RPSBLAST alignment for GI: 254780461 and conserved domain: pfam02801

>gnl|CDD|145778 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase, C-terminal domain. The structure of beta-ketoacyl synthase is similar to that of the thiolase family (pfam00108) and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains. Length = 117
 Score =  107 bits (270), Expect = 5e-24
 Identities = 37/110 (33%), Positives = 49/110 (44%), Gaps = 8/110 (7%)

Query: 253 YAELTGYGSTCDGDDMVS---PSGEGAIRCMRQALSSVE---EPVDYINTHGTATPKGDK 306
           YA + G     DG        P+G    R +R AL+      E VDY+  HGT TP GD 
Sbjct: 1   YAVIRGSAVNQDGAAHNGLTAPNGPAQARAIRAALADAGLDPEDVDYVEAHGTGTPLGDP 60

Query: 307 KEVEAIREVFKGNIP--YIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFI 354
            E EA++ VF        + S KS  GH   AAG    I  ++ ++   I
Sbjct: 61  IEAEALKAVFGPGRRPLPVGSVKSNIGHLEAAAGVAGLIKAVLALRHGVI 110