HHsearch results for GI: 254780464 and protein with PDBid: 3gwb_A

>3gwb_A Peptidase M16 inactive domain family protein; peptidase M16 family, PFL_5859, structural genomics, PSI-2; 1.90A {Pseudomonas fluorescens pf-5}
Probab=100.00  E-value=0  Score=487.99  Aligned_cols=410  Identities=17%  Similarity=0.231  Sum_probs=372.8

Q ss_pred             CCEEEEECCCCCEEEEECCC-CCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEE
Q ss_conf             96189987987199998589-98799999983311448888983489999897335688898899999997087679975
Q gi|254780464|r    1 MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYT   79 (424)
Q Consensus         1 ~~~~~~~L~NGl~v~~~~~~-~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t   79 (424)
                      +||+.+||+||++|++.+++ .|.++++++|++|+++|+ ++.|+||++|||+|+||++++..++.+.++.+|+.+|++|
T Consensus        12 ~~v~~~~L~NG~~v~~~~~~~~p~v~~~l~~~~Gs~~e~-~~~G~a~lle~ll~~gt~~~~~~~l~~~l~~~g~~~~~~t   90 (434)
T 3gwb_A           12 LNVQTWSTAEGAKVLFVEARELPMFDLRLIFAAGSSQDG-NAPGVALLTNAMLNEGVAGKDVGAIAQGFEGLGADFGNGA   90 (434)
T ss_dssp             CCCEEEECTTCCEEEEEECCSSSEEEEEEEESCSGGGCT-TSTTHHHHHHHHGGGEETTEEHHHHHHHHHTTTCEEEEEE
T ss_pred             CCCEEEECCCCCEEEEEECCCCCEEEEEEEEEECCCCCC-CHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCEEEEEE
T ss_conf             998799989999899999799988999999801367689-7163999999998179899999999999998099777686


Q ss_pred             CCCEEEEEEEC--CCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCC
Q ss_conf             32237999612--6656521001222322103566200112455676666511332111000000122222222222222
Q gi|254780464|r   80 SLEHTSYHAWV--LKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPIL  157 (424)
Q Consensus        80 ~~d~~~~~~~~--~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f~~~~~~~~~~  157 (424)
                      +.|.++|++++  ++++++.+|+++.+++.+|.|++++|+++|+.++++++...++|...+.+.+.+.+|+++|+++++.
T Consensus        91 ~~d~~~~~~~~~~~~~~l~~~l~ll~~~~~~p~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  170 (434)
T 3gwb_A           91 YKDMAVASLRSLSAVDKREPALKLFAEVVGKPTFPADSLARIKNQMLAGFEYQKQNPGKLASLELMKRLYGTHPYAHASD  170 (434)
T ss_dssp             CSSCEEEEEEEECSHHHHHHHHHHHHHHHHSCCCCHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTSTTSSCTT
T ss_pred             CCCEEEEEEEEECCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             24557999997087899999999999997588888899988899999998755269889999999998257764578887


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC-CCCCCCEEEEECCCCCCC
Q ss_conf             1034420001667764201124566300000254551221122110123587777886642-233221023303684321
Q gi|254780464|r  158 GKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK-PAVYVGGEYIQKRDLAEE  236 (424)
Q Consensus       158 g~~~~i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~-p~~~~~~~~~~~~~~~~~  236 (424)
                      |..+.+++++.+++++||++||+|+||+++|+||+++++++++++++|+.+|..+...... |............+..++
T Consensus       171 ~~~~~l~~~~~e~l~~~~~~~~~~~n~~l~i~Gd~~~~~~~~~i~~~~~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~q~  250 (434)
T 3gwb_A          171 GDAKSIPPITLAQLKAFHAKAYAAGNVVIALVGDLSRSDAEAIAAQVSAALPKGPALAKIEQPAEPKASIGHIEFPSSQT  250 (434)
T ss_dssp             CCTTTTTTCCHHHHHHHHHHHSCGGGEEEEEEESCCHHHHHHHHHHHHHHSCCCCCCCCCCCCCCCCCEEEEEECCSSEE
T ss_pred             CCHHHHHCCCHHHHHHHHHHCCCHHHEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEECCCCCC
T ss_conf             87133312899999987642368233045655862699999999986422478887677789877664156630342000


Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHC-CCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHH
Q ss_conf             0230100001352113568998777624-876532222000268621013332221012201344425830247778778
Q gi|254780464|r  237 HMMLGFNGCAYQSRDFYLTNILASILGD-GMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSI  315 (424)
Q Consensus       237 ~i~~~~~~~~~~~~d~~al~ll~~iLg~-g~sSrL~~~lRe~~glaY~v~s~~~~~~~~g~~~i~~~~~~~~~~~~~~~i  315 (424)
                      ++.++|++++..+++.+++.++..+|++ +++|+|++.+|+++|++|++++++..+.+.|.|.+++.+.|++.+++.+.+
T Consensus       251 ~i~~~~~~~~~~~~~~~~~~vl~~~L~g~~~~s~l~~~lre~~gl~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i  330 (434)
T 3gwb_A          251 SLMLAQLGIDRDDPDYAAVSLGNQILGGGGFGTRLMSEVREKRGLTYGVYSGFTPMQARGPFMINLQTRAEMSEGTLKLV  330 (434)
T ss_dssp             EEEEEEECCBTTCTTHHHHHHHHHHHHSSSSCSHHHHHHTTTTCCCSCEEEEECCBSSCCEEEEEEEEEGGGHHHHHHHH
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             00110024457817779999999864489755188999998628600464125554466118999604530099999999


Q ss_pred             HHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHHCCC
Q ss_conf             99998531-48998999999999999998513898999999999999689847989999988727989999999986277
Q gi|254780464|r  316 VEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS  394 (424)
Q Consensus       316 ~~~i~~l~-~~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~~~~i~~vt~~di~~~~~~~l~~  394 (424)
                      .+++..+. .+++++||+++|+.++.++....+++..++..+....+++.+..+.+++.+.|++||++||++++++||++
T Consensus       331 ~~~l~~l~~~~i~~~el~~aK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~vt~~dv~~~a~~~l~~  410 (434)
T 3gwb_A          331 QDVFAEYLKNGPTQKELDDAKRELAGSFPLSTASNADIVGQLGAMGFYNLPLSYLEDFMRQSQELTVEQVKAAMNKHLNV  410 (434)
T ss_dssp             HHHHHHHHHHCCCHHHHHHHHHHHHHC---CCCCHHHHHHHHHHHHHTTCCTTHHHHHHHHHHHCCHHHHHHHHHHHCCG
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCC
T ss_conf             99999997479999999999999999998816999999999999998388920799999999769999999999985897


Q ss_pred             -CCEEEEEECCCCCCCCH
Q ss_conf             -87799981660108998
Q gi|254780464|r  395 -TPTLAILGPPMDHVPTT  411 (424)
Q Consensus       395 -~~~i~~vgp~~~~~P~~  411 (424)
                       +..++++||.....|-.
T Consensus       411 ~~~~~vv~gp~~~~~pl~  428 (434)
T 3gwb_A          411 DKMVIVSAGPTVAQKPLE  428 (434)
T ss_dssp             GGCEEEEEECCCCCCC--
T ss_pred             CCEEEEEECCHHHCCCCC
T ss_conf             885999987613208852