>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages: (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer. Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC) and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales . This entry represents DP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligases (MurE; 6.3.2.13 from EC). An exception is found with Staphylococcus aureus, in which diaminopimelate is replaced by lysine in the peptidoglycan and MurE is (6.3.2.7 from EC). The Mycobacteria, part of the closest neighbouring branch outside of the low-GC Gram-positive bacteria, use diaminopimelate.; GO: 0005524 ATP binding, 0016881 acid-amino acid ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.

Probab=93.39 E-value=0.35 Score=26.96 Aligned_cols=228 Identities=17% Similarity=0.151 Sum_probs=93.3 Q ss_pred CEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEEC-CHHHHHHHHHHHHCCCCEEEEECCCCCH--HHHHHHHHHHHHHHC Q ss_conf 7899938898852589999999989988999948-9789999999985159649998779999--999999999999837 Q gi|254780462|r 8 KRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQ-GESIGKRLKPLALTVDSDFMIPCNVEDP--SSMDLLFERIKERWE 84 (267) Q Consensus 8 K~~lItGas~~~GIG~aia~~l~~~Ga~V~i~~~-~~~~~~~~~~l~~~~~~~~~~~~Dv~~~--~~v~~~~~~~~~~~g 84 (267) T Consensus 89 ~viGvTGTNGKTtt~~li~~~l~~~G~~tgliGT~g~~~~g---------~~~~~~~~~~TTP~~~~~q~~L~~~~~~-- 157 (494) T TIGR01085 89 KVIGVTGTNGKTTTTSLIAQLLELLGKKTGLIGTIGYRLGG---------NELIKDPASLTTPEALTLQKTLAEMVEA-- 157 (494) T ss_pred EEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEEEECCC---------CCCCCCCCCCCCCCCHHHHHHHHHHHHC-- T ss_conf 68999712874489999999998679708998654530477---------6312665556799718999999999965-- Q ss_pred CCCEEEE---CCCCCCC-CCC------CCCCCCCCHH--HHHHHHHCCCCHHHHHHHH-CCCCC--CCCCEEEEEEEEEE Q ss_conf 9889993---6833177-655------5761257999--9977650166112322210-02224--46841689887520 Q gi|254780462|r 85 TLDFVVH---SIAFSDK-NEL------RGPYYNTSRD--NFIQTMLVSCFSFTEIVRR-AAQLM--PHGGAMITLTYGGS 149 (267) Q Consensus 85 ~iD~lVn---nAg~~~~-~~~------~~~~~~~~~e--~~~~~~~vn~~~~~~~~~~-~~~~~--~~~G~II~isS~~~ 149 (267) T Consensus 158 g~~~~v~EvSSHaL~q~TARV~~~~F~~~vFTNl~~DHLDfHgtmEnY~~aK~~LF~~~~~~~~~~~~~~aV~n~dD~~~ 237 (494) T TIGR01085 158 GAQYAVMEVSSHALAQGTARVEGVDFDAAVFTNLTRDHLDFHGTMENYFAAKAKLFTELGLKSDRRRARFAVINLDDEYG 237 (494) T ss_pred CCCEEEEEEEHHHHHCCCCEEECCEEEEEEEECCCHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCHHH T ss_conf 99799998630124214211102115799960788302340334899999998524400136775356611588645446 Q ss_pred C---CCCCCCCCCHHHHH-----HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHCCCCCHHHHHHHHHCCCCCC-C- Q ss_conf 1---45643210000015-----677631477998421085897562287268557507984799999982688998-7- Q gi|254780462|r 150 M---RVVPNYNAMAPAKS-----ALESSTKYLACDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKR-T- 219 (267) Q Consensus 150 ~---~~~~~~~~Y~asKa-----al~~ltr~lA~El~~~gIrVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~r-~- 219 (267) T Consensus 238 ~~f~~~~~~~~~~~~~~~~A~~R~~~~~~~~~~~~~~~~G~~~~~~~~~g~~~~~~~~LiG~FNv~N~lAa~a~~~~~gg 317 (494) T TIGR01085 238 AQFVKRLPKDITVSAITQKADWRGKAQDIKITDSGYSFEGQSFTFETPAGVEFKLHTPLIGRFNVYNLLAALATLLHLGG 317 (494) T ss_pred HHHHHHHHHHCEEEEEEECCCCCCCCCCCHHHCCCCEEEEEEEEEECCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCC T ss_conf 99986102522577885042126311240110000103456667524675206887536136889999999999997338 Q ss_pred CCHHHHHHHHHHHHCHHHCCCCCCEEEECCCC Q ss_conf 66999999999861988788788689986884 Q gi|254780462|r 220 VSLEDIGNSALYLLSYLSNGVTGEIHYVDCGY 251 (267) Q Consensus 220 ~~~edva~~v~fL~Sd~s~~iTGq~l~VDGG~ 251 (267) T Consensus 318 ~~~~~~~~~l~~~~g-----v~GRmE~v~~~~ 344 (494) T TIGR01085 318 IDLEDIVAALEKLRG-----VPGRMELVDGGQ 344 (494) T ss_pred CCHHHHHHHHHHCCC-----CCCCCEEECCCC T ss_conf 889999989873489-----987312302789

HHsearch alignment for GI: 254780462 and conserved domain: TIGR01085