HHsearch results for GI: 254780464 and protein with PDBid: 3cww_A

>3cww_A Insulysin, insulin-degrading enzyme, insulinase; A-beta degrading enzyme, criptidase, kinins, hydrolase; 1.96A {Homo sapiens} PDB: 2wby_A 2wc0_A 3h44_A 3e4z_A 2wk3_A 3e4a_A* 2g47_A 2g48_A 2g49_A 2g54_A 2g56_A 2jbu_A 3e50_A 2jg4_A 3hgz_A
Probab=100.00  E-value=2.4e-34  Score=247.84  Aligned_cols=390  Identities=10%  Similarity=0.111  Sum_probs=290.1

Q ss_pred             EEECCCCCEEEEECCC---CCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEECC
Q ss_conf             9987987199998589---9879999998331144888898348999989733568889889999999708767997532
Q gi|254780464|r    5 ISKTSSGITVITEVMP---IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSL   81 (424)
Q Consensus         5 ~~~L~NGl~v~~~~~~---~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t~~   81 (424)
                      .....+|.++...+..   .|.+.+.+.+..+.....+...+++.++..++     +.+..++.......|..++.+.+.
T Consensus       521 ~i~~~~~~~~~~~~d~~f~~pk~~~~~~~~s~~~~~~~~~~~l~~l~~~l~-----~~~l~e~~~~~~~agl~~~i~~~~  595 (990)
T 3cww_A          521 LIKDTAMSKLWFKQDDKFFLPKANLNFEFFSPFAYVDPLHSNMAYLYLELL-----KDSLNEYAYAAELAGLSYDLQNTI  595 (990)
T ss_dssp             EEEECSSEEEEEEECSSCCCSEEEEEEEEECGGGTSSHHHHHHHHHHHHHH-----HHHHHHHHHHHHHTTEEEEEEEET
T ss_pred             EEEECCCEEEEECCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHH-----HHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             997068546886578765674046888733840003878889999998777-----888899999987357546776326


Q ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCC-CCCCCCCHHHCCCCCCCCCCCCCCCCCHH
Q ss_conf             23799961266565210012223221035662001124556766665113-32111000000122222222222222103
Q gi|254780464|r   82 EHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSE-DDSWDFLDARFSEMVWKDQIIGRPILGKP  160 (424)
Q Consensus        82 d~~~~~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~-~~p~~~~~~~~~~~~f~~~~~~~~~~g~~  160 (424)
                      +...+.+.+.+++++.+++++.+.+.+|.+++++|+..+..+..++.... +.|...+...+...+++ +++.  .....
T Consensus       596 ~g~~~~~~g~~~~l~~~l~~i~~~l~~~~~~~~~f~~~k~~~~~~~~n~~~~~p~~~~~~~~~~l~~~-~~~~--~~~~~  672 (990)
T 3cww_A          596 YGMYLSVKGYNDKQPILLKKIIEKMATFEIDEARFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTE-VAWT--KDELK  672 (990)
T ss_dssp             TEEEEEEEEESTTHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHBS-SCCC--HHHHH
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC-CCCC--HHHHH
T ss_conf             77643103421027999999999853977678899999999999987533278999999999998568-8886--68889


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC---------CCCCCEEE-EE-
Q ss_conf             44200016677642011245663000002545512211221101235877778866422---------33221023-30-
Q gi|254780464|r  161 ETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP---------AVYVGGEY-IQ-  229 (424)
Q Consensus       161 ~~i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~p---------~~~~~~~~-~~-  229 (424)
                      +.++.++.+++++|++++|.+.++.++|+||++++++.++++++++.++......+..+         ....+... .. 
T Consensus       673 ~~l~~it~~dl~~f~~~~~~~~~~~~~i~Gni~~~~a~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  752 (990)
T 3cww_A          673 EALADVTLPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQLAAYREVQLPDRGWFVYQQ  752 (990)
T ss_dssp             HHHTTCCHHHHHHHHHHHHHEEEEEEEEEESCCHHHHHHHHHHHHHHHHHHHCCEECCGGGCCCCCBBCCCTTEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEECCCCCEEEEEE
T ss_conf             98876548899999999851033478870686999999999999976411566788882001333305648986289982


Q ss_pred             -CCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCE--EEEEECCCC
Q ss_conf             -36843210230100001352113568998777624876532222000268621013332221012201--344425830
Q gi|254780464|r  230 -KRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL--YIASATAKE  306 (424)
Q Consensus       230 -~~~~~~~~i~~~~~~~~~~~~d~~al~ll~~iLg~g~sSrL~~~lRe~~glaY~v~s~~~~~~~~g~~--~i~~~~~~~  306 (424)
                       ..+...+.+.+.++++..+.++..++.+++.+|    +++||++||++.||+|+|+++.....+...+  .+....+|+
T Consensus       753 ~~~~~~~s~v~~~~~~~~~~~~~~~~~~ll~~il----~~~lf~~LRt~~qLgY~v~s~~~~~~~~~g~~~~vqS~~~p~  828 (990)
T 3cww_A          753 RNEVHNNSGIEIYYQTDMQSTSENMFLELFAQII----SEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSEKPPH  828 (990)
T ss_dssp             ECSSCSSEEEEEEEEEEECCHHHHHHHHHHHHHH----HHHHHHHHTTTTCCCSEEEEEEEEETTEEEEEEEEEESSCHH
T ss_pred             CCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHH----HHHHHHHHHHCCCCCEEEEEEEEECCCEEEEEEEEECCCCHH
T ss_conf             6987753289999558999999999999999998----799999998703763499789875388015999997899999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCC-CCCCHHHHHHHHHCCCHHHHH
Q ss_conf             2477787789999853148998999999999999998513898999999999999689-847989999988727989999
Q gi|254780464|r  307 NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG-SILCSEKIIDTISAITCEDIV  385 (424)
Q Consensus       307 ~~~~~~~~i~~~i~~l~~~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~-~~~~~~~~~~~i~~vt~~di~  385 (424)
                      .+.+.++.+.+.+....++++++||+++|+.+..++.....+....+..++.....++ ..+..+++.+.|++||.+||+
T Consensus       829 ~l~~~i~~fl~~~~~~l~~~s~eef~~~k~~li~~~~~~~~~l~~~~~~~w~~i~~~~~~fd~~~~~~~~l~~lT~~d~~  908 (990)
T 3cww_A          829 YLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWGEIISQQYNFDRDNTEVAYLKTLTKADII  908 (990)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHCCCSSHHHHHHHHHHHHHTTCCCTTHHHHHHHHHTTCCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCHHHHH
T ss_conf             99999999999999988349999999999999998754789999999999999982899987679999999768999999


Q ss_pred             HHHHHHCCCC------CEEEEEECCCC
Q ss_conf             9999862778------77999816601
Q gi|254780464|r  386 GVAKKIFSST------PTLAILGPPMD  406 (424)
Q Consensus       386 ~~~~~~l~~~------~~i~~vgp~~~  406 (424)
                      +++++||.++      .+|.++|+..+
T Consensus       909 ~~~~~~l~~~~~~r~kl~i~v~g~~~~  935 (990)
T 3cww_A          909 KFYKEMLAVDAPRRHKVSVHVLAREMD  935 (990)
T ss_dssp             HHHHHHTSTTCTTCEEEEEEEECTTC-
T ss_pred             HHHHHHCCCCCCCCEEEEEEEEECCCC
T ss_conf             999996487888730699999945876