HHsearch results for GI: 254780464 and protein with PDBid: 1hr6_A

>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A*
Probab=98.38  E-value=7.4e-06  Score=56.82  Aligned_cols=128  Identities=15%  Similarity=0.171  Sum_probs=58.7

Q ss_pred             HHHHHHHHCCEEEEEECC----C--EEEEEEECCCCCCCCCHHHHHHHHHCC------CCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             999999708767997532----2--379996126656521001222322103------5662001124556766665113
Q gi|254780464|r   64 IVEEIEKVGGDINAYTSL----E--HTSYHAWVLKEHVPLALEIIGDMLSNS------SFNPSDIERERNVVLEEIGMSE  131 (424)
Q Consensus        64 ~~~~l~~~G~~~na~t~~----d--~~~~~~~~~~~~~~~~l~ll~~~~~~p------~~~~~~~~~ek~~v~~e~~~~~  131 (424)
                      +.+..+..|...++++..    +  .+.+++.+.+++.+.+++.+.+.+.+-      .++++++++.|..++.++....
T Consensus       290 ~~~lre~~gl~ys~~s~~~~~~~~g~f~i~~~~~~~~~~~~v~~i~~el~~~~~~~~~~it~~eL~raK~~l~~~~~~~~  369 (475)
T 1hr6_A          290 YTHVLNQYYFVENCVAFNHSYSDSGIFGISLSCIPQAAPQAVEVIAQQMYNTFANKDLRLTEDEVSRAKNQLKSSLLMNL  369 (475)
T ss_dssp             HHHTTTTCSSEEEEEEEEEECSSCEEEEEEEEECGGGHHHHHHHHHHHHHTTTTCTTSCCCHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             99766514741257763034467763465676567758999999999999999847789989999999999999999865


Q ss_pred             CCCCCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC---------CCHHHHCCCCC
Q ss_conf             321110000001222222222222221034420001667764201124566---------30000025455
Q gi|254780464|r  132 DDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD---------RMYVVCVGAVD  193 (424)
Q Consensus       132 ~~p~~~~~~~~~~~~f~~~~~~~~~~g~~~~i~~lt~~~l~~f~~~~y~p~---------n~~l~i~Gd~~  193 (424)
                      +++...+.+.....++.+.+  .++.-..+.|+++|.+||++..++++..+         ..+++++|+..
T Consensus       370 e~~~~~~~~i~~~~l~~~~~--~~~~~~~~~i~~VT~~dv~~~a~~~~~~~~~~~~~g~~~~t~~~~g~~~  438 (475)
T 1hr6_A          370 ESKLVELEDMGRQVLMHGRK--IPVNEMISKIEDLKPDDISRVAEMIFTGNVNNAGNGKGRATVVMQGDRG  438 (475)
T ss_dssp             TSHHHHHHHHHHHHHHHSCC--CCHHHHHHHHHTCCHHHHHHHHHHHHTTCCCCTTCCCCCCEEEEESCGG
T ss_pred             CCHHHHHHHHHHHHHHCCCC--CCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEECCCCCEEEEECCCC
T ss_conf             89999999999999967998--9999999999787999999999997278973888438874399955512