDMVSNDRTGLIAGSGGASCSSQAEAVDILRAK-GVKRI 118

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GP+ VP+ M+ST SA L+T FKIRG +YSISSACATSAHCIG A E IQ GKQDI+FAGG
Sbjct: 119 GPYMVPRIMASTVSACLATAFKIRGVNYSISSACATSAHCIGQAMEQIQLGKQDIVFAGG 178

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+ DW+++ +FDAMGA+S+ +N  P +ASRP+DS+RDGFVI+GG  ++VLEE+E A+ R
Sbjct: 179 GEEEDWSLTMMFDAMGALSTKYNDAPETASRPFDSKRDGFVIAGGGGMLVLEELEHARKR 238

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GA I AELTGYG+T DG DMV+PSGEGA RCM+QA++++   VDYIN HGT+TP GD  E
Sbjct: 239 GANIIAELTGYGATSDGYDMVAPSGEGAQRCMKQAMATMHGKVDYINAHGTSTPVGDAAE 298

Query: 309 VEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK 368
           + A+R  F   +P I STKSL+GHSLGAAG QEAIY L+MMQ  FI  + N+ E+D    
Sbjct: 299 LGAVRNTFVDKVPPISSTKSLSGHSLGAAGVQEAIYSLLMMQNGFIAGTANLNELDAAIA 358

Query: 369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            +PIV     +A ++ V+SNSFGFGGTNA+L+F R
Sbjct: 359 DLPIVGPAGQDATLNAVMSNSFGFGGTNASLIFER 393


>gi|238759045|ref|ZP_04620215.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia aldovae ATCC
           35236]
 gi|238702722|gb|EEP95269.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia aldovae ATCC
           35236]
          Length = 407

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/406 (56%), Positives = 298/406 (73%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  SLR+ RSGITFS++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLRKGRSGITFSQEFKDAGMRSHVWGAVKLESEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAI DS+L   +I++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAIADSKLTEEQISNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHAVELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNDTPEKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMEGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAIY L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIYSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           NI+ +D +  G+ I+ +  +  ++ TV+SNSFGFGGTNATLV R+Y
Sbjct: 361 NIDNLDEQAAGMDIITEPTER-ELTTVMSNSFGFGGTNATLVMRKY 405


>gi|323143094|ref|ZP_08077797.1| 3-oxoacyl-(acyl carrier protein) synthase I [Succinatimonas hippei
           YIT 12066]
 gi|322417144|gb|EFY07775.1| 3-oxoacyl-(acyl carrier protein) synthase I [Succinatimonas hippei
           YIT 12066]
          Length = 405

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/404 (55%), Positives = 288/404 (71%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MR+  +TG GIVSSIG     V  SL+  RSGI    DF + G R QV G   ++  + I
Sbjct: 1   MRKAVITGYGIVSSIGIGKDAVLESLKVGRSGIVAEPDFIEKGMRSQVAGMVNIDFKDYI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+ +RF+     + ++AM+EAI  S L+  ++++ERTGLI GSGG STK  V +AD+ R
Sbjct: 61  DRRDLRFMGDAAAYSYIAMKEAIAMSGLEEKDVSNERTGLIVGSGGGSTKTTVDSADILR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+AV KAMSST SA L+T FKI+G SYS+SSACATSAHCI  A + I  G+
Sbjct: 121 TK-GVKRIGPYAVTKAMSSTTSACLATPFKIKGVSYSVSSACATSAHCIEAACDEIMLGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
            DI+FAGG E  DWT++ LFD MGA+SS +N  P  ASRPYD+ RDGFVI  G  ++V+E
Sbjct: 180 HDIIFAGGGEAADWTIACLFDGMGALSSKYNATPEKASRPYDANRDGFVIGAGGGIVVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           + E AKARGAKI AE+ G+G++ DG DMV+PSGEGA RCMRQAL +   P+DYINTHGT+
Sbjct: 240 DEEHAKARGAKILAEVVGFGASSDGYDMVAPSGEGAERCMRQALRTCPYPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD KE+EAI+ VFK  +P I STKS+TGH+LGAAG  EAIY LIM++  FI  S NI
Sbjct: 300 TVVGDVKEIEAIKSVFKDKVPPISSTKSMTGHALGAAGVNEAIYSLIMLENSFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           + +D   +G+ IV     +A I+TV+SNSFGFGGTNATL+ R+Y
Sbjct: 360 DTLDESAQGLDIVANTARSAAINTVMSNSFGFGGTNATLILRKY 403


>gi|259907884|ref|YP_002648240.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Erwinia pyrifoliae
           Ep1/96]
 gi|224963506|emb|CAX54995.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Erwinia pyrifoliae
           Ep1/96]
 gi|283477756|emb|CAY73672.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Erwinia pyrifoliae DSM
           12163]
          Length = 407

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/407 (55%), Positives = 293/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           M+R  +TG+GIVSSIGNN  EV  SLR  RSGITFS++    G R  VWG   L+  ++ 
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLRAGRSGITFSQELKDSGMRSHVWGNVKLSEEDIK 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAA 116
             IDRK +RF+S    +  L+MQ+A+ DS L   +  +  R GL+AGSGG S     ++ 
Sbjct: 61  ARIDRKMLRFMSGASVYAFLSMQQAVQDSGLTDEQYQNNPRVGLVAGSGGGSPFYQAASV 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D  R     R +GP+ V +AM+S  SA L+T FKI+G +YSISSACATSAHCIGNA E I
Sbjct: 121 DGMRAK-GLRGVGPYMVTRAMASGVSACLATPFKIQGVNYSISSACATSAHCIGNAVEQI 179

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  +
Sbjct: 180 QLGKQDIVFAGGGEELCWEMSCEFDAMGALSTDYNDTPEKASRTYDTARDGFVIAGGGGM 239

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A+  V+ P+DY+NT
Sbjct: 240 VVVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAMRCMRMAMEGVDTPIDYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIR VF G  P + +TK++TGHSLGAAG QEAIY L+M++  F+  
Sbjct: 300 HGTSTPIGDVKELGAIRAVFPGKTPAMSATKAMTGHSLGAAGVQEAIYSLLMLEHGFVAP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S NI+E+DP  +G+ IV + ++  ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 SINIDELDPAAEGLDIVTQPVER-QLTTVMSNSFGFGGTNATLVMRK 405


>gi|120612817|ref|YP_972495.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Acidovorax citrulli
           AAC00-1]
 gi|120591281|gb|ABM34721.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Acidovorax citrulli
           AAC00-1]
          Length = 408

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 284/405 (70%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV +TG GIVS IGN+++ V  SLRE+R GI     F + G R QV G P ++    ID
Sbjct: 5   KRVVITGAGIVSCIGNDLATVEASLRESRPGIRAMPKFTELGMRSQVAGVPDIDLEARID 64

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     + H+A+++AI  S L P +++H RTGLI GSGG S +  + +AD+ R 
Sbjct: 65  RKQLRFMGDAAAYAHIALEDAIAQSGLAPDQVSHPRTGLIMGSGGGSPENQIESADILRS 124

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA LST F I+G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 125 K-GIRRVGPYQVTRCMSSTVSACLSTNFGIKGINYSITSACSTSAHCIGAAAQQIAWGMQ 183

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E++ W M  LFDAMGAMSS +N  P  ASR YD+ RDGFV+SGG   +VLE 
Sbjct: 184 DVMFAGGGEEVTWGMGLLFDAMGAMSSKYNDTPEKASRAYDANRDGFVLSGGGGAVVLES 243

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A+ARGA I  E+ G+G+T DG DMV+PSG+GAI CMRQA+  ++ P+DYINTHGT+T
Sbjct: 244 LEHAQARGATILGEVIGFGATSDGADMVAPSGDGAIACMRQAIEGLDAPIDYINTHGTST 303

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD  E+ AIR VF   +P   STKSLTGHSLGA G QEAIYCLIM+Q+ FI  S N+E
Sbjct: 304 PVGDVPELRAIRAVFGDAVPPFSSTKSLTGHSLGATGVQEAIYCLIMLQKGFIAGSANVE 363

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             DP  +G+P+       A + T LSNSFGFGGTNA+LV RR+ G
Sbjct: 364 TPDPAVEGMPLATA-TREAPLRTALSNSFGFGGTNASLVLRRWDG 407


>gi|37527069|ref|NP_930413.1| 3-oxoacyl-(acyl carrier protein) synthase I [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36786502|emb|CAE15558.1| 3-oxoacyl-[acyl-carrier-protein] synthase I (beta-ketoacyl-ACP
           synthase I) (KAS I) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 404

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 233/404 (57%), Positives = 295/404 (73%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SL+E RSGITFSE F + G R  VWG   L+ + LI
Sbjct: 1   MKRVVITGLGIVSSIGNNQKEVLASLKEGRSGITFSEKFKEIGMRSHVWGNVKLDTSGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +LAM+EAI DS L   ++++ R+GL+ GSGG S    V+ AD  R
Sbjct: 61  DRKIQRFMSDASVYAYLAMEEAIKDSGLADDQVSNIRSGLVVGSGGGSPHNQVAGADGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V ++M+S  SA L+T FKI+G +YSISSAC+TSAHCIG+AAELIQ GK
Sbjct: 121 TR-GLRGVGPYMVTRSMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDIVFAGGGEELCWEMSCEFDAMGALSTKYNEMPEKASRTYDKSRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV PSGEGA+RCM  AL  V+  +DY+NTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGADMVVPSGEGAVRCMNMALQDVKGSIDYVNTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAIREVF    P I +TK++TGHSLGAAG  EAIY L+M++  FI  S NI
Sbjct: 300 TPAGDVKELEAIREVFGDTTPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +D +  G+ I+ K  +  K++TV+SNSFGFGGTNA+LV  +Y
Sbjct: 360 EALDDKAVGMNIITKPTEQ-KLNTVMSNSFGFGGTNASLVMSKY 402


>gi|226327930|ref|ZP_03803448.1| hypothetical protein PROPEN_01811 [Proteus penneri ATCC 35198]
 gi|225203634|gb|EEG85988.1| hypothetical protein PROPEN_01811 [Proteus penneri ATCC 35198]
          Length = 403

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 299/405 (73%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE+F + G R  +WG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQKEVLDSLKEGRSGITFSEEFKEMGLRSHIWGNVKLDTEGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+MQEAI DS L   ++++ R+GL+ GSGG S +  V  +D  R
Sbjct: 61  DRKIRRFMSDASVYAYLSMQEAIADSGLSEDQVSNIRSGLVVGSGGGSPRNQVQGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELSWEMTCEFDAMGALSTKYNDTPSKASRTYDKNRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  VE+ VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMQMAMQDVEK-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI EVF  + P I +TK++TGHSLGAAG  EAIY L+M++  FI  S NI
Sbjct: 299 TPVGDLKELEAITEVFGTHTPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+D + +G+ I+ +  +  K++TV+SNSFGFGGTNA+LV  +YK
Sbjct: 359 EELDDKAQGMNIITQPTEQ-KLETVMSNSFGFGGTNASLVMSKYK 402


>gi|188578684|ref|YP_001915613.1| beta-ketoacyl- synthase I [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523136|gb|ACD61081.1| beta-ketoacyl- synthase I [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 394

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 287/395 (72%), Gaps = 2/395 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGI S +GN++  V+ +LRE RSGIT   D A+ G R QV G   L+   LIDRK  RF+
Sbjct: 1   MGINSCLGNDLDTVSSALREGRSGITALPDHAEAGLRSQVGGAVALDLDSLIDRKLKRFM 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
                + +LAM++AI D+ L    ++  RTG+IAGSGG S++  V  ADL R     R++
Sbjct: 61  GDASAYAYLAMRDAIADAGLDAEHVSGLRTGVIAGSGGGSSQWQVETADLLRNR-GVRKV 119

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GP+ VP+ M S  SA+L+T FKIRG SYS+S+ACATSAHCIG AA+LI+ G QD+MFAGG
Sbjct: 120 GPYMVPRTMCSAVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGAQDVMFAGG 179

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+L WTMS +FDAMGA+S+ FN  P  ASRPYD++RDGFVI  G  ++VLE+ + A AR
Sbjct: 180 GEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLEDYDHAIAR 239

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GA+I+AEL GYG T DG DMV+PSGEGA+RCMR A+  ++ P+DY+NTHGT+TP GD  E
Sbjct: 240 GARIHAELLGYGVTSDGADMVAPSGEGAVRCMRMAIQGLDRPIDYLNTHGTSTPLGDVTE 299

Query: 309 VEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK 368
           + A+REVF  N+P + STK L+GHSLGAA   EA+Y L+M+++ F+  S +IEE+DP  +
Sbjct: 300 LGAVREVFGDNVPPLSSTKGLSGHSLGAASVHEAVYSLLMLRDGFMAGSAHIEELDPRAE 359

Query: 369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           G PI+R+    A ++TV+SNSFGFGGTN  LVF R
Sbjct: 360 GFPILRQ-TQEATLNTVMSNSFGFGGTNGALVFGR 393


>gi|227114791|ref|ZP_03828447.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 405

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 288/404 (71%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRL-QPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    + +L+M++AI DS L       + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAYLSMEQAIQDSGLSDEVYQNNPRVGLIAGSGG-SARYQVFGADAM 119

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V K+M S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ G
Sbjct: 120 RSPRGLKAVGPYVVTKSMGSAVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQMG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 180 KQDIVFAGGGEELCWELACEFDAMGALSTKYNETPEKASRTYDADRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++ P+DYINTHGT
Sbjct: 240 EELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMKMAMQDIDTPIDYINTHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF   +P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 300 STPVGDVKELWAIREVFGDKVPPISATKAMTGHSLGAAGVQEAIYTLLMLEHGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           ++ +D   +G+ I+ +  +  ++ TV+SN FGFGGTNA LV R+
Sbjct: 360 VDTLDERAEGMNIITETTER-ELKTVMSNGFGFGGTNAALVMRK 402


>gi|238785995|ref|ZP_04629957.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia bercovieri
           ATCC 43970]
 gi|238713099|gb|EEQ05149.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia bercovieri
           ATCC 43970]
          Length = 407

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/407 (56%), Positives = 297/407 (72%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L A   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGDVKLAAEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAIADSGLSDEQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMACEFDAMGALSTKYNETPTKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMEGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NIE +D +  G+ IV K     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIENLDEQAAGMNIVTKPTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|320355092|ref|YP_004196431.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Desulfobulbus
           propionicus DSM 2032]
 gi|320123594|gb|ADW19140.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Desulfobulbus
           propionicus DSM 2032]
          Length = 402

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 286/403 (70%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSS+G++ +E   SLRE RSGI + E + + G R Q+ G   ++  E I
Sbjct: 1   MRRVVITGMGIVSSLGDSTAEALASLREGRSGIRYHEPYREIGLRAQIGGFTSVDVKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           D+K +RF+     +  +A+ +AI D+ L   E++H RTGLI GSGG S + +V+ AD  R
Sbjct: 61  DKKNLRFMGNAAAYASIALSQAIADAGLAEDEVSHPRTGLIIGSGGTSAENVVATADTMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R+ PF VP+ MSST SA L++  +I G  YSISSACAT +HCIG A E IQ GK
Sbjct: 121 DK-GLKRLSPFMVPRTMSSTVSACLTSTHRIMGLCYSISSACATGSHCIGAAMEQIQMGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG ++  WT + +FDAMGA+S+ +N  P  ASRPYD  RDGFV++ GA ++VLE
Sbjct: 180 QDLVFAGGSDEEHWTQTAMFDAMGALSTRYNDTPERASRPYDRNRDGFVVANGAGIVVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E ERAK RGA IY EL GYG+T DG +MV PSGEGA+RC+R AL++ + P+DYIN HGT+
Sbjct: 240 EYERAKRRGANIYGELVGYGATADGSEMVQPSGEGAVRCIRLALNTAQGPIDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIREVF  + P I STKSL+GHSLGAAG  EAIY L+M+   FI  S NI
Sbjct: 300 TPIGDIVELRAIREVFGPDSPPISSTKSLSGHSLGAAGVHEAIYSLLMLNHGFICGSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           EE+DP+  G  IV    D A + TV+SNS+GFGGTNA LVFRR
Sbjct: 360 EEMDPDAVGHNIVETSRD-ASLSTVMSNSYGFGGTNACLVFRR 401


>gi|212712235|ref|ZP_03320363.1| hypothetical protein PROVALCAL_03321 [Providencia alcalifaciens DSM
           30120]
 gi|212684981|gb|EEB44509.1| hypothetical protein PROVALCAL_03321 [Providencia alcalifaciens DSM
           30120]
          Length = 403

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 301/405 (74%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE+F + G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLKEGRSGITFSEEFKEAGLRSHVWGNVKLDTEGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M++AI DS L   ++++ RTG++ GSGG S +  V+ +D  R
Sbjct: 61  DRKVRRFMSDCSVYAYLSMEQAIKDSGLAEDQVSNLRTGVVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTRAMASGISACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELSWEMTCEFDAMGALSTKYNETPSKASRTYDQDRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+EVF  + P + +TK++TGHSLGAAG QEAIY L+M++  FI  S N+
Sbjct: 299 TPVGDTKELEAIQEVFGHDCPALSATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINV 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D + KG+ I+ K  + A ++TV+SNSFGFGGTNATLV  +YK
Sbjct: 359 ENLDEKAKGLNIITKPTEQA-LNTVMSNSFGFGGTNATLVMSKYK 402


>gi|22125486|ref|NP_668909.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis KIM
           10]
 gi|108808081|ref|YP_651997.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis
           Antiqua]
 gi|108812351|ref|YP_648118.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis
           Nepal516]
 gi|145599281|ref|YP_001163357.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis
           Pestoides F]
 gi|149365231|ref|ZP_01887266.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis
           CA88-4125]
 gi|161511355|ref|NP_993734.2| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162419322|ref|YP_001604979.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis
           Angola]
 gi|165925360|ref|ZP_02221192.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165937140|ref|ZP_02225705.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008094|ref|ZP_02228992.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166214250|ref|ZP_02240285.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399386|ref|ZP_02304910.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167421354|ref|ZP_02313107.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424477|ref|ZP_02316230.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|218929829|ref|YP_002347704.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis CO92]
 gi|229838324|ref|ZP_04458483.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895354|ref|ZP_04510527.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis Pestoides A]
 gi|229898889|ref|ZP_04514034.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229902710|ref|ZP_04517827.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis Nepal516]
 gi|270490117|ref|ZP_06207191.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis KIM
           D27]
 gi|294504657|ref|YP_003568719.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis Z176003]
 gi|21958381|gb|AAM85160.1|AE013762_2 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis KIM
           10]
 gi|108775999|gb|ABG18518.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis
           Nepal516]
 gi|108779994|gb|ABG14052.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis
           Antiqua]
 gi|115348440|emb|CAL21376.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis CO92]
 gi|145210977|gb|ABP40384.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis
           Pestoides F]
 gi|149291644|gb|EDM41718.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis
           CA88-4125]
 gi|162352137|gb|ABX86085.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis
           Angola]
 gi|165915003|gb|EDR33615.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165922967|gb|EDR40118.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992476|gb|EDR44777.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166204606|gb|EDR49086.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960843|gb|EDR56864.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051890|gb|EDR63298.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056359|gb|EDR66128.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229680157|gb|EEO76256.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis Nepal516]
 gi|229688437|gb|EEO80508.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694690|gb|EEO84737.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701662|gb|EEO89688.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis Pestoides A]
 gi|262366645|gb|ACY63202.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis D182038]
 gi|270338621|gb|EFA49398.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia pestis KIM
           D27]
 gi|294355116|gb|ADE65457.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis Z176003]
 gi|320014556|gb|ADV98127.1| Beta-ketoacyl-ACP synthase I [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 407

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/407 (56%), Positives = 299/407 (73%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGDVKLQSEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAIADSGLSDSQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPAKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMAGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGNNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NI+ +D + +G+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIDNLDEQAQGMNIITETTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|51596945|ref|YP_071136.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           pseudotuberculosis IP 32953]
 gi|153950758|ref|YP_001400390.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           pseudotuberculosis IP 31758]
 gi|170023761|ref|YP_001720266.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           pseudotuberculosis YPIII]
 gi|186896026|ref|YP_001873138.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           pseudotuberculosis PB1/+]
 gi|51590227|emb|CAH21864.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia
           pseudotuberculosis IP 32953]
 gi|152962253|gb|ABS49714.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Yersinia
           pseudotuberculosis IP 31758]
 gi|169750295|gb|ACA67813.1| Beta-ketoacyl synthase [Yersinia pseudotuberculosis YPIII]
 gi|186699052|gb|ACC89681.1| Beta-ketoacyl synthase [Yersinia pseudotuberculosis PB1/+]
          Length = 407

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/407 (55%), Positives = 299/407 (73%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGDVKLQSEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAIADSGLSDSQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMACEFDAMGALSTKYNDTPAKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMAGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGNNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NI+ +D + +G+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIDNLDEQAQGMNIITETTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|197285652|ref|YP_002151524.1| 3-oxoacyl-(acyl carrier protein) synthase I [Proteus mirabilis
           HI4320]
 gi|227356157|ref|ZP_03840546.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Proteus mirabilis ATCC
           29906]
 gi|194683139|emb|CAR43733.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Proteus mirabilis
           HI4320]
 gi|227163621|gb|EEI48537.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Proteus mirabilis ATCC
           29906]
          Length = 403

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/405 (56%), Positives = 296/405 (73%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE+F + G R  +WG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLDSLKEGRSGITFSEEFKEMGLRSHIWGNVKLDTEGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+MQ+AI DS L   ++++ R+GL+ GSGG S +  V  +D  R
Sbjct: 61  DRKIRRFMSDASVYAYLSMQQAIEDSGLTEDQVSNIRSGLVVGSGGGSPRNQVQGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELSWEMTCEFDAMGALSTKYNDTPAKASRTYDKNRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  ++  VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGIDH-VDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI EVF    P I +TK++TGHSLGAAG  EAIY L+M++  FI  S NI
Sbjct: 299 TPVGDLKELEAIAEVFGTKTPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           EE+D +  G+ I+ K  +  K+DTV+SNSFGFGGTNA+LV  +YK
Sbjct: 359 EELDDKADGMNIITKPTEQ-KLDTVMSNSFGFGGTNASLVMSKYK 402


>gi|310768208|gb|ADP13158.1| 3-oxoacyl synthase 1 [Erwinia sp. Ejp617]
          Length = 407

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/407 (55%), Positives = 293/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           M+R  +TG+GIVSSIGNN  EV  SLR  RSGITFS++    G R  VWG   L+  ++ 
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLRAGRSGITFSQELKDSGMRSHVWGNVKLSEDDIS 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAA 116
             IDRK +RF+S+   +  L+MQ+A+ DS L   +  +  R GL+AGSGG S +  V + 
Sbjct: 61  ARIDRKMLRFMSKASVYAFLSMQQAVQDSGLTEEQYQNNPRVGLVAGSGGGSPRNQVLSV 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D  R     R +GP+ V +AM+S  SA L+T FKI+G +YSISSACATSAHCIGNA E I
Sbjct: 121 DGMRAK-GLRGVGPYMVTRAMASGVSACLATPFKIQGVNYSISSACATSAHCIGNAVEQI 179

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  +
Sbjct: 180 QLGKQDIVFAGGGEELCWEMSCEFDAMGALSTDYNDTPEKASRTYDTARDGFVIAGGGGM 239

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A+  V+ P+DY+NT
Sbjct: 240 VVVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAMRCMRMAMEGVDTPIDYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIR VF    P + +TK++TGHSLGAAG QEAIY L+M++  F+  
Sbjct: 300 HGTSTPIGDVKELGAIRAVFPDKTPAMSATKAMTGHSLGAAGVQEAIYSLLMLEHGFVAP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S NI+E+D   +G+ IV + ++  ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 SINIDELDSAAEGLDIVTQPVER-QLTTVMSNSFGFGGTNATLVMRK 405


>gi|188533303|ref|YP_001907100.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Erwinia tasmaniensis
           Et1/99]
 gi|188028345|emb|CAO96206.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Erwinia tasmaniensis
           Et1/99]
          Length = 407

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/407 (55%), Positives = 290/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           M+R  +TG+GIVSSIGNN  EV  SLR  RSGITFS++    G R  VWG   L+  ++ 
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLRAGRSGITFSQELKDSGMRSHVWGNVKLSKEDIS 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAA 116
             IDRK +RF+S    +  L+MQ+A+ DS L   +  +  R GL+AGSGG S     ++ 
Sbjct: 61  ARIDRKMLRFMSDASVYAFLSMQQAVLDSGLTDEQYQNNPRVGLVAGSGGGSPFYQAASV 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D  R     R +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E I
Sbjct: 121 DGMRAK-GLRGVGPYMVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQI 179

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  +
Sbjct: 180 QLGKQDIVFAGGGEELCWEMSCEFDAMGALSTKYNETPEKASRTYDTARDGFVIAGGGGM 239

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A+  V+ P+DY+NT
Sbjct: 240 VVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAMRCMRMAMEGVDTPIDYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIR VF    P + +TK++TGHSLGAAG QEAIY L+M++  F+  
Sbjct: 300 HGTSTPVGDVKELGAIRAVFPEKTPAMSATKAMTGHSLGAAGVQEAIYSLLMLEHGFVAP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S NI+E+DP  +G+ IV +  +  ++ TV+SNSFGFGGTNATLV R+
Sbjct: 360 SINIDELDPAAEGLDIVTQPTER-QLTTVMSNSFGFGGTNATLVMRK 405


>gi|254449993|ref|ZP_05063430.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Octadecabacter
           antarcticus 238]
 gi|198264399|gb|EDY88669.1| 3-oxoacyl-(acyl-carrier-protein) synthase 1 [Octadecabacter
           antarcticus 238]
          Length = 401

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 288/401 (71%), Gaps = 3/401 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGIVS IGNNV+EV  +LR  +SG+  SE+  + GFR Q+ G   L+ +E +D++ +RF+
Sbjct: 1   MGIVSPIGNNVAEVDANLRAGKSGVVASEEMKEHGFRSQIAGTLKLDVSEHVDKRTLRFM 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
             G  + H+AM +AI D+ L   ++ +  TGLIAGSGGPST  + +A  +  +  +T+RI
Sbjct: 61  GPGAAYAHIAMGQAIADAGLSEDDVVNPMTGLIAGSGGPSTSAMFAAHQIVLKTGATKRI 120

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GPFAVPK MSST SA L+T +KI+G ++SI+SAC+TS HCIG AA+ I  G QDIMF GG
Sbjct: 121 GPFAVPKTMSSTVSANLATAYKIKGMNFSITSACSTSLHCIGMAAQQIALGTQDIMFGGG 180

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI+GG A++VLE ++ A AR
Sbjct: 181 GEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDANRDGFVIAGGGAMLVLESLDGALAR 240

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEE--PVDYINTHGTATPKGDK 306
           GAKIYAE+TG+ +T DG DMV+PSGEG  R MR AL ++ E   + YIN HGT+TP GD 
Sbjct: 241 GAKIYAEVTGFAATSDGADMVAPSGEGGERAMRGALKTLPEGRKISYINAHGTSTPVGDV 300

Query: 307 KEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDP 365
            EVEA+R VF  G+ P I STKS+TGHS GA GA EAIYCL+ +Q  +I  S NIE +DP
Sbjct: 301 GEVEAVRRVFGTGSTPPISSTKSMTGHSQGATGAHEAIYCLLALQSDYIIPSINIETLDP 360

Query: 366 EFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
                 I    ++NA +DTV++NSFGFGGTN +++  +Y+G
Sbjct: 361 TINAGEIATSLVENAGLDTVMTNSFGFGGTNGSMLLSKYEG 401


>gi|14278623|pdb|1EK4|A Chain A, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex
           With Dodecanoic Acid To 1.85 Resolution
 gi|14278624|pdb|1EK4|B Chain B, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex
           With Dodecanoic Acid To 1.85 Resolution
 gi|14278625|pdb|1EK4|C Chain C, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex
           With Dodecanoic Acid To 1.85 Resolution
 gi|14278626|pdb|1EK4|D Chain D, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex
           With Dodecanoic Acid To 1.85 Resolution
          Length = 418

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 13  MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 72

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 73  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 132

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSA ATSAHCIGNA E IQ G
Sbjct: 133 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLG 192

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 193 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 252

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 253 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 312

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 313 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 372

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 373 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 417


>gi|292488894|ref|YP_003531781.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Erwinia amylovora
           CFBP1430]
 gi|292900038|ref|YP_003539407.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Erwinia amylovora ATCC
           49946]
 gi|291199886|emb|CBJ47010.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Erwinia amylovora ATCC
           49946]
 gi|291554328|emb|CBA21701.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Erwinia amylovora
           CFBP1430]
          Length = 407

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/407 (55%), Positives = 290/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           M+R  +TG+GIVSSIGNN  EV  SLR  RSGITFS++    G R  VWG   L+  ++ 
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLRAGRSGITFSQELKDSGMRSHVWGNVKLSKEDIA 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAA 116
             IDRK +RF+S    +  L+MQ+A+ DS L   +  +  R GL+AGSGG S     ++ 
Sbjct: 61  ARIDRKMLRFMSDASAYAFLSMQQAVQDSGLTEEQYQNNPRVGLVAGSGGGSPFYQAASV 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D  R     R +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIGNA E I
Sbjct: 121 DGMRAK-GLRGVGPYMVTKAMASGVSACLATPFKIQGVNYSISSACATSAHCIGNAVEQI 179

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  +
Sbjct: 180 QLGKQDIVFAGGGEELCWEMSCEFDAMGALSTKYNETPEKASRTYDTARDGFVIAGGGGM 239

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A+  ++ P+DY+NT
Sbjct: 240 VVVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAMRCMRMAMEGLDTPIDYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIR VF G  P + +TK++TGHSLGAAG QEAIY L+M++  F+  
Sbjct: 300 HGTSTPVGDVKELGAIRAVFPGKTPAMSATKAMTGHSLGAAGVQEAIYTLLMLEHGFMAP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S NI+E+DP  +G  IV +  +   + TV+SNSFGFGGTNATLV R+
Sbjct: 360 SINIDELDPAAEGFDIVTEPTER-PLTTVMSNSFGFGGTNATLVMRK 405


>gi|261346193|ref|ZP_05973837.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Providencia
           rustigianii DSM 4541]
 gi|282565849|gb|EFB71384.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Providencia
           rustigianii DSM 4541]
          Length = 403

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 299/405 (73%), Gaps = 3/405 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFSE+F + G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLKEGRSGITFSEEFKEAGLRSHVWGNVKLDTEGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M++AI DS L   ++++ RTG++ GSGG S +  V+ +D  R
Sbjct: 61  DRKIRRFMSDCSVYAYLSMEQAIKDSGLAEDQVSNLRTGVVVGSGGGSPRNQVAGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTRAMASGISACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVVFAGGGEELSWEMTCEFDAMGALSTKYNETPSKASRTYDQDRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+T DG DMVSPSGEGA+RCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEVVGYGATSDGADMVSPSGEGAVRCMQMAMHGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+EAI+EVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S NI
Sbjct: 299 TPVGDTKELEAIQEVFGNNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINI 358

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           E +D +  G+ IV +  + A ++TV+SNSFGFGGTNATLV  + K
Sbjct: 359 ETLDEKATGLNIVTQPTEQA-LNTVMSNSFGFGGTNATLVMSKLK 402


>gi|14278633|pdb|1F91|A Chain A, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex
           With C10 Fatty Acid Substrate
 gi|14278634|pdb|1F91|B Chain B, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex
           With C10 Fatty Acid Substrate
 gi|14278635|pdb|1F91|C Chain C, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex
           With C10 Fatty Acid Substrate
 gi|14278636|pdb|1F91|D Chain D, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex
           With C10 Fatty Acid Substrate
 gi|93279102|pdb|2CF2|A Chain A, Architecture Of Mammalian Fatty Acid Synthase
 gi|93279107|pdb|2CF2|J Chain J, Architecture Of Mammalian Fatty Acid Synthase
          Length = 406

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 233/406 (57%), Positives = 292/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSA ATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSASATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|71892271|ref|YP_278005.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71796377|gb|AAZ41128.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 404

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 287/404 (71%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GI+SSIGNN +EV +SL+  RSG+TFS++  + G R  VWG   LN + LI
Sbjct: 1   MKRAVITGLGIISSIGNNQNEVLVSLKNGRSGVTFSQELKESGMRSHVWGNIKLNTSGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M++AI DS L    +++++TGLI GSGG S +  VS ++  R
Sbjct: 61  DRKIARFMSDASIYTYLSMEQAIIDSGLSTGMVSNDQTGLIVGSGGGSPRNQVSGSNGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V K+M+S  SA L+T FKIRG SYSISSAC+TS HCIGNA ELIQSGK
Sbjct: 121 LR-GLRGVGPYMVTKSMASGVSACLATSFKIRGVSYSISSACSTSTHCIGNAVELIQSGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q I+FAGG E+L W M+  FDAMGA+S+ +N  P  ASRPYD  RDGFVI+GG  ++V+E
Sbjct: 180 QSIIFAGGGEELCWEMACEFDAMGALSTKYNTTPERASRPYDINRDGFVIAGGGGIVVIE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+  A +RGA IYAE+ GYG+T DG DMV+PSGEGAIRCM+ AL +V   +DY+N HGT+
Sbjct: 240 ELTHALSRGAYIYAEIVGYGATSDGCDMVAPSGEGAIRCMKMALRNVGGSIDYLNVHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD KE+ AIRE+F    P   STKS+TGHSLGAAG  E I+ L+M++  FI  S NI
Sbjct: 300 TQIGDIKEIWAIREIFGDQHPSFSSTKSMTGHSLGAAGVHETIFTLLMLKHNFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           + +DP  K + I+       K+ T ++NSFGFGGTNATL+  +Y
Sbjct: 360 DHLDPYMKNMRIIINNPVYRKLKTAMTNSFGFGGTNATLIMSKY 403


>gi|238797442|ref|ZP_04640941.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia mollaretii
           ATCC 43969]
 gi|238718713|gb|EEQ10530.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia mollaretii
           ATCC 43969]
          Length = 407

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 230/407 (56%), Positives = 297/407 (72%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TGMGIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGMGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGAVKLASEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAIADSGLSDEQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNDTPTKASRTYDKDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NI+ +D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIDNLDEQAAGMNIVTEPTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|289827497|ref|ZP_06546109.1| 3-oxoacyl-(acyl carrier protein) synthase I [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
          Length = 405

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 229/396 (57%), Positives = 287/396 (72%), Gaps = 4/396 (1%)

Query: 10  GIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFLS 69
           G VSSIGNN  EV  SLRE RSGITFS++    G R QVWG   L+   LIDRK +RF+S
Sbjct: 11  GHVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMS 70

Query: 70  QGGTWGHLAMQEAITDSRLQPCEI--THERTGLIAGSGGPSTKCIVSAADLTREHCSTRR 127
               + +L+M++A+ D+ L P E+   + R GLIAGSGG S K  V  AD  R     + 
Sbjct: 71  DASIYAYLSMEQAVADAGLAP-EVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKA 129

Query: 128 IGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAG 187
           +GP+ V KAM+S  SA L+T FKI G +YSISSACATSAHCIGNA E IQ GKQDI+FAG
Sbjct: 130 VGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAG 189

Query: 188 GQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKA 247
           G E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+EE+E A A
Sbjct: 190 GGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALA 249

Query: 248 RGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKK 307
           RGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT+TP GD K
Sbjct: 250 RGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGTSTPVGDVK 309

Query: 308 EVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEF 367
           E+ AIREVF  N P I +TK++TGHSLGAAG QEAIY L+M++  FI  S NIEE+D + 
Sbjct: 310 ELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQA 369

Query: 368 KGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            G+ IV +     ++ TV+SNSFGFGGTNATLV R+
Sbjct: 370 AGLNIVTETT-ERELTTVMSNSFGFGGTNATLVMRK 404


>gi|312173055|emb|CBX81310.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Erwinia amylovora ATCC
           BAA-2158]
          Length = 407

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/407 (55%), Positives = 290/407 (71%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           M+R  +TG+GIVSSIGNN  EV  SLR  RSGITFS++    G R  VWG   L+  ++ 
Sbjct: 1   MKRAVITGLGIVSSIGNNQEEVLASLRAGRSGITFSQELKDSGMRSHVWGNVKLSKEDIA 60

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHE-RTGLIAGSGGPSTKCIVSAA 116
             IDRK +RF+S    +  L+MQ+A+ DS L   +  +  R GL+AGSGG S     ++ 
Sbjct: 61  ARIDRKMLRFMSDASAYAFLSMQQAVQDSGLTEEQYQNNPRVGLVAGSGGGSPFYQAASV 120

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
           D  R     R +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIGNA E I
Sbjct: 121 DGMRAK-GLRGVGPYMVTKAMASGVSACLATPFKIQGVNYSISSACATSAHCIGNAVEQI 179

Query: 177 QSGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAV 236
           Q GKQDI+FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  +
Sbjct: 180 QLGKQDIVFAGGGEELCWEMSCEFDAMGALSTKYNETPEKASRTYDTARDGFVIAGGGGM 239

Query: 237 IVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINT 296
           +V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCMR A+  ++ P+DY+NT
Sbjct: 240 VVVEELEHALARGAHIYAEVVGYGATSDGADMVAPSGEGAMRCMRMAMEGLDTPIDYLNT 299

Query: 297 HGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGE 356
           HGT+TP GD KE+ AIR VF G  P + +TK++TGHSLGAAG QEAIY L+M++  F+  
Sbjct: 300 HGTSTPVGDVKELGAIRAVFPGKTPAMSATKAMTGHSLGAAGVQEAIYTLLMLEHGFMTP 359

Query: 357 SKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           S NI+E+DP  +G  IV +  +   + TV+SNSFGFGGTNATLV R+
Sbjct: 360 SINIDELDPAAEGFDIVTEPTER-PLTTVMSNSFGFGGTNATLVMRK 405


>gi|149376030|ref|ZP_01893796.1| beta-ketoacyl synthase [Marinobacter algicola DG893]
 gi|149359667|gb|EDM48125.1| beta-ketoacyl synthase [Marinobacter algicola DG893]
          Length = 403

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/403 (55%), Positives = 285/403 (70%), Gaps = 1/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSS+G N  EV  SLRE+  GI FS++    G R  V G+  LN  ELI
Sbjct: 1   MRRVVITGMGIVSSLGTNQDEVTRSLRESIPGIGFSQEAKDNGLRSHVCGQIDLNLPELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +LAM+EAI  + L   +I    TG+I G+GG ST  ++ A D  R
Sbjct: 61  DRKLMRFMCPASGYTYLAMKEAIEQAGLTEEQIRANSTGVITGAGGASTVELMDAIDTHR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    RR+GP+ VP+ M S  +A+LST F I G +Y I+SACATSAH IG+AA++I  G+
Sbjct: 121 EK-GIRRVGPYRVPRTMGSAINASLSTAFGITGINYGITSACATSAHSIGHAADMIALGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG ED+ WT+S +FDAMGA+S+ +N  P  ASR YD  RDGFVISGG  ++VLE
Sbjct: 180 QDVMFAGGGEDIHWTLSLMFDAMGALSTKYNDTPGKASRTYDRDRDGFVISGGGGILVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I AEL G+G+T DG DMV+PSGEGAIRCM+QA+ +V+  + YINTHGT+
Sbjct: 240 ALEHAEARGANILAELVGFGATSDGADMVAPSGEGAIRCMQQAMKNVDGEISYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++A++E F   IP + STK L GH+LGAAG  EAIY LIM +  FI  S NI
Sbjct: 300 TPAGDVTELKALKETFGDKIPPLSSTKPLCGHALGAAGVHEAIYSLIMQRGNFIAPSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           E +D   +G PIVR+R DN  +  V+SNSFGFGGTN TL+F++
Sbjct: 360 ENLDEGAEGYPIVRERQDNVDLPLVMSNSFGFGGTNGTLIFKK 402


>gi|37912976|gb|AAR05308.1| predicted 3-oxoacyl-(acyl-carrier-protein) synthase [uncultured
           marine gamma proteobacterium EB000-45B06]
 gi|40063207|gb|AAR38044.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [uncultured marine
           bacterium 562]
          Length = 402

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 295/404 (73%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+ V +TG+GI S IGN   +V  SL+  +SGI  +  +A+ GFR QV G   ++ ++LI
Sbjct: 1   MKNVVITGVGIKSCIGNTYDDVLESLKLGKSGIVSNTSYAEMGFRSQVSGSMDIDFSQLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+ +   + +LA Q+AI+ + L   ++   R G++AGSGG ST+ +V+ AD+ R
Sbjct: 61  DRKLLRFMGESAAYSYLAAQDAISMASLSDEQLDSPRVGIVAGSGGASTRVMVTTADIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +RIGP+AV K+M S+ SA L T FKI+G +YSISSACATSAHCIG+ A+LI+SG+
Sbjct: 121 EK-GPKRIGPYAVTKSMGSSISAILGTAFKIKGVNYSISSACATSAHCIGHGADLIKSGQ 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+ AGG ED  W+ S+LFDAMGA+SS+FN +P  ASRPYD  RDGFVISGGA +++LE
Sbjct: 180 QDIVIAGGGEDEHWSSSSLFDAMGALSSNFNDNPSVASRPYDKNRDGFVISGGAGILILE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AK R A I A+L+GY +T DG DMV+PSGEGA+RCM+ AL S    VDYINTHGT+
Sbjct: 240 EEEHAKKRNANILAKLSGYYATSDGYDMVAPSGEGALRCMQGALKSYGSDVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AI E+F  N P I STKS+TGHSLGA GAQEAIY ++M++++FI  S NI
Sbjct: 300 TPVGDIAELNAINELFGDNRPVISSTKSMTGHSLGATGAQEAIYSIMMLRDKFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E++  E KG+ +      +++I + +SNSFGFGGTNA+L+  +Y
Sbjct: 360 EDLCDEAKGLKL-NTETTSSEIKSAMSNSFGFGGTNASLILTKY 402


>gi|163931071|pdb|2VB7|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo
           Structure After Soak In Peg Solution
          Length = 406

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 232/406 (57%), Positives = 291/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFS++    G R  VWG   L+   LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQP-CEITHERTGLIAGSGGPSTKCIVSAADLT 119
           DRK +RF+S    +  L+M++AI D+ L P     + R GLIAGSGG S +  V  AD  
Sbjct: 61  DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     + +GP+ V KAM+S  SA L+T FKI G +YSISSA ATSAHCIGNA E IQ G
Sbjct: 121 RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSAXATSAHCIGNAVEQIQLG 180

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQDI+FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++V+
Sbjct: 181 KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV 240

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N+HGT
Sbjct: 241 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT 300

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIREVF    P I +TK++TGHSLGAAG QEAIY L+M++  FI  S N
Sbjct: 301 STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN 360

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IEE+D +  G+ IV +  D  ++ TV+SNSFGFGGTNATLV R+ K
Sbjct: 361 IEELDEQAAGLNIVTETTDR-ELTTVMSNSFGFGGTNATLVMRKLK 405


>gi|290475968|ref|YP_003468863.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Xenorhabdus bovienii
           SS-2004]
 gi|289175296|emb|CBJ82099.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Xenorhabdus bovienii
           SS-2004]
          Length = 404

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 295/404 (73%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVSSIGNN  EV  SLRE RSGITFSE+F + G R  VWG   L+ + LI
Sbjct: 1   MKRAVITGLGIVSSIGNNQKEVLESLREGRSGITFSEEFKEMGLRSHVWGNIKLDISGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +LAM EAI DS L   ++++ RTGL+ GSGG S +  VS +D  R
Sbjct: 61  DRKTQRFMSDSSVYAYLAMDEAIKDSGLSDEQVSNLRTGLVVGSGGGSPRNQVSGSDGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ GK
Sbjct: 121 AK-GLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+E
Sbjct: 180 QDVIFAGGGEELSWEMACEFDAMGALSTKYNETPELASRTYDQGRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA IYAE+ GYG+  DG DMV+PSGEGA+RCM+ AL  +E  VDYINTHGT+
Sbjct: 240 ELEHALARGAHIYAEIIGYGANSDGADMVAPSGEGAVRCMKLALDGIEGGVDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AIREVF  N P I +TK++TGHSLGAAGA EAIY L+M++   I  S NI
Sbjct: 300 TPIGDLKELGAIREVFGDNTPAISATKAMTGHSLGAAGAHEAIYSLLMLEHGVIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           + +D +  G+ I+ +  +  ++ TV+SNSFGFGGTNA+LV R+Y
Sbjct: 360 DNLDEKALGMNIITEPTER-ELRTVMSNSFGFGGTNASLVMRKY 402


>gi|121592956|ref|YP_984852.1| beta-ketoacyl synthase [Acidovorax sp. JS42]
 gi|222109758|ref|YP_002552022.1| beta-ketoacyl synthase [Acidovorax ebreus TPSY]
 gi|120605036|gb|ABM40776.1| beta-ketoacyl synthase [Acidovorax sp. JS42]
 gi|221729202|gb|ACM32022.1| Beta-ketoacyl synthase [Acidovorax ebreus TPSY]
          Length = 407

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/405 (54%), Positives = 284/405 (70%), Gaps = 2/405 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV +TG GIVS IGN++  V  +LR +RSGI     F + G R QV G P ++    ID
Sbjct: 4   KRVVITGAGIVSCIGNDLQTVEEALRASRSGIKAVPQFTELGLRSQVAGVPEIDVEARID 63

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK +RF+     +  +A+++AI  + L P +++H RTGLI GSGG S    + AAD  RE
Sbjct: 64  RKQLRFMGDAAAYAQIALEDAIQQAGLTPEQVSHPRTGLIMGSGGGSPANQIEAADTLRE 123

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + MSST SA L+T FK++G +YSI+SAC+TSAHCIG AA+ I  G Q
Sbjct: 124 K-GIRRVGPYQVTRCMSSTVSACLATNFKVKGINYSITSACSTSAHCIGAAAQQIAWGLQ 182

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           D+MFAGG E+L W MS LFD MGAMSS +N  P  ASR YD+ RDGFVI+GG   +VLE 
Sbjct: 183 DVMFAGGGEELSWGMSLLFDGMGAMSSKYNATPEKASRAYDANRDGFVIAGGGGAVVLES 242

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A ARGA I  E+ G+G+T DG+DMV+PSG+GAI CM+QA+  +  P+DYINTHGT+T
Sbjct: 243 LEHALARGATILGEVVGFGATSDGEDMVAPSGDGAIACMQQAMEGLGAPIDYINTHGTST 302

Query: 302 PKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIE 361
           P GD +EV A++ VF   +P   STKSLTGHSLGA G QEAIYCLIM+ + FI  S N+E
Sbjct: 303 PVGDMQEVRAMQAVFGEAVPPFSSTKSLTGHSLGATGVQEAIYCLIMLNKGFIAGSANVE 362

Query: 362 EIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             DP    +P+V +  D A++  VLSNSFGFGGTNA+LV RR++G
Sbjct: 363 TPDPLLGSMPLVTQTRD-AQLTHVLSNSFGFGGTNASLVLRRWQG 406


>gi|268590462|ref|ZP_06124683.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Providencia rettgeri
           DSM 1131]
 gi|291314142|gb|EFE54595.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Providencia rettgeri
           DSM 1131]
          Length = 404

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/406 (56%), Positives = 300/406 (73%), Gaps = 4/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M+R  +TG+GIVSS+GNN  EV  SL+E RSGITFSE+F + G R  VWG    L+  +L
Sbjct: 1   MKRAVITGLGIVSSLGNNQEEVLASLKEGRSGITFSEEFKEAGLRSHVWGNVKNLDPKDL 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK  RF+S    + +L+M++AI DS L   ++++ RTG++ GSGG S +  V+ +D  
Sbjct: 61  IDRKIFRFMSDCSAYAYLSMEQAIADSGLTEEQVSNLRTGIVVGSGGGSPRNQVAGSDGM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ G
Sbjct: 121 RAK-GLRGVGPYMVTRAMASGISACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+
Sbjct: 180 KQDVVFAGGGEELSWEMTCEFDAMGALSTKYNETPDKASRTYDKDRDGFVIAGGGGIVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V++ +DYINTHGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGVDK-IDYINTHGT 298

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+EAI+EVF  N P I +TK+++GHSLGAAG  EAIY L+M++  FI  S N
Sbjct: 299 STPVGDTKELEAIQEVFGNNSPAISATKAMSGHSLGAAGVHEAIYSLLMLEHGFIAPSIN 358

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           +E +D +  G+ IV K  + A +DTV+SNSFGFGGTNATLV  +YK
Sbjct: 359 VENLDEKAAGLNIVTKPTEQA-LDTVMSNSFGFGGTNATLVMSKYK 403


>gi|238791926|ref|ZP_04635562.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia intermedia
           ATCC 29909]
 gi|238728557|gb|EEQ20075.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia intermedia
           ATCC 29909]
          Length = 407

 Score =  444 bits (1143), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/407 (56%), Positives = 297/407 (72%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGDVKLASEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    +  LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAFLAMQEAIADSGLSDDQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMACEFDAMGALSTKYNETPAKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMAGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NIE +D +  G+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIENLDEKAAGMNIITEPTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|238751303|ref|ZP_04612797.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia rohdei ATCC
           43380]
 gi|238710577|gb|EEQ02801.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia rohdei ATCC
           43380]
          Length = 407

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 226/407 (55%), Positives = 299/407 (73%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AE 58
           M+R  +TG+GIVSSIGNN  EV  +L+E RSGITF+++F   G R  VWG   L +   +
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLAALQEGRSGITFAQEFKDAGMRSHVWGDVKLASEPKD 60

Query: 59  LIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADL 118
           LIDRK +RF+S    + +LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D 
Sbjct: 61  LIDRKVLRFMSDASIYAYLAMQEAIADSGLAEDQVSNFRSGLVVGSGGGSPRNQVAGSDA 120

Query: 119 TREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQS 178
            R     + +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ 
Sbjct: 121 MRTPRGLKGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQL 180

Query: 179 GKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIV 238
           GKQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V
Sbjct: 181 GKQDVVFAGGGEELCWEMACEFDAMGALSTKYNETPAKASRTYDQDRDGFVIAGGGGMVV 240

Query: 239 LEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHG 298
           +EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N HG
Sbjct: 241 VEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMAGVDTPIDYMNVHG 300

Query: 299 TATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESK 358
           T+TP GD KE+ AIREVF  + P I STK++TGHSLGAAG  EAI+ L+M++  FI  S 
Sbjct: 301 TSTPVGDVKELGAIREVFGNDTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSI 360

Query: 359 NIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           NI+ +D + KG+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 NIDNLDEQAKGMNIITEPTKR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|119502959|ref|ZP_01625044.1| 3-oxoacyl-(acyl carrier protein) synthase [marine gamma
           proteobacterium HTCC2080]
 gi|119461305|gb|EAW42395.1| 3-oxoacyl-(acyl carrier protein) synthase [marine gamma
           proteobacterium HTCC2080]
          Length = 409

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/404 (55%), Positives = 301/404 (74%), Gaps = 3/404 (0%)

Query: 2   RRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELID 61
           +RV VTG+G VS +GN+ + V  +L+  +SGITF +  A+ G R  V G P ++ +  ID
Sbjct: 3   QRVVVTGIGTVSCLGNDTAAVTAALKAGQSGITFCQQHAEAGMRSHVAGVPDIDLSACID 62

Query: 62  RKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTRE 121
           RK  RF+     + +L+M++AI D+ L   ++++ RTG+IAGSGG S+   V AAD+ R+
Sbjct: 63  RKRWRFMGDAAGYAYLSMEQAIADAGLSEEQVSNTRTGIIAGSGGASSASQVEAADILRD 122

Query: 122 HCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQ 181
               RR+GP+ V + M ST SA L+T FKI+G +YSISSAC+TSAHCIGN  ELIQ GKQ
Sbjct: 123 R-GLRRVGPYRVTQTMGSTVSACLATPFKIKGVNYSISSACSTSAHCIGNGMELIQMGKQ 181

Query: 182 DIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEE 241
           DI+FAGG E+L W++S LFDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG  ++VLE 
Sbjct: 182 DIVFAGGGEELHWSLSCLFDAMGALSTQYNETPNQASRAYDADRDGFVIAGGGGMVVLES 241

Query: 242 MERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTAT 301
           +E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+QA+++V+ P+DYIN HGT+T
Sbjct: 242 LEHALARGANIYAEIVGYGATSDGYDMVAPSGEGAVRCMQQAIATVDGPIDYINAHGTST 301

Query: 302 PKGDKKEVEAIREVF--KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           P GD +E+ A+REVF  +   P+I STKSL+GHSLGAAG QEA+Y L+MM+E FI  S N
Sbjct: 302 PVGDIQELNAVREVFGARDEGPWIGSTKSLSGHSLGAAGVQEAVYSLLMMREDFIAASAN 361

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I ++D    G+ I R+RID A ++ V+SNSFGFGGTNA+LVF+R
Sbjct: 362 INQLDDGAAGLKIARERIDQAGLNRVMSNSFGFGGTNASLVFQR 405


>gi|311693526|gb|ADP96399.1| 3-oxoacyl-(acyl carrier protein) synthase I [marine bacterium HP15]
          Length = 394

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/395 (55%), Positives = 290/395 (73%), Gaps = 2/395 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGIVS +GN++ EV  SL+  +SGI F+E + + GFR Q+ G   ++ + +IDRK  RF+
Sbjct: 1   MGIVSCLGNSLDEVTQSLKNGKSGIRFNETYKEMGFRSQIAGSVDVDTS-VIDRKIRRFM 59

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
                +  L+M++AI  + L    I+++RTGLIAGSGG S    V A D+ RE    +RI
Sbjct: 60  GPSAMYSFLSMEQAIAQAGLTEDLISNDRTGLIAGSGGASCSSQVEATDIMREK-GVKRI 118

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GP+ VP+ M+ST SA L+T +KIRG +YS+SSACATSAHCIG+A E IQ+GKQDI+FAGG
Sbjct: 119 GPYMVPRIMTSTVSACLATAYKIRGVNYSMSSACATSAHCIGHAMEQIQAGKQDIVFAGG 178

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+ DW+++ +FDAMGA+S+ +N  P +ASRP+D+ RDGFVI+GG  ++VLEE+E AK R
Sbjct: 179 GEEEDWSLTMMFDAMGALSTKYNDAPETASRPFDAGRDGFVIAGGGGMMVLEELEHAKKR 238

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GA I AELTGYG+T DG DMV+PSGEGA RCM+QA++++   +DYIN HGT+TP GD  E
Sbjct: 239 GANIIAELTGYGATSDGYDMVAPSGEGAQRCMKQAMATIRGKIDYINAHGTSTPVGDVAE 298

Query: 309 VEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK 368
           + A+R  F  +IP I STKSL+GHSLGAAG QEAIY L+M+Q  FI  +KN+   D +  
Sbjct: 299 MGAVRATFGSDIPAISSTKSLSGHSLGAAGVQEAIYSLLMLQNGFIAGTKNLNNPDEKIS 358

Query: 369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
            IPIV      A ++TV+SNSFGFGGTNA+LVF +
Sbjct: 359 DIPIVGPEGREASLNTVMSNSFGFGGTNASLVFEK 393


>gi|298368838|ref|ZP_06980156.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298282841|gb|EFI24328.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 404

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/404 (55%), Positives = 296/404 (73%), Gaps = 3/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GI+SS+GNN  EV  SL+  +SGI+F E + + G R  + G   ++  E I
Sbjct: 1   MKRVVVTGIGILSSLGNNCREVLESLKNLKSGISFDESYREMGLRSHLAGNIKIDTKEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+     + ++AM+EAI  + L   ++++ RTG++ GSGG S+   V AAD  R
Sbjct: 61  DRKILRFMGDAAAYAYIAMKEAIAHAGLTEEQVSNIRTGIVTGSGGASSSSQVEAADTLR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+ V K M+ST SA L+T FKI+G +YSISSAC+TSAHCIG+AAELIQ GK
Sbjct: 121 A-SGVKRIGPYGVTKCMASTVSACLATPFKIKGVNYSISSACSTSAHCIGHAAELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E++ W M +LFDAMGA+SS +N  P  ASR +D+ RDGFVISGG +++V+E
Sbjct: 180 QDIVFAGGGEEISWQMGSLFDAMGALSSKYNDTPEQASRAFDADRDGFVISGGGSILVME 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E E AKARGA I  ELTGYG+T DG DMV PSGEGA+RCM+ AL+     VDYIN HGT+
Sbjct: 240 EYEHAKARGANILCELTGYGATSDGYDMVQPSGEGAVRCMQMALAQHGGKVDYINAHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGN-IPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           TP GD KE+ A+REVF G  IP+I STKSL+GH+ GAAG+ EAIY ++MMQ  F   S N
Sbjct: 300 TPVGDTKELGAVREVFAGQEIPFISSTKSLSGHAQGAAGSNEAIYSILMMQNDFACASAN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           I+ +D + +G+PI+R+  +  K++ V+SNSFGFGGTNATL+F R
Sbjct: 360 IQNLDEQAEGLPILRENRE-MKLNAVMSNSFGFGGTNATLIFSR 402


>gi|332162441|ref|YP_004299018.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318606529|emb|CBY28027.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASI [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666671|gb|ADZ43315.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330860201|emb|CBX70521.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia
           enterocolitica W22703]
          Length = 407

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 230/408 (56%), Positives = 297/408 (72%), Gaps = 5/408 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLL---NAA 57
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFS++F   G R  VWG   L      
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFSQEFKDAGMRSHVWGDVKLAPETIT 60

Query: 58  ELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAAD 117
           E IDRK +RF+S    + +L+M++AI DS L   ++++ R+GL+ GSGG S +  V+ +D
Sbjct: 61  ENIDRKVLRFMSDASVYAYLSMKQAIEDSGLTEKQVSNFRSGLVVGSGGGSPRNQVAGSD 120

Query: 118 LTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQ 177
             R     R +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ
Sbjct: 121 GMRTK-GLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQ 179

Query: 178 SGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVI 237
            GKQD++FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++
Sbjct: 180 LGKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNETPAKASRTYDQDRDGFVIAGGGGMV 239

Query: 238 VLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTH 297
           V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N H
Sbjct: 240 VVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMAGVDTPIDYMNVH 299

Query: 298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           GT+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S
Sbjct: 300 GTSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPS 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            NIE++D +  G+ IV +     K+ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 360 INIEKLDEQAAGMNIVTEPT-QCKLTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|33519949|ref|NP_878781.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Candidatus Blochmannia
           floridanus]
 gi|33504295|emb|CAD83187.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Candidatus Blochmannia
           floridanus]
          Length = 405

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/406 (53%), Positives = 290/406 (71%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV VTG+GI+SSIGNN  EV +SL+  RSGITFS++  + G R  VWG   LN   LI
Sbjct: 1   MKRVVVTGLGIISSIGNNQDEVLVSLKNGRSGITFSKELQESGMRSCVWGNIKLNIDGLI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+S    + +L+M +A+ DS L    I ++ TGLI GSGG S +  V  ++  R
Sbjct: 61  DRKIARFMSDAAIYAYLSMDQAVQDSGLSKDMIINDYTGLIVGSGGGSPRNQVLGSNGMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R +GP+ V K+M+S  SA L+T+FKI+G SYSISSAC+TS HC+G+A ELIQSGK
Sbjct: 121 TR-GLRGVGPYMVTKSMASGISACLATFFKIKGMSYSISSACSTSTHCVGHAFELIQSGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           Q I+FAGG E+L W M+  FDAMGA+S+ +N  P  ASRPYD  RDGFVI+GG  ++V+E
Sbjct: 180 QVIVFAGGGEELCWEMACEFDAMGALSTKYNDIPEKASRPYDLNRDGFVIAGGGGIVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+  A  R A IY E+ GYG+T DG DMV+PSGEGAIRCM+ AL +V++ VDY+N HGT+
Sbjct: 240 ELTHALDRNAHIYGEIVGYGATSDGFDMVAPSGEGAIRCMQIALRNVDDSVDYLNMHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD KE++A+ +VF    PY  STKS+TGH+LGAAG  E I+ L+M++  FI  S NI
Sbjct: 300 TQIGDIKELQALYKVFGNQHPYFSSTKSMTGHALGAAGVHEIIFTLLMLKHNFIAPSINI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +++DP  + + ++RK I + K+  V++NSFGFGGTNATLV ++Y G
Sbjct: 360 DQLDPYLENMKVIRKTI-HQKLTVVMTNSFGFGGTNATLVMQKYSG 404


>gi|219872167|ref|YP_002476542.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus parasuis
           SH0165]
 gi|219692371|gb|ACL33594.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus parasuis
           SH0165]
          Length = 411

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/400 (57%), Positives = 293/400 (73%), Gaps = 1/400 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TG+GI+SSIGNN  EV  SL+E +SGI F   FA+ G R Q+ G   LN AELI
Sbjct: 1   MKRVVITGIGIISSIGNNKEEVLASLKEGKSGIEFVPKFAEVGMRSQIAGTIKLNPAELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + +L+M+EAI DS L   +++++RTGL+ G+G  S    + A D  R
Sbjct: 61  DRKVYRFMGDAAAYAYLSMKEAIEDSGLTEEQVSNDRTGLVIGAGTGSAHSQLVACDAVR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                + +GP+AV K M+S+ SA L+T +KIRG +YSISSACATSAHCIG+A ELIQ GK
Sbjct: 121 GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHAMELIQLGK 180

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+E
Sbjct: 181 QDVVFAGGAEELSWECATEFDAMGAVSTKYNETPTKASRAYDANRDGFVIAGGGAVVVVE 240

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIYAE+ GYG T DG DMV+PSGEGA RCM+QA+++V+  ++YIN HGT+
Sbjct: 241 ELEHALARGAKIYAEIVGYGVTSDGYDMVAPSGEGAERCMKQAMATVKGEIEYINVHGTS 300

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD KE+ AI+ VF    P I STKS+TGHSLGAAGA EAIY L+M+   FI  S NI
Sbjct: 301 TPVGDVKELGAIKNVFGDKTPAISSTKSMTGHSLGAAGAHEAIYSLLMLDNDFIAPSINI 360

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLV 400
           EE+D + +G+ +V +R D A + TV+SNSFGFGGTNA LV
Sbjct: 361 EELDEQAQGVNVVTERQDKA-LTTVMSNSFGFGGTNACLV 399


>gi|325273914|ref|ZP_08140082.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas sp.
           TJI-51]
 gi|324100951|gb|EGB98629.1| 3-oxoacyl-(acyl carrier protein) synthase I [Pseudomonas sp.
           TJI-51]
          Length = 418

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/403 (53%), Positives = 291/403 (72%), Gaps = 2/403 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           +RRV VTGMGIVS +GN+ ++V  +LR+ RSGI F+  +A+ G R  V G+  ++  + I
Sbjct: 9   LRRVVVTGMGIVSCLGNSPAQVLQALRQGRSGIAFNLAYAQAGLRSHVSGRLEVDF-QRI 67

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DR+  RF+     +G+LAM +AI D+RL P ++   RTG + GSGG S++ IV A  L  
Sbjct: 68  DRRHRRFMGDAAAYGYLAMADAIADARLTPEQVADTRTGCVMGSGGGSSEDIVEANQLLH 127

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                R++GP+ VP+ M+ST SA L+++F I+G +YSI+SACATSAHCIG+A E IQ GK
Sbjct: 128 SQ-GVRKVGPYRVPRTMTSTVSACLASFFGIKGLNYSIASACATSAHCIGHAFEQIQFGK 186

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++FAGG E   ++ S +FDAMGA S+ +N  P +ASRPYD  RDGFVISGGA V+VLE
Sbjct: 187 QDVVFAGGAEAEHFSQSCMFDAMGAFSTGYNDRPATASRPYDVARDGFVISGGAGVLVLE 246

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I AE+ GYG+  DG DMVSPSG+GA+R M+ AL+S  EPVDY+NTHGT+
Sbjct: 247 ALEHAQARGATILAEVIGYGTASDGQDMVSPSGDGALRAMQMALASCAEPVDYLNTHGTS 306

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           T  GD  E++A    F G +P   STKSL+GH+LGAAG  EAIY L+MM+  F+  S NI
Sbjct: 307 TQAGDLVELQAALAAFDGELPPFSSTKSLSGHALGAAGVHEAIYALLMMRHGFMAASHNI 366

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR 403
           E++DP+ +G+P+VR   +  +++ V+SNSFGFGG NA+LVF R
Sbjct: 367 EQLDPQVEGLPLVRSVREGQQVNCVMSNSFGFGGANASLVFSR 409


>gi|85374175|ref|YP_458237.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Erythrobacter litoralis
           HTCC2594]
 gi|84787258|gb|ABC63440.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Erythrobacter litoralis
           HTCC2594]
          Length = 401

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 294/401 (73%), Gaps = 3/401 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MGIVSSIGNN  EV  +L+  +SGI+F+E+ A+ GFR Q+ G   L+ AE +D++ +RF+
Sbjct: 1   MGIVSSIGNNADEVLAALKAGKSGISFNEEMAEHGFRSQIAGAVDLDVAEHVDKRTLRFM 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
             G  + ++AM +AI D+ L+  ++ +  TG+IAGSGGPST  +++A     +  +T+RI
Sbjct: 61  GPGAAYSYIAMGQAIADAGLEQKDVVNPMTGVIAGSGGPSTSAMLAAHQTVLKTGATKRI 120

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GPFAVPK MSST SA L+T ++I+G ++SI+SAC+TS HCIG AA+ I  G+QD+MF GG
Sbjct: 121 GPFAVPKCMSSTISANLATAYQIKGMNFSITSACSTSLHCIGMAAQQIALGQQDVMFGGG 180

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+LDWT+S LFDAMGAMSS +N  P  ASR +D+ RDGFVI GG A++VLE +E A+AR
Sbjct: 181 GEELDWTLSCLFDAMGAMSSKYNDTPERASRAFDADRDGFVIGGGGAILVLEALEHAQAR 240

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSV--EEPVDYINTHGTATPKGDK 306
           GAKIYAE+TG+ +T DG DMV+PSGEG  R M  AL ++  +  V YIN HGT+TP GD 
Sbjct: 241 GAKIYAEVTGFCATSDGADMVAPSGEGGERAMCGALGTLGDDRTVSYINAHGTSTPVGDV 300

Query: 307 KEVEAIREVF-KGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDP 365
            E+EA+R VF +G+ P + STKS+TGHS GA GAQEA+YCL+ ++  FI  S N+E +DP
Sbjct: 301 GEIEAVRRVFGEGSTPPVSSTKSMTGHSQGATGAQEAVYCLLALENDFIIPSINVETLDP 360

Query: 366 EFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
             K   I  + +++A +DTV++NSFGFGGTN T++  ++ G
Sbjct: 361 ALKPEEIATELVEDAGLDTVMTNSFGFGGTNGTMLLSKFHG 401


>gi|45437059|gb|AAS62611.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 399

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/399 (56%), Positives = 293/399 (73%), Gaps = 3/399 (0%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA--AELIDRKAMR 66
           MGIVSSIGNN  EV  SL+E RSGITF+++F   G R  VWG   L +   +LIDRK +R
Sbjct: 1   MGIVSSIGNNQQEVLASLQEGRSGITFAQEFKDAGMRSHVWGDVKLQSEPKDLIDRKVLR 60

Query: 67  FLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTR 126
           F+S    + +LAMQEAI DS L   ++++ R+GL+ GSGG S +  V+ +D  R     +
Sbjct: 61  FMSDASIYAYLAMQEAIADSGLSDSQVSNFRSGLVVGSGGGSPRNQVAGSDAMRTPRGLK 120

Query: 127 RIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFA 186
            +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ GKQDI+FA
Sbjct: 121 GVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQLGKQDIVFA 180

Query: 187 GGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAK 246
           GG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+EE+E A 
Sbjct: 181 GGGEELCWEMACEFDAMGALSTKYNDTPAKASRTYDQDRDGFVIAGGGGMVVVEELEHAL 240

Query: 247 ARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDK 306
           ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A++ V+ P+DY+N HGT+TP GD 
Sbjct: 241 ARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMAGVDTPIDYMNVHGTSTPVGDV 300

Query: 307 KEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPE 366
           KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S NI+ +D +
Sbjct: 301 KELGAIREVFGNNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSINIDNLDEQ 360

Query: 367 FKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            +G+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 361 AQGMNIITETTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 398


>gi|238763868|ref|ZP_04624825.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia kristensenii
           ATCC 33638]
 gi|238697836|gb|EEP90596.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia kristensenii
           ATCC 33638]
          Length = 407

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/408 (56%), Positives = 295/408 (72%), Gaps = 5/408 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLL---NAA 57
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFS++F   G R  VWG   L      
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFSQEFKDAGMRSHVWGDVKLAPETIT 60

Query: 58  ELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAAD 117
           E IDRK +RF+S    + +L+M++AI DS L   ++++ R+GL+ GSGG S +  V+ +D
Sbjct: 61  ENIDRKVLRFMSDASVYAYLSMKQAIEDSGLTEEQVSNFRSGLVVGSGGGSPRNQVAGSD 120

Query: 118 LTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQ 177
             R     R +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ
Sbjct: 121 GMRAK-GLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQ 179

Query: 178 SGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVI 237
            GKQD++FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++
Sbjct: 180 LGKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNETPAKASRTYDQDRDGFVIAGGGGMV 239

Query: 238 VLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTH 297
           V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N H
Sbjct: 240 VVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMEGVDTPIDYMNVH 299

Query: 298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           GT+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S
Sbjct: 300 GTSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPS 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            NIE +D +  G+ IV +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 360 INIENLDEKAVGMNIVTEPTQR-ELTTVMSNSFGFGGTNATLVMRKYQ 406


>gi|238753798|ref|ZP_04615159.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia ruckeri ATCC
           29473]
 gi|238708034|gb|EEQ00391.1| 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Yersinia ruckeri ATCC
           29473]
          Length = 405

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/406 (55%), Positives = 297/406 (73%), Gaps = 3/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           M+R  +TG+GIVSSIGNN  EV  +L+E RSGITF+++F   G R  +WG    L+    
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLAALQEGRSGITFAQEFKDAGMRSHIWGDVKDLDVTSR 60

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLT 119
           IDRK +RF+S    + +LAMQEAI DS+L   ++++ R+GL+ GSGG S +  V+ +D  
Sbjct: 61  IDRKVLRFMSDASVYAYLAMQEAIEDSKLADDQVSNFRSGLVVGSGGGSPRNQVAGSDGM 120

Query: 120 REHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSG 179
           R     R +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ G
Sbjct: 121 RAK-GLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHAVELIQLG 179

Query: 180 KQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVL 239
           KQD++FAGG E+L W M+  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++V+
Sbjct: 180 KQDVVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDKDRDGFVIAGGGGMVVV 239

Query: 240 EEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGT 299
           EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N HGT
Sbjct: 240 EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMQGVDTPIDYMNVHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +TP GD KE+ AIRE+F  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S N
Sbjct: 300 STPVGDVKELGAIREIFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPSIN 359

Query: 360 IEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +D + +G+ I+ +     ++ TV+SNSFGFGGTNATLV R+Y+
Sbjct: 360 IETLDEKAEGMNIITEPTKR-ELTTVMSNSFGFGGTNATLVMRKYQ 404


>gi|123441623|ref|YP_001005608.1| 3-oxoacyl-(acyl carrier protein) synthase I [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122088584|emb|CAL11379.1| 3-oxoacyl-[acyl-carrier-protein] synthase I [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 407

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 229/408 (56%), Positives = 296/408 (72%), Gaps = 5/408 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNA---A 57
           M+R  +TG+GIVSSIGNN  EV  SL+E RSGITFS++F   G R  VWG   L      
Sbjct: 1   MKRAVITGLGIVSSIGNNQQEVLASLQEGRSGITFSQEFKDAGMRSHVWGDVKLAPEAIT 60

Query: 58  ELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAAD 117
           E IDRK +RF+S    + +L+M++AI DS L   ++++ R+GL+ GSGG S +  V+ +D
Sbjct: 61  ENIDRKVLRFMSDASVYAYLSMKQAIEDSGLTEEQVSNFRSGLVVGSGGGSPRNQVAGSD 120

Query: 118 LTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQ 177
             R     R +GP+ V KAM+S  SA L+T FKI+G +YSISSACATSAHCIG+A ELIQ
Sbjct: 121 GMRAK-GLRGVGPYMVTKAMASGVSACLATPFKIKGVNYSISSACATSAHCIGHALELIQ 179

Query: 178 SGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVI 237
            GKQD++FAGG E+L W MS  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++
Sbjct: 180 LGKQDVVFAGGGEELCWEMSCEFDAMGALSTKYNETPDKASRTYDQYRDGFVIAGGGGMV 239

Query: 238 VLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTH 297
           V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ A+  V+ P+DY+N H
Sbjct: 240 VVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMEGVDTPIDYMNVH 299

Query: 298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           GT+TP GD KE+ AIREVF  N P I STK++TGHSLGAAG  EAI+ L+M++  FI  S
Sbjct: 300 GTSTPVGDVKELGAIREVFGDNTPAISSTKAMTGHSLGAAGVHEAIFSLLMVEHGFIAPS 359

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
            NIE +D +  G+ IV +     +++TV+SNSFGFGGTNATLV R+Y+
Sbjct: 360 INIENLDEQAAGMNIVTEPTKR-ELNTVMSNSFGFGGTNATLVMRKYQ 406


>gi|284009286|emb|CBA76417.1| 3-oxoacyl-(acyl carrier protein) synthase I [Arsenophonus nasoniae]
          Length = 416

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 298/407 (73%), Gaps = 6/407 (1%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAEL- 59
           M+R  +TG+GIVSSIGNN  EV  SL+  RSGI FSE+F K G R  VWG   L    + 
Sbjct: 11  MKRAVITGLGIVSSIGNNQQEVLASLKTGRSGIRFSEEFEKMGLRSHVWGNIQLTEEYIK 70

Query: 60  --IDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAAD 117
             IDRK +RF+S    + +L+M+EAI+D++L   +I++ RTGL+ GSGG S +  V+ +D
Sbjct: 71  QKIDRKILRFMSDCSIYAYLSMEEAISDAKLTQAQISNTRTGLVVGSGGGSPRNQVAGSD 130

Query: 118 LTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQ 177
             R     R +GP+ V +AM+S  SA L+T FKI+G +YSISSAC+TSAHCIG+A ELIQ
Sbjct: 131 GMRAK-GLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQ 189

Query: 178 SGKQDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVI 237
            GKQD++FAGG E+L W ++  FDAMGA+S+ +N  P  ASR YD  RDGFVI+GG  ++
Sbjct: 190 LGKQDVIFAGGGEELSWELTCEFDAMGALSTKYNATPEKASRTYDQDRDGFVIAGGGGIV 249

Query: 238 VLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTH 297
           V+EE+E A ARGA IYAE+ GYG+T DG DMV+PSGEGA+RCM+ AL+ V++ VDYINTH
Sbjct: 250 VVEELEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAVRCMKMALADVKQ-VDYINTH 308

Query: 298 GTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           GT+TP GD KE+EAI EVF  N P I +TK++TGHSLGAAG  EAIY L+M++  FI  S
Sbjct: 309 GTSTPVGDTKELEAITEVFGSNTPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPS 368

Query: 358 KNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
            NI+ +D + + + I+ +  +  K++TV+SNSFGFGGTNA+LV  +Y
Sbjct: 369 INIDNLDEKAQAMNIITQPTEQ-KLNTVMSNSFGFGGTNASLVMSKY 414


>gi|153803034|ref|ZP_01957620.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae MZO-3]
 gi|124121432|gb|EAY40175.1| 3-oxoacyl-(acyl-carrier-protein) synthase I [Vibrio cholerae MZO-3]
          Length = 356

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 210/357 (58%), Positives = 270/357 (75%), Gaps = 2/357 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+RV +TGMGI+SSIGNNV EV  SL+  +SGIT SE F + G R QVWG   +N  E I
Sbjct: 1   MKRVVITGMGIISSIGNNVEEVLASLKAGKSGITASEQFKEHGLRSQVWGDLKINPEEHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK MRF+     + +L++++AI D+ L P +++++RTG++AGSGG S++  V A D  R
Sbjct: 61  DRKQMRFMGDAAAYAYLSLEQAIADAGLTPEQVSNDRTGIVAGSGGASSENQVIAVDTQR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           E    +R+GP+ VP+ MSST SA L+T FKIRG +YSISSACATSAHCIGNA ELIQ GK
Sbjct: 121 EK-GVKRVGPYMVPRTMSSTVSACLATPFKIRGVNYSISSACATSAHCIGNAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+FAGG E+L W+ + +FDAMGA+S+ +N  P  ASR YD+ RDGFVISGG  ++V+E
Sbjct: 180 QDIVFAGGGEELYWSQTMMFDAMGALSTKYNETPEKASRTYDADRDGFVISGGGGMVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGAKIY E+ GYG+T DG DMV+PSGEGAIRCM+ A+  V++ +DYINTHGT+
Sbjct: 240 ELEHALARGAKIYGEIVGYGATSDGYDMVAPSGEGAIRCMKMAMQGVDK-IDYINTHGTS 298

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGES 357
           TP GD KE+ AI+EVF GN P I +TK++TGH+LGAAG  EAIY  +M+   FI  S
Sbjct: 299 TPVGDVKELGAIQEVFGGNSPAISATKAMTGHALGAAGVHEAIYSTLMLHHGFIAPS 355


>gi|145642075|ref|ZP_01797646.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           R3021]
 gi|145273255|gb|EDK13130.1| 3-oxoacyl-(acyl carrier protein) synthase I [Haemophilus influenzae
           22.4-21]
          Length = 398

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/398 (54%), Positives = 279/398 (70%)

Query: 9   MGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELIDRKAMRFL 68
           MG+         EV  SL+  +SGI    +F +   R  V G   LN +E IDRK  RF+
Sbjct: 1   MGLFQVSVTTKEEVLASLKAGKSGIEVVPEFVEMNMRSHVAGTIKLNPSEHIDRKVFRFM 60

Query: 69  SQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRI 128
                + +L+M+EAI D+ L   +++++RTGL+ G+G  S    + A D  R     + I
Sbjct: 61  GDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLVACDAVRGPRGVKAI 120

Query: 129 GPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGG 188
           GP+AV K M+S+ SA L+T +KIRG +YS+SSACATSAHCIG+A ELIQ GKQD++FAGG
Sbjct: 121 GPYAVTKTMASSVSACLATPYKIRGVNYSMSSACATSAHCIGHAVELIQLGKQDVVFAGG 180

Query: 189 QEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKAR 248
            E+L W  +  FDAMGA+S+ +N  P  ASR YD+ RDGFVI+GG AV+V+EE+E A AR
Sbjct: 181 AEELSWECATEFDAMGAVSTKYNETPEKASRAYDANRDGFVIAGGGAVVVVEELEHALAR 240

Query: 249 GAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTATPKGDKKE 308
           GAKIYAE+ GYG+T DG DMV+PSGEGA RCM+QA+++V+ P+DYIN HGT+TP GD KE
Sbjct: 241 GAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDTPIDYINVHGTSTPVGDVKE 300

Query: 309 VEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFK 368
           + AI+ VF   IP I STKS+TGHSLGAAGA E IY L+M+   FI  S NIE +D   +
Sbjct: 301 LGAIKNVFGDKIPAISSTKSMTGHSLGAAGAHEVIYTLLMLDNDFIAPSINIETLDETAE 360

Query: 369 GIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           G  IV +  +NA + TV+SNSFGFGGTNATL+F+RY G
Sbjct: 361 GCNIVTETKENAGLQTVMSNSFGFGGTNATLIFKRYNG 398


>gi|90416593|ref|ZP_01224524.1| 3-oxoacyl-(acyl-carrier-protein) synthase [marine gamma
           proteobacterium HTCC2207]
 gi|90331792|gb|EAS47020.1| 3-oxoacyl-(acyl-carrier-protein) synthase [marine gamma
           proteobacterium HTCC2207]
          Length = 404

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/406 (51%), Positives = 286/406 (70%), Gaps = 2/406 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+R  +TG+GIVS +GN+   VA SL+E  SGI   EDFA+ G RC V     ++  + I
Sbjct: 1   MKRAVITGLGIVSCLGNDKESVAHSLKEGISGIRRREDFAEMGLRCNVGAVLDIDPKDHI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+    ++ ++A   AI D+ L P  +++ RTGL+ GSGG S +    + D+ R
Sbjct: 61  DRKILRFMGPSASYAYIATDRAIADAGLTPEMVSNHRTGLVMGSGGVSGEMFTESIDVMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
           +    +R GP+ V + M+ST SA ++T FKI+G +YSI+SACATSAHCIG+A ELIQ GK
Sbjct: 121 DR-GIKRAGPYRVTQIMASTVSACVATPFKIKGVNYSIASACATSAHCIGHAVELIQLGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD++ AGG ED+ W+M+ +FDAMGA++S +N  P  ASR YDS+RDGF    GA  +V+E
Sbjct: 180 QDVLLAGGSEDMHWSMAGMFDAMGALTSKYNDTPEIASRAYDSQRDGFAPGLGAGTVVVE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
           E+E A ARGA I  E+TGYG+T DG DMVSPSGEGA RCM+ A+ + + P+DYINTHGT+
Sbjct: 240 ELEHALARGANIICEVTGYGATSDGADMVSPSGEGAERCMKMAMETAKGPIDYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E+ AIR  F  N P I STKSL+GHSLGAAG  EAIYC++MMQ  F+  S +I
Sbjct: 300 TPVGDVAELGAIRNTFPENCPDISSTKSLSGHSLGAAGVHEAIYCMLMMQNNFVAGSAHI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYKG 406
           +E+D    G+PI+ +  +  +++ ++SNSFGFGGTNATL+  R+ G
Sbjct: 360 DELDENAAGLPILLETKEK-QLNCIMSNSFGFGGTNATLIMERFTG 404


>gi|126665745|ref|ZP_01736726.1| putative 3-oxoacyl- synthase I [Marinobacter sp. ELB17]
 gi|126629679|gb|EBA00296.1| putative 3-oxoacyl- synthase I [Marinobacter sp. ELB17]
          Length = 403

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 285/404 (70%), Gaps = 1/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TGMGIVSS+G ++  V  SLRE +SGI FSE+    G R Q+ G+  LN  ELI
Sbjct: 1   MRRVVITGMGIVSSLGTDIKAVTKSLREVKSGIGFSEEARDNGLRSQICGQINLNLPELI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK  RF+     + HL+  EA+  S L   +I    TG I G+GG ST  ++ A D  R
Sbjct: 61  DRKLWRFMCPASGYAHLSTVEALAQSGLTDEQIRANTTGAIFGTGGASTVELMDAIDTHR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                RR+GP+ VP+ M S+ +A++ST F I G +Y I+SACATS H +G+AA+LI  G+
Sbjct: 121 AK-GIRRVGPYRVPRTMGSSINASISTAFGITGVNYGITSACATSTHAVGHAADLIAMGR 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+M AGG +D+ W++S LFDAMGA+S+ +N  P  ASR YD+ RDGFVISGG   +VLE
Sbjct: 180 QDVMLAGGGDDIHWSLSMLFDAMGALSTKYNDTPEKASRTYDANRDGFVISGGGGTLVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300
            +E A+ARGA I AE+ G+G+T DG DMV+PSGEGA+RCM+QA+ +++  + YINTHGT+
Sbjct: 240 ALEHAQARGANILAEIVGFGATSDGADMVAPSGEGAVRCMQQAMKNIDGEISYINTHGTS 299

Query: 301 TPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNI 360
           TP GD  E++AI++ F   IP + STK+L+GH+LGAAG  EAIY LIM +E FI  S NI
Sbjct: 300 TPAGDITELKAIKQAFGDRIPQLSSTKALSGHALGAAGVHEAIYSLIMQRENFICPSANI 359

Query: 361 EEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
           E +D   +G P+VR+  +N  ++ V+SNSFGFGGTN +LVF+++
Sbjct: 360 ENLDEGAEGYPVVREVRENQNLEYVMSNSFGFGGTNGSLVFKKF 403


>gi|32491157|ref|NP_871411.1| hypothetical protein WGLp408 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166364|dbj|BAC24554.1| fabB [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 407

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/407 (52%), Positives = 287/407 (70%), Gaps = 3/407 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           MRRV +TG+G++SSIGNN  EV  SL+  +SGI FS++    G R Q+WG    + + +I
Sbjct: 1   MRRVVITGLGLLSSIGNNKEEVLNSLKSGKSGINFSQELKDSGMRSQIWGNIKTDVSGII 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
            RK  RF+S    + +L+M++AI D++L    I++ RTGLI GSGG S K  V  +D  R
Sbjct: 61  SRKTSRFMSDASIYAYLSMEQAIFDAKLNFNIISNNRTGLIVGSGGGSPKNQVYGSDAMR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
            +   R +GP+ V KAM+S  SA LST FKIRG +YSI+SAC+TSAHCIGNA E+I+ GK
Sbjct: 121 -YRGLRGVGPYIVTKAMASGISACLSTPFKIRGINYSITSACSTSAHCIGNAMEMIKFGK 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QD+MFAGG E+L W M+  FDAMGA+S+ +N+ P  ASR YDS RDGFVISGG  +IVLE
Sbjct: 180 QDVMFAGGGEELCWEMACEFDAMGALSTSYNNFPQKASRAYDSNRDGFVISGGGGIIVLE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVE-EPVDYINTHGT 299
           E++ A +R A IYAE+ GYG+T DG DMV PSGEGA+RCM+ AL +++   +DY+N HGT
Sbjct: 240 ELKHALSRNAFIYAEIIGYGATSDGSDMVIPSGEGAVRCMKMALENLDVSSIDYLNVHGT 299

Query: 300 ATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKN 359
           +T  GD KE+ AI+E F  N P I STKS+TGH+LGAAG  E I+ ++M+   FI  S N
Sbjct: 300 STSIGDIKELNAIKETFGENSPMISSTKSMTGHALGAAGVHEIIFSILMLNNNFIAPSIN 359

Query: 360 IEEIDPEFKGIPI-VRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           IE +D + K + + +  +     ++ V+SNSFGFGGTNATL+ ++Y 
Sbjct: 360 IENLDKKAKDLDMKIITKYTKYDLNYVMSNSFGFGGTNATLILKKYN 406


>gi|45644726|gb|AAS73114.1| predicted 3-oxoacyl-ACP synthase [uncultured marine gamma
           proteobacterium EBAC20E09]
          Length = 402

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/404 (52%), Positives = 291/404 (72%), Gaps = 2/404 (0%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGKPLLNAAELI 60
           M+ V +TGMGI S IGN  + V  +L+E +SGI F+E + +  FR  V G   ++ +E I
Sbjct: 1   MKNVVITGMGIKSCIGNEYNSVLKNLQEGKSGIIFNETYDEMNFRSCVSGSIKIDLSEYI 60

Query: 61  DRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTR 120
           DRK +RF+ +   + +LA  +A+  + +    + + R G++AGSGG ST+ +V ++D+ R
Sbjct: 61  DRKLLRFMGESAGYAYLATLDALKMAGVDNNYLDNPRIGIVAGSGGASTRIMVESSDIAR 120

Query: 121 EHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGK 180
                +RIGP+ V K+MSS+ SA ++T  K++G +YSISSACATSAHCIG+AA+LI++G+
Sbjct: 121 NR-GPKRIGPYGVTKSMSSSISAIVATALKLKGINYSISSACATSAHCIGHAADLIKNGQ 179

Query: 181 QDIMFAGGQEDLDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLE 240
           QDI+ AGG +D  W+ S LFDAMGA+SS+FN DP  ASRPYD+ RDGFVISGGA +++LE
Sbjct: 180 QDIVIAGGSDDEHWSSSCLFDAMGALSSNFNADPTIASRPYDANRDGFVISGGAGMLILE 239

Query: 241 EMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQALSSVEEPVDYINTHGTA 300