RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780463|ref|YP_003064876.1| putative peptidoglycan binding protein [Candidatus Liberibacter asiaticus str. psy62] (673 letters) >gnl|CDD|34155 COG4477, EzrA, Negative regulator of septation ring formation [Cell division and chromosome partitioning]. Length = 570 Score = 37.5 bits (87), Expect = 0.011 Identities = 37/183 (20%), Positives = 74/183 (40%), Gaps = 13/183 (7%) Query: 219 FKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGID------EKLVSIVNSTHNLLSLLKL 272 + L E++ S + ++ + G I+ E+ V N L +L Sbjct: 257 LERLKEQLVENSELLTQLELDEAEEELGLIQEKIESLYDLLEREVEAKNVVEENLPILPD 316 Query: 273 LNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDV 332 EK + L E V+++ + A++ V KFEK L+ + + + +I ++ Sbjct: 317 YLEKAKEN-----NEHLKEEIERVKESYRLAETELG-SVRKFEKELKELESVLDEILENI 370 Query: 333 REQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEE-RQNTSEDPAILRNLENQLLNIK 391 Q+ D +E+I + L ++E + L R++ E L L+++L IK Sbjct: 371 EAQEVAYSELQDNLEEIEKALTDIEDEQEKVQEHLTSLRKDELEARENLERLKSKLHEIK 430 Query: 392 DLV 394 + Sbjct: 431 RYM 433 >gnl|CDD|31474 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism]. Length = 533 Score = 33.6 bits (77), Expect = 0.17 Identities = 44/190 (23%), Positives = 69/190 (36%), Gaps = 40/190 (21%) Query: 305 SYTQKFVEKFEKHLESIGAQVQDI---HSDVREQQKPAK------PRLDLIEKIGERLG- 354 ++ +E+ +++E +V++I V + K + L E+ R Sbjct: 345 DSIEQMLERLYEYIEGDAKKVKEIRKLEDAVDRLYEEIKLYLARLSKEGLSEEESRRWAE 404 Query: 355 ------NLESHVANIMLKLEERQNT--------SED------PAILRNLENQLLNIKDLV 394 NLE H+ +I+ +L E + SED LEN L I LV Sbjct: 405 IIDAAINLE-HIGDIIERLLELADKKIANGRAFSEDGLEELDALFALTLENLRLAISVLV 463 Query: 395 TNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLNSINKS---QDIERILQK------ 445 T DL+ R L E + V LE K R S+ S DI R L++ Sbjct: 464 TGDLELARRLVERKKRVRRLERRSSKRHLDRLRDGAASVETSSLHLDILRDLKRINSHIA 523 Query: 446 NMHEYCKEIQ 455 ++ E Sbjct: 524 SVAYPVLEES 533 >gnl|CDD|147678 pfam05649, Peptidase_M13_N, Peptidase family M13. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk. Length = 379 Score = 31.9 bits (73), Expect = 0.57 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query: 265 NLLSLLKLLNEKIST--KGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEK 316 LL L L ++ + V++F+TKL++ + E+ R YA+ Y + + + Sbjct: 163 KLLKLAGLDEDEAEKAAEDVVAFETKLAKASWSREELRDYAKLYNPMTLAELQA 216 >gnl|CDD|37429 KOG2218, KOG2218, KOG2218, ER to golgi transport protein/RAD50-interacting protein 1 [Intracellular trafficking, secretion, and vesicular transport, Cell cycle control, cell division, chromosome partitioning]. Length = 737 Score = 31.5 bits (71), Expect = 0.82 Identities = 25/141 (17%), Positives = 51/141 (36%), Gaps = 3/141 (2%) Query: 403 TLREPDQHVFGLEDYIVKTAHKTARS-MLNSINKSQDIERILQKNMHEYCKEIQKVHAEQ 461 TL E D +F LE+ I +A K S + + +IE IL +H +++ + + Sbjct: 126 TLLELDTLLFSLENSIFLSASKALFSTSFSLFEEINNIEEILVARLHLIWRKLFRSFDRR 185 Query: 462 TIKNFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPN--HQASHKYSELFKNLCSDN 519 T+K L F+ + + S S L + + F L + Sbjct: 186 TVKWHKLLRKQKSSDFEAILSSLRWPLATLMSESVGLKSPLREMLKSLFCQSFLFLSEET 245 Query: 520 TPSVNQTRVESNTYNEQYPIL 540 ++ ++ + + + Sbjct: 246 LQGESRRPLQYFKESVEPVLW 266 >gnl|CDD|144876 pfam01442, Apolipoprotein, Apolipoprotein A1/A4/E domain. These proteins contain several 22 residue repeats which form a pair of alpha helices. This family includes: Apolipoprotein A-I, Apolipoprotein A-IV, and Apolipoprotein E. Length = 191 Score = 31.4 bits (72), Expect = 0.88 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Query: 283 LSFDTKLSEIKTAVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPR 342 L E+ + E+ ++ Y Q+F + K E++ ++Q +VR + +P Sbjct: 1 TLLSDSLDELNSYAEELQEQLGPYAQEFWAQLSKETEALREELQKDLEEVRARLQPY--L 58 Query: 343 LDLIEKIGERLGNLESHVANIMLKLEERQNT 373 +L K+G+ L L +A +L ER N Sbjct: 59 DELKAKVGQNLEELRQRLAPYAEELRERLNR 89 >gnl|CDD|147584 pfam05478, Prominin, Prominin. The prominins are an emerging family of proteins that among the multispan membrane proteins display a novel topology. Mouse prominin and human prominin (mouse)-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration. Length = 809 Score = 30.8 bits (70), Expect = 1.5 Identities = 23/124 (18%), Positives = 50/124 (40%), Gaps = 16/124 (12%) Query: 366 KLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDY--IVKTAH 423 +L+ N + + L+N+ L+++ + N + +L LE VKT Sbjct: 631 ELDALANNLPNGKLKVALKNEALDLRSIQQNFVPPMESL---------LEKLNSNVKTLD 681 Query: 424 KTARSMLNSI----NKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDM-LVKIFQ 478 +++ + N++ + Q + L N E E K ++ + D + +I + Sbjct: 682 ESSNDLQNAVKDVLAEVQAAQGFLNNNASEIVNEESKKFLDRILGYIDQYIDWVIEEITE 741 Query: 479 KLGT 482 K+G Sbjct: 742 KVGR 745 >gnl|CDD|37671 KOG2460, KOG2460, KOG2460, Signal recognition particle, subunit Srp68 [Intracellular trafficking, secretion, and vesicular transport]. Length = 593 Score = 30.4 bits (68), Expect = 1.6 Identities = 67/420 (15%), Positives = 127/420 (30%), Gaps = 79/420 (18%) Query: 206 NWKGALQHFK--KLDFKNLHEKINTL-----------SCQMNVMQCTFDKNNNGFAASGI 252 WK A + F KL ++ L N Q N+ C ++ + I Sbjct: 167 KWKDAAEAFNNAKLVYEKLAHAKNLELEESVYDNRVNEIQPNLRYCAYNIIGPE-SNGFI 225 Query: 253 DEKLVSIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKFVE 312 DE + S L+ LL+ ++ IS + T T + + E Sbjct: 226 DELMQSREQKDEELVKLLESVDFLISIQ------TSTESSATTTTIEWRGRKVKVI--DE 277 Query: 313 KFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGN-LESHVANIMLKLEERQ 371 K + L DI + + +L L+EK R + +++ I + ++R Sbjct: 278 KVRQFLLQG----LDIEPALAQITTY-DQKLSLLEKALARCEDAIQNVRDEIKIDEKQRN 332 Query: 372 NTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTARSMLN 431 +T IL L+ L D N + + ++ Sbjct: 333 STLNGQIILAYLKYNKLLTTISRNEDAFTN-----------------LWNQWLSQQTSDP 375 Query: 432 SINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRRLP 491 + QD+ER L ++ + EI ++ ++ K + ++ F+ Sbjct: 376 KKLRPQDLER-LYDSIIKNLSEIMELPGLESDKELQSQLELKKLYFKAFRCFY------- 427 Query: 492 YSTSNDLSPNHQASHKYSELFKNLCSDNTPSVNQTRVESNTYNEQYPILSSNNSLDQHNH 551 ++ ++QA KYSE L + + E ++ E L Sbjct: 428 ------IAVSYQAKKKYSEALA-LYVRAYSYLQEVNSELESFKESLLPLLLLEL------ 474 Query: 552 PHDISETQGDSVYDQKKR----------EKEFNSPHDIQHMLERVSLIQQGILEDDNTIP 601 ISE Q + D ++E + + + D Sbjct: 475 ---ISELQKRKESLGAAVILLAEYAKRTNTGGSQGKDNLPLVETLDSYKLDLSLDTKLPN 531 >gnl|CDD|33075 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]. Length = 835 Score = 29.9 bits (67), Expect = 2.4 Identities = 29/189 (15%), Positives = 60/189 (31%), Gaps = 43/189 (22%) Query: 264 HNLLSLLKLLNEK-------------ISTKGVLSFDTKLSEIKTAVEKNRKYAQSYTQKF 310 L L + +N K + + + ++ A+ + + + Sbjct: 29 AALQLLQEAVNSKRQEEAEPAAEEAELQAELIQQELAINDQLSQALNQQTERLNALASD- 87 Query: 311 VEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNL--ESHVANIMLKLE 368 ++ L ++ Q+ +REQ + L L + ++LG L + Sbjct: 88 ----DRQLANLLLQLLQSSRTIREQIAVLRGSLLLSRILLQQLGPLPEAGQPQEQFEVTQ 143 Query: 369 ERQN-TSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTAR 427 ER +E I N L + +T +++D I+ T R Sbjct: 144 ERDALQAEKAYI-----NALEGQAEQLTAEVRD-----------------ILDQILDTRR 181 Query: 428 SMLNSINKS 436 +LNS+ Sbjct: 182 ELLNSLLSQ 190 >gnl|CDD|36214 KOG0996, KOG0996, KOG0996, Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics, Cell cycle control, cell division, chromosome partitioning]. Length = 1293 Score = 29.9 bits (67), Expect = 2.4 Identities = 57/413 (13%), Positives = 146/413 (35%), Gaps = 26/413 (6%) Query: 81 SPIQREDDCNVVRTNDDTKQIFNLLRKKLS--NPHLQQHIESKTEQNGGIDPNLQSESLP 138 ++ +R +K+ L + LS + +QH E E + E +P Sbjct: 759 KKVKGGRMGTSIRVTGVSKESVEKLERALSKMSDKARQHQEQLHELEERVRKL--RERIP 816 Query: 139 TIPGTAIREDDDIDIFHSDMAKLSKSITEL-CRIISIPGIKKSHSQLEKILSKMENIAKE 197 + + + + L I EL ++ KK +LE+ + +++ Sbjct: 817 ELENRLEKLTASVKRLAELIEYLESQIAELEAAVLKKVVDKKRLKELEEQIEELK----- 871 Query: 198 CSLQSVENNWKGALQHFKKLDFKNLHEKINTLSCQMNVMQCTFDKNNNGFAASGIDEKLV 257 + VE + A + + + +N ++I Q + + I + V Sbjct: 872 ---KEVEELQEKAAKKARIKELQNKIDEIGGEKVQAQKDKVEKINEQLDKLEADIAKLTV 928 Query: 258 SIVNSTHNLLSLLKLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYA---QSYTQKFVEKF 314 +I S N+ K L+E + + + +L ++ ++ + A + ++ E Sbjct: 929 AIKTSDRNIAKAQKKLSE--LEREIEDTEKELDDLTEELKGLEEKAAELEKEYKEAEESL 986 Query: 315 EKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQN-- 372 ++ + + ++ + + + + R+D+ K+ G L + I + E+ Sbjct: 987 KEIKKELRDLKSELENIKKSENELKAERIDIENKLEAINGELNEIESKIK-QPEKELKKL 1045 Query: 373 -----TSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLEDYIVKTAHKTAR 427 T P I ++E+ +++ +++ + L E D V + Sbjct: 1046 SLCNMTETRPQIELDVESPEELEAEMLEDNINEKIALLEKRVEELREVDLGVIAEYAKKV 1105 Query: 428 SMLNSINKSQDIERILQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKL 480 + + + E +E++K ++ + F + L +++Q + Sbjct: 1106 ELYLKRVAELEKFTQKRDEHREKLEELRKRRLDEFMAGFNIISMKLKEMYQMI 1158 >gnl|CDD|31697 COG1508, RpoN, DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog [Transcription]. Length = 444 Score = 29.5 bits (66), Expect = 2.8 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Query: 2 SGLTPLKDHSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKPLS 50 GL LK S +++ E S IK I+ E+K KPLS Sbjct: 360 RGLFELKYFFSSSLASSEGGEASSTEAIKALIKKLIEA---EDKKKPLS 405 >gnl|CDD|30902 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]. Length = 663 Score = 29.4 bits (66), Expect = 3.2 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Query: 286 DTKLSEIKTAVEKN-RKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDV 332 D LSEI+ V KN R + T+K E ++L+ +G +V+ +HSD+ Sbjct: 433 DDLLSEIRKRVAKNERVLVTTLTKKMAEDLTEYLKELGIKVRYLHSDI 480 >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the early G1 phase by CDK4 or CDK6, the G1/S phase transition by CDK2, or the entry of mitosis by CDK1. They also exhibit overlapping cyclin specificity and functions in certain conditions. Knockout mice with a single CDK deleted remain viable with specific phenotypes, showing that some CDKs can compensate for each other. For example, CDK4 can compensate for the loss of CDK6, however, double knockout mice with both CDK4 and CDK6 deleted die in utero. CDK8 and CDK9 are mainly involved in transcription while CDK5 is implicated in neuronal function. CDK7 plays essential roles in both the cell cycle as a CDK-Activating Kinase (CAK) and in transcription as a component of the general transcription factor TFIIH. Length = 282 Score = 29.4 bits (67), Expect = 3.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Query: 470 YDMLVKIFQKLGTLTEE 486 D L KIFQ LGT TEE Sbjct: 205 IDQLFKIFQILGTPTEE 221 >gnl|CDD|39109 KOG3906, KOG3906, KOG3906, Tryptophan 2,3-dioxygenase [Amino acid transport and metabolism]. Length = 399 Score = 28.9 bits (64), Expect = 4.9 Identities = 38/176 (21%), Positives = 65/176 (36%), Gaps = 46/176 (26%) Query: 240 FDKNNNGFAASGIDE-KLVSIVNSTHNLLSLLKLLNEKIS-------------------T 279 D + +DE K + IV+ + +LKLL E+I+ Sbjct: 86 LDSVRKLLNNTVVDETKTLKIVSRLDRVTKILKLLVEQITILETMTPLDFVDFRKYLTPA 145 Query: 280 KGVLSFDTKLSEIKTAVEKNRKY---AQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQ 336 G S +L E K V + R+ AQ Y F + +++ + ++ Sbjct: 146 SGFQSLQFRLLENKLGVLQERRVKYNAQHYKDVFND-------------EELKTLNVSEE 192 Query: 337 KPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKD 392 + + L+L+E ER LES N +K E+ ++ R LE+ D Sbjct: 193 EKS--LLELVESWLERTPGLESTGFNFWIKYEK--------SVNRYLEDLAKQAAD 238 >gnl|CDD|145900 pfam02994, Transposase_22, L1 transposable element. Length = 370 Score = 28.9 bits (64), Expect = 5.5 Identities = 24/107 (22%), Positives = 47/107 (43%), Gaps = 2/107 (1%) Query: 312 EKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQ 371 EK K L + + +++ + R +K IE +R G +++ N + ++EER Sbjct: 94 EKCLKELMELKKKARELKEECRSIKKEHMETTLDIENQKKRQGVVDTSFTNRIQEMEERI 153 Query: 372 NTSEDPA--ILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGLED 416 + +ED I R + K L N + +R P+ + G+ + Sbjct: 154 SGAEDSIEEIKRTGKFNEKRKKRLEQNIQEIQDYVRRPNLRIIGVPE 200 >gnl|CDD|147394 pfam05185, PRMT5, PRMT5 arginine-N-methyltransferase. The human homologue of yeast Skb1 (Shk1 kinase-binding protein 1) is PRMT5, an arginine-N-methyltransferase. These proteins appear to be key mitotic regulators. They play a role in Jak signalling in higher eukaryotes. Length = 447 Score = 28.8 bits (65), Expect = 5.5 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 10/60 (16%) Query: 295 AVEKNRKYAQSYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLDLIEKIGERLG 354 AVEKN A QK V E G +V I SD+RE + P K D++ + E LG Sbjct: 219 AVEKNP-NAVVTLQKRVNF-----EEWGDKVTLISSDMREWKGPEKA--DIL--VSELLG 268 >gnl|CDD|38808 KOG3602, KOG3602, KOG3602, WD40 repeat-containing protein [General function prediction only]. Length = 1459 Score = 28.5 bits (63), Expect = 5.7 Identities = 34/187 (18%), Positives = 60/187 (32%), Gaps = 29/187 (15%) Query: 355 NLESHVANIMLKLEERQNTSEDPAILRNLENQLLNIKDLVTNDLKDNRTLREPDQHVFGL 414 +L H+ + KL E S A + L ++ KD+ + E H Sbjct: 197 SLGRHLDSEAQKLLETLRDSRSLAKGEEENAEDLTVE-WTGRRGKDSESHPEYLNHFLQE 255 Query: 415 EDY-IVKTAHKTARSMLNSINKSQ-------DIERILQKNMHEYCKEIQKVHAEQTIK-- 464 ++ +N N+S +I R + E+ + K++A Q + Sbjct: 256 FYKSLLSLVDSAMEKEVNMQNQSDPEVLQHLEICREIFFGRPEFILKA-KLYALQPLNLR 314 Query: 465 -------------NFTTLYDMLVKIFQKLGTLTEEGRRLPYSTSNDLSPNHQASHKYSEL 511 Y L + F+ LGTL + ++ S+ Q Y Sbjct: 315 GCGKTSLLLAIAAFLPEWYPHLRRYFRFLGTLPDSSIQVAELYSSCA----QIDKNYLVP 370 Query: 512 FKNLCSD 518 KNL + Sbjct: 371 IKNLPTC 377 >gnl|CDD|35383 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain [Cytoskeleton]. Length = 1930 Score = 28.7 bits (64), Expect = 6.3 Identities = 41/231 (17%), Positives = 83/231 (35%), Gaps = 16/231 (6%) Query: 271 KLLNEKISTKGVLSFDTKLSEIKTAVEKNRKYAQ-----SYTQKFVEKFEKHLESIGAQV 325 + +E + +K L D EI+ N+ Q +++ ++ LE Sbjct: 1597 RSKSEALRSKKKLEGDINELEIQLDH-ANKANEDAQKQLKKLQAQLKELQRELEDAQRAR 1655 Query: 326 QDIHSDVREQQKPAKPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAILRNLEN 385 +++ + E ++ +E++ E+L LE L+LEE +E L + Sbjct: 1656 EELLEQLAEAERRLAALQAELEELREKLEALERARRQAELELEE---LAERVNELNAQNS 1712 Query: 386 QLLNIKDLVTNDLKD-NRTLREPDQHVFGLEDYIVKT---AHKTARSMLNSINKSQDIER 441 L K + ++ L E + E+ K A K A + SQ +ER Sbjct: 1713 SLTAEKRKLEAEIAQLQSELEEEQSELRAAEERAKKAQADAAKLAEELRKEQETSQKLER 1772 Query: 442 I---LQKNMHEYCKEIQKVHAEQTIKNFTTLYDMLVKIFQKLGTLTEEGRR 489 + L++ + + + + + + +I + L E RR Sbjct: 1773 LKKSLERQVKDLQLRLDEAEQAALKGGKKQIAKLEARIRELESELEGEQRR 1823 >gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP). This family consists of several eukaryotic kinesin-associated (KAP) proteins. Kinesins are intracellular multimeric transport motor proteins that move cellular cargo on microtubule tracks. It has been shown that the sea urchin KRP85/95 holoenzyme associates with a KAP115 non-motor protein, forming a heterotrimeric complex in vitro, called the Kinesin-II. Length = 708 Score = 28.3 bits (63), Expect = 6.4 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 11/53 (20%) Query: 240 FDKNNNGFAASGIDEKLVSIVNSTHNLL---SLLKLLNEKISTKGVLSFDTKL 289 FD+N N +GI EKL+ + H L +L L N LSFDT L Sbjct: 316 FDENKNEMEENGIIEKLLKLFPCQHEDLLNITLRLLFN--------LSFDTGL 360 >gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms]. Length = 194 Score = 27.9 bits (62), Expect = 9.4 Identities = 11/41 (26%), Positives = 17/41 (41%) Query: 340 KPRLDLIEKIGERLGNLESHVANIMLKLEERQNTSEDPAIL 380 P LD+ E L +A + +LEER+ +L Sbjct: 114 LPILDVAVSRFEERRALRRELAKLKDRLEERKVIERAKGLL 154 >gnl|CDD|35702 KOG0481, KOG0481, KOG0481, DNA replication licensing factor, MCM5 component [Replication, recombination and repair]. Length = 729 Score = 28.0 bits (62), Expect = 9.6 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 3/75 (4%) Query: 10 HSSCAVSKKSELENPSGMTDIHRIKNWIQKVIGEEKNKP-LSQEQKEKIKILWSSLRKIA 68 H S A ++ E G I ++K +IQ K P LS E EK+ + ++RK Sbjct: 531 HVSKANAQTDSQEENEGEIPIEKLKRYIQYC--RLKCGPRLSAEAAEKLSSRYVTMRKGV 588 Query: 69 GSNEEVSDPNLNSPI 83 +E+ SD + PI Sbjct: 589 RQHEQDSDKRSSIPI 603 >gnl|CDD|176521 cd08579, GDPD_memb_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial glycerophosphodiester phosphodiesterases. In addition to a C-terminal GDPD domain, most members in this family have an N-terminus that functions as a membrane anchor. Length = 220 Score = 27.9 bits (63), Expect = 9.9 Identities = 22/100 (22%), Positives = 39/100 (39%), Gaps = 19/100 (19%) Query: 260 VNSTHNLLSLLKLLNEKISTKG----VLSFDTKLS-----------EIKTAVEKNRKYAQ 304 VN L+L +L I G + S D L+ E+K + + Sbjct: 56 VNKKVWDLTLEELKKLTIGENGHGAKIPSLDEYLALAKGLKQKLLIELKP----HGHDSP 111 Query: 305 SYTQKFVEKFEKHLESIGAQVQDIHSDVREQQKPAKPRLD 344 +KFV+ ++++L QV + V E+ K P++ Sbjct: 112 DLVEKFVKLYKQNLIENQHQVHSLDYRVIEKVKKLDPKIK 151 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.312 0.129 0.357 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 7,552,320 Number of extensions: 386163 Number of successful extensions: 1013 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1009 Number of HSP's successfully gapped: 59 Length of query: 673 Length of database: 6,263,737 Length adjustment: 100 Effective length of query: 573 Effective length of database: 4,102,837 Effective search space: 2350925601 Effective search space used: 2350925601 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 61 (27.5 bits)