RPSBLAST alignment for GI: 254780461 and conserved domain: COG3321

>gnl|CDD|33130 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 1061
 Score =  132 bits (332), Expect = 2e-31
 Identities = 92/341 (26%), Positives = 150/341 (43%), Gaps = 31/341 (9%)

Query: 81  EAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSST 140
           EA+ D+ + P  +    TG+ AG+       ++ A D             +A+    SS 
Sbjct: 101 EALEDAGIYPDSLRGSATGVFAGASVADYLLLLLADD--------EAEPEYAITGNSSSV 152

Query: 141 ASATLSTWFKIRGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSN-L 199
           A+  +S    + G S ++ +AC++S   +  A + ++ G+ D+  AGG   +    S+ L
Sbjct: 153 AAGRISYVLGLSGPSVTVDTACSSSLVAVHLACQSLRLGECDLALAGGVNLVLSPESSYL 212

Query: 200 FDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAAVIVLEEMERAKARGAKIYAELTGY 259
           F A G +S           + +D+  DG+V   GA V+VL+ +  A+  G +IYA + G 
Sbjct: 213 FSAGGMLSPDGR------CKAFDADADGYVRGEGAGVVVLKRLSDAERDGDRIYAVIRGS 266

Query: 260 GSTCDG--DDMVSPSGEGAIRCMRQALSSVE---EPVDYINTHGTATPKGDKKEVEAIRE 314
               DG  + + +P+ E     +R+AL+        V Y+  HGT TP GD  E  A+  
Sbjct: 267 AVNQDGRSNGLTAPNLEAQADVIREALADAGIDPATVQYVEAHGTGTPLGDPIEANALGA 326

Query: 315 VFKGNIP----YIQSTKSLTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEEIDPE--FK 368
           V+    P     I S KS  GH   AAG    I   + ++  +I  + + +  +PE  F 
Sbjct: 327 VYGEGAPAQPCAIGSVKSNIGHLEAAAGIAGLIKTALALKHGYIPPTLHFDTPNPEIDFD 386

Query: 369 GIPIV-----RKRIDNAKIDTVLSNSFGFGGTNATLVFRRY 404
             P V                   +SFGFGGTNA ++    
Sbjct: 387 SSPFVVPTEATPWPTGGGPRRAGVSSFGFGGTNAHVILEEA 427