HHsearch alignment for GI: 254780464 and conserved domain: COG1025

>COG1025 Ptr Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones].
Probab=99.72  E-value=8.6e-15  Score=118.18  Aligned_cols=376  Identities=11%  Similarity=0.124  Sum_probs=240.2

Q ss_pred             ECCCCCEEEEECCC--C-CEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEECCCE
Q ss_conf             87987199998589--9-87999999833114488889834899998973356888988999999970876799753223
Q gi|254780464|r    7 KTSSGITVITEVMP--I-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEH   83 (424)
Q Consensus         7 ~L~NGl~v~~~~~~--~-~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t~~d~   83 (424)
T Consensus       507 ~~~~~~~wy~~~d~F~~~PK~~v~~~irsp~~~~s~r~~Vl~~l~~~la~dal~~~~y-----~A~~aG~sfs~~~~~~G  581 (937)
T COG1025         507 EDPNLRLWYLKEDYFAVEPKASVSLAIRSPHASRSPRNQVLTELYAYLANDALDKLSY-----QASLAGLSFSLAANSNG  581 (937)
T ss_pred             CCCCCEEEEECCCCCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-----HHHHCCEEEEEECCCCC
T ss_conf             4888448984377566677623699975753455789999999999997878876302-----77755657885047886


Q ss_pred             EEEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCC-CCCCCCCHHHCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             799961266565210012223221035662001124556766665113-3211100000012222222222222210344
Q gi|254780464|r   84 TSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSE-DDSWDFLDARFSEMVWKDQIIGRPILGKPET  162 (424)
Q Consensus        84 ~~~~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~-~~p~~~~~~~~~~~~f~~~~~~~~~~g~~~~  162 (424)
T Consensus       582 l~ltisGft~~lp~L~~~~l~~l~~~~~~~~~f~~~K~~~~~~~~~a~~~~p~~~~~~~l~~l~~~~~~---s~~e~~~~  658 (937)
T COG1025         582 LDLTISGFTQRLPQLLRAFLDGLFSLPVDEDRFEQAKSQLSEELKNALTGKPYRQALDGLTGLLQVPYW---SREERRNA  658 (937)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCC---CHHHHHHH
T ss_conf             699960565124999999999873489987899999999999997665148799987875665178876---78999987


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCC--CCEEEEE--CCCCCCCEE
Q ss_conf             200016677642011245663000002545512211221101235877778866422332--2102330--368432102
Q gi|254780464|r  163 ISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY--VGGEYIQ--KRDLAEEHM  238 (424)
Q Consensus       163 i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~p~~~--~~~~~~~--~~~~~~~~i  238 (424)
T Consensus       659 l~~v~~~e~~~f~~~l~~~~~lE~lv~Gn~~~~da~~l~~~~~~~l~~~~s~~~~~~~~~~~~~~~~~~e~~~~~~~~an  738 (937)
T COG1025         659 LESVSVEEFAAFRDTLLNGVHLEMLVLGNLTEADATNLAETLQKKLPAIGSTWYRNPSVYLLKGGTRIFETVGGESDSAN  738 (937)
T ss_pred             HHHCCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEECCCCCEEEEEECCCCCCCCC
T ss_conf             64244999987888764103401466356038889889999986502467755678752306887167641268865554


Q ss_pred             EECCCCCCCC-CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECC---CCHHHHHHHH
Q ss_conf             3010000135-21135689987776248765322220002686210133322210122013444258---3024777877
Q gi|254780464|r  239 MLGFNGCAYQ-SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA---KENIMALTSS  314 (424)
Q Consensus       239 ~~~~~~~~~~-~~d~~al~ll~~iLg~g~sSrL~~~lRe~~glaY~v~s~~~~~~~~g~~~i~~~~~---~~~~~~~~~~  314 (424)
T Consensus       739 ~~i~~~~~~~~~~~~a~s~Ll~~l~----~~~ff~~LRTkeQLGY~Vfs~~~~v~~~~gi~f~vqS~~~~p~~L~~r~~~  814 (937)
T COG1025         739 AAILYPQQYDEIKSSALSSLLGQLI----HPWFFDQLRTKEQLGYAVFSGPREVGRTPGIGFLVQSNSKSPSYLLERINA  814 (937)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHHHH----HHHHHHHHHHHHHCCEEEEECCEEECCCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             1067514666088799999999997----677687764566404389740234257254599995799882999999999


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCC--CCCCHHHHHHHHHCCCHHHHHHHHHHHC
Q ss_conf             89999853148998999999999999998513898999999999999689--8479899999887279899999999862
Q gi|254780464|r  315 IVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG--SILCSEKIIDTISAITCEDIVGVAKKIF  392 (424)
Q Consensus       315 i~~~i~~l~~~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~--~~~~~~~~~~~i~~vt~~di~~~~~~~l  392 (424)
T Consensus       815 F~~~~~~~l~~ms~e~Fe~~k~alin~il~~~~nl~e~a~r~~-~~~~~g~~~Fd~~ek~i~~vk~LT~~~l~~f~~~~l  893 (937)
T COG1025         815 FLETAEPELREMSEEDFEQIKKALINQILQPPQNLAEEASRLW-KAFGRGNLDFDHREKKIEAVKTLTKQKLLDFFENAL  893 (937)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH-HHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             9998999987189999999999999998716888899999999-996368778673789999998649999999999751


Q ss_pred             CCC
Q ss_conf             778
Q gi|254780464|r  393 SST  395 (424)
Q Consensus       393 ~~~  395 (424)
T Consensus       894 ~~~  896 (937)
T COG1025         894 SYE  896 (937)
T ss_pred             CCC
T ss_conf             103