HHsearch results for GI: 254780464 and protein with PDBid: 1pp9_B

>1pp9_B Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein, cytochrome B; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: d.185.1.1 d.185.1.1 PDB: 1bgy_B* 1be3_B* 1l0n_B* 1ntk_B* 1ntm_B* 1ntz_B* 1nu1_B* 1l0l_B* 1ppj_B* 1sqq_B* 1sqv_B* 1sqx_B* 2a06_B* 2fyu_B* 1sqb_B* 1sqp_B* 1qcr_B* 2bcc_B* 3bcc_B* 1bcc_B* ...
Probab=100.00  E-value=0  Score=541.98  Aligned_cols=409  Identities=20%  Similarity=0.290  Sum_probs=371.9

Q ss_pred             CCEEEEECCCCCEEEEECCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEEC
Q ss_conf             96189987987199998589987999999833114488889834899998973356888988999999970876799753
Q gi|254780464|r    1 MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS   80 (424)
Q Consensus         1 ~~~~~~~L~NGl~v~~~~~~~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t~   80 (424)
                      .++++++|+|||||++.+++.|+++++++|++||++|++++.|+||++|||+|+||++++..+|.+.++.+|+.+||+|+
T Consensus        22 ~~~~~~~L~NGl~v~~~~~~~p~~~i~l~v~~Gs~~E~~~~~G~ahllehl~~~Gt~~~~~~~i~~~~~~~G~~~na~t~  101 (439)
T 1pp9_B           22 QDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTST  101 (439)
T ss_dssp             CCCEEEECTTSCEEEEECCCCSEEEEEEEESCSGGGCCTTSTTHHHHHHHTTTSCBSSSCHHHHHHHHHHTTCEEEEEEC
T ss_pred             CCEEEEECCCCCEEEEEECCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEEC
T ss_conf             87279997999889998589987999999821237889797649999999984799988999999999983998999983


Q ss_pred             CCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCHH
Q ss_conf             22379996126656521001222322103566200112455676666511332111000000122222222222222103
Q gi|254780464|r   81 LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKP  160 (424)
Q Consensus        81 ~d~~~~~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f~~~~~~~~~~g~~  160 (424)
                      +|+|+|+++|++++++.+|+++++++.+|.|++++++++|+.+++|++...++|...+++.+++.+|+ ++|+++++|+.
T Consensus       102 ~~~t~y~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~i~~e~~~~~~~p~~~~~~~l~~~~f~-~~~~~~~~g~~  180 (439)
T 1pp9_B          102 RENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYR-NALANSLYCPD  180 (439)
T ss_dssp             SSCEEEEEEEEGGGHHHHHHHHHHHHHCBCCCHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHBS-SGGGSCSSCCG
T ss_pred             CCEEEEEEEECHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCC-CCCCCCCCCCH
T ss_conf             57189999974631799999997321376103999999998887876664048288889999998343-55688745676


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCEEEE
Q ss_conf             44200016677642011245663000002545512211221101235877778866422332210233036843210230
Q gi|254780464|r  161 ETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML  240 (424)
Q Consensus       161 ~~i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~i~~  240 (424)
                      ++|++++.++|++||++||+|+||+|++.|+.  ++..+.+.+.|+.++........ +..+.+.+.....+..+.++.+
T Consensus       181 ~~i~~lt~~~l~~f~~~~y~p~n~~iv~~~~~--~~~~~~l~~~f~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~  257 (439)
T 1pp9_B          181 YRIGKVTPVELHDYVQNHFTSARMALIGLGVS--HPVLKQVAEQFLNIRGGLGLSGA-KAKYHGGEIREQNGDSLVHAAL  257 (439)
T ss_dssp             GGTTTCCHHHHHHHHHHHCSGGGEEEEEESSC--HHHHHHHHHHHCCCCCCC-CCCC-CCCBCCEEEEEECCCSEEEEEE
T ss_pred             HHHCCCCHHHHHHHHHHHCCCCCEEEECCCCC--HHHHHHHHHHHCCCCCCCCCCCC-CCCCCCCEEEECCCCCCEEEEE
T ss_conf             66243689999999985058676376547884--89999999985376334577875-5577786442027864025652


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCC--------CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHH
Q ss_conf             1000013521135689987776248--------76532222000268621013332221012201344425830247778
Q gi|254780464|r  241 GFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALT  312 (424)
Q Consensus       241 ~~~~~~~~~~d~~al~ll~~iLg~g--------~sSrL~~~lRe~~glaY~v~s~~~~~~~~g~~~i~~~~~~~~~~~~~  312 (424)
                      +++.+++.++|++++.+++.+||++        ++|+|++++|+++|++|++++++..+.+.|+|.+++.|++++..+++
T Consensus       258 ~~~~~~~~~~d~~~~~~~~~~Lg~~~~~~~~~~~~s~L~~~lre~~gl~y~v~s~~~~~~~~g~~~i~~~~~~~~~~~~~  337 (439)
T 1pp9_B          258 VAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVI  337 (439)
T ss_dssp             EEECCCTTSHHHHHHHHHHHHHCCSCSBTTCCCTTCHHHHHHHHHCCSCEEEEEEEEEETTEEEEEEEEEEEGGGHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCHHHCCCCCCHHHHHHHHHHCCCCHHHCCCCCCCCCCCEEEEEEECCCCCHHHHH
T ss_conf             01345666401689999999862751232246543077877643036420100124423568448999954731067889


Q ss_pred             HHHHHHHHHHCC-CCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             778999985314-8998999999999999998513898999999999999689847989999988727989999999986
Q gi|254780464|r  313 SSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI  391 (424)
Q Consensus       313 ~~i~~~i~~l~~-~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~~~~i~~vt~~di~~~~~~~  391 (424)
                      +.+.+++.++.+ +++++||+++|+.++.++..+.+++..++..++++++.++++.+++++.+.|++||++||++++++|
T Consensus       338 ~~i~~~i~~l~~~~it~~el~~aK~~l~~~~~~~~e~~~~~a~~l~~~~l~~~~~~~~~~~~~~i~~vT~~dv~~~a~~~  417 (439)
T 1pp9_B          338 KAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKF  417 (439)
T ss_dssp             HHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHTSSHHHHHHHHHHHHHHHSSCCCHHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999999998679999999999999999999967899999999999999779989999999999678999999999998


Q ss_pred             CCCCCEEEEEECCCCCCCCHHHH
Q ss_conf             27787799981660108998999
Q gi|254780464|r  392 FSSTPTLAILGPPMDHVPTTSEL  414 (424)
Q Consensus       392 l~~~~~i~~vgp~~~~~P~~~~l  414 (424)
                      |+++++++++| |..++|+.++|
T Consensus       418 l~~~~~v~v~G-~~~~~p~~~~~  439 (439)
T 1pp9_B          418 VSGRKSMAASG-NLGHTPFIDEL  439 (439)
T ss_dssp             HHSCEEEEEEE-CGGGCCCGGGC
T ss_pred             HCCCCEEEEEC-CCCCCCCHHHC
T ss_conf             25898899988-77568891129