Query         gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 424
No_of_seqs    186 out of 5740
Neff          9.6 
Searched_HMMs 23785
Date          Mon May 30 11:40:13 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780464.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1hr6_A Alpha-MPP, mitochondria 100.0       0       0  567.6  34.6  415    2-418     5-450 (475)
  2 1pp9_A Ubiquinol-cytochrome C  100.0       0       0  561.4  32.7  417    2-419    13-442 (446)
  3 1pp9_B Ubiquinol-cytochrome C  100.0       0       0  542.0  32.3  409    1-414    22-439 (439)
  4 1hr6_B Beta-MPP, mitochondrial 100.0       0       0  536.0  35.5  418    2-420     6-443 (443)
  5 3hdi_A Processing protease; CA 100.0       0       0  535.6  33.2  406    3-410     2-409 (421)
  6 3cx5_A Cytochrome B-C1 complex 100.0       0       0  530.2  29.0  410    4-422     2-430 (431)
  7 3eoq_A Putative zinc protease; 100.0       0       0  490.5  32.4  401    3-405     2-405 (406)
  8 3gwb_A Peptidase M16 inactive  100.0       0       0  488.0  29.5  410    1-411    12-428 (434)
  9 3d3y_A Uncharacterized protein 100.0       0       0  444.7  28.9  398    2-405     2-423 (425)
 10 3go9_A Insulinase family prote 100.0       0       0  433.0  28.4  416    2-422    25-465 (492)
 11 3cww_A Insulysin, insulin-degr 100.0       0       0  428.9  25.8  402    2-405    34-456 (990)
 12 1q2l_A Protease III; hydrolase 100.0       0       0  427.4  25.3  403    2-405    20-440 (939)
 13 3cx5_B Cytochrome B-C1 complex 100.0       0       0  408.7  13.5  350   12-414     1-352 (352)
 14 2fge_A Atprep2;, zinc metallop 100.0       0       0  364.9  20.0  393    8-404    43-483 (995)
 15 2fge_A Atprep2;, zinc metallop 100.0 2.8E-39 1.2E-43  280.9  25.5  391    4-404   554-975 (995)
 16 3cww_A Insulysin, insulin-degr 100.0 2.4E-34   1E-38  247.8  20.1  390    5-406   521-935 (990)
 17 1q2l_A Protease III; hydrolase 100.0 8.1E-32 3.4E-36  230.9  24.9  382    3-396   500-894 (939)
 18 3ih6_A Putative zinc protease; 100.0 1.7E-27 6.9E-32  202.0  15.5  185  218-404     7-194 (197)
 19 1pp9_A Ubiquinol-cytochrome C   98.5 4.3E-06 1.8E-10   58.4  13.2  165  229-402    28-201 (446)
 20 1hr6_B Beta-MPP, mitochondrial  98.4 6.3E-06 2.7E-10   57.3  12.7  173  222-403    13-196 (443)
 21 1hr6_A Alpha-MPP, mitochondria  98.4 7.4E-06 3.1E-10   56.8  11.9  128   64-193   290-438 (475)
 22 3hdi_A Processing protease; CA  98.3 9.9E-05 4.1E-09   49.3  16.4  163  232-402    20-190 (421)
 23 3gwb_A Peptidase M16 inactive   98.3 2.4E-05   1E-09   53.3  12.5  173  223-402    21-203 (434)
 24 3cx5_A Cytochrome B-C1 complex  98.3   4E-05 1.7E-09   51.9  13.4  105  298-402    77-186 (431)
 25 3cx5_B Cytochrome B-C1 complex  98.2 1.6E-05 6.8E-10   54.6  11.1  163  230-402     7-175 (352)
 26 1pp9_B Ubiquinol-cytochrome C   98.2 3.2E-05 1.4E-09   52.5  11.9  164  230-402    39-209 (439)
 27 3d3y_A Uncharacterized protein  98.2   7E-05   3E-09   50.2  13.1  179  234-420    23-220 (425)
 28 3ih6_A Putative zinc protease;  98.1 6.3E-07 2.7E-11   64.0   0.7  171   11-190    12-192 (197)
 29 3eoq_A Putative zinc protease;  98.0 1.7E-05 7.2E-10   54.4   7.8  101  298-402    85-189 (406)
 30 3go9_A Insulinase family prote  97.3 3.4E-05 1.4E-09   52.4   0.3   35  252-286   289-323 (492)
 31 3h14_A Aminotransferase, class  40.7      12  0.0005   15.2   2.1   16  169-184    75-94  (391)
 32 1c7n_A Cystalysin; transferase  38.8      15 0.00062   14.6   3.2   17  168-184    72-92  (399)
 33 1d2f_A MALY protein; aminotran  35.9      16 0.00069   14.3   2.9   22  168-190    70-95  (390)
 34 3dzz_A Putative pyridoxal 5'-p  35.4      15 0.00062   14.6   1.9   22  168-190    68-93  (391)
 35 1qap_A Quinolinic acid phospho  31.3      14 0.00061   14.6   1.3   13  378-390   260-272 (296)
 36 3gee_A MNME, tRNA modification  30.6      20 0.00083   13.7  11.3   19  304-322   381-399 (476)
 37 3ihj_A Alanine aminotransferas  29.5      21 0.00087   13.6   1.9   18  106-123    97-114 (498)
 38 3paj_A Nicotinate-nucleotide p  27.0      14  0.0006   14.6   0.6   13  378-390   283-295 (320)
 39 1kl7_A Threonine synthase; thr  25.7      24   0.001   13.1   4.1   29  180-210   201-230 (514)
 40 1x1o_A Nicotinate-nucleotide p  23.9      18 0.00076   14.0   0.7   13  378-390   248-260 (286)
 41 3l0g_A Nicotinate-nucleotide p  23.2      21 0.00088   13.5   0.9   16  255-270   160-175 (300)
 42 1zav_U 50S ribosomal protein L  21.9      28  0.0012   12.7   3.3   24  368-391     2-25  (30)
 43 3gnn_A Nicotinate-nucleotide p  21.1      23 0.00095   13.3   0.7   15  255-269   162-176 (298)
 44 1o4u_A Type II quinolic acid p  20.4      20 0.00084   13.7   0.3   15  255-269   145-159 (285)

No 1  
>1hr6_A Alpha-MPP, mitochondrial processing peptidase alpha subunit; hxxeh zinc-binding motif, hydrolase; HET: EPE; 2.50A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1hr7_A 1hr8_A* 1hr9_A*
Probab=100.00  E-value=0  Score=567.56  Aligned_cols=415  Identities=21%  Similarity=0.328  Sum_probs=382.3

Q ss_pred             CEEEEECCCCCEEEEECCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEECC
Q ss_conf             61899879871999985899879999998331144888898348999989733568889889999999708767997532
Q gi|254780464|r    2 NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSL   81 (424)
Q Consensus         2 ~~~~~~L~NGl~v~~~~~~~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t~~   81 (424)
                      +++++||+||+||++++.+.|.+++++++++||++|++++.|+||++|||+|+||++++..++.+.++.+|+.+||+|++
T Consensus         5 ~~~~~~L~NGl~V~~~~~~~~~~~~~l~v~~Gs~~E~~~~~G~ahlleh~~f~GT~~~~~~~l~~~l~~~G~~~na~t~~   84 (475)
T 1hr6_A            5 NFKLSSLANGLKVATSNTPGHFSALGLYIDAGSRFEGRNLKGCTHILDRLAFKSTEHVEGRAMAETLELLGGNYQCTSSR   84 (475)
T ss_dssp             CCEEEECTTSCEEEEESCCCSSEEEEEEESCCGGGCTTTTTTHHHHHHHTTTSCBTTBCHHHHHHHHHHTTSCEEEEECS
T ss_pred             CEEEEECCCCCEEEEEECCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCEEEEEECC
T ss_conf             73799989999899997899989999997400278897986399999999738999999999999999829989999863


Q ss_pred             CEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCHHH
Q ss_conf             23799961266565210012223221035662001124556766665113321110000001222222222222221034
Q gi|254780464|r   82 EHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPE  161 (424)
Q Consensus        82 d~~~~~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f~~~~~~~~~~g~~~  161 (424)
                      |+|+|++++++++++.+|+++++++.+|.|++++|+++|+++++|+++..++|...+.+.+.+.+|+++||+++++|+.+
T Consensus        85 d~t~y~~~~~~~~l~~~l~ll~d~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~g~~~  164 (475)
T 1hr6_A           85 ENLMYQASVFNQDVGKMLQLMSETVRFPKITEQELQEQKLSAEYEIDEVWMKPELVLPELLHTAAYSGETLGSPLICPRG  164 (475)
T ss_dssp             SCEEEEEEECGGGHHHHHHHHHHHHHCBCCCHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTTSGGGSCSSCCGG
T ss_pred             CEEEEEEEECHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             72999999778999999999999975888788999999999999988774184878999988887337876788878988


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEE------ECCCCCC
Q ss_conf             4200016677642011245663000002545512211221101235877778866422332210233------0368432
Q gi|254780464|r  162 TISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI------QKRDLAE  235 (424)
Q Consensus       162 ~i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~p~~~~~~~~~------~~~~~~~  235 (424)
                      +|++++.++|++||++||+|+|++|+| |++++++++++++++||+|+....+....+..+.+++..      ...+..+
T Consensus       165 ~i~~it~~~l~~~~~~~y~p~n~~lvi-~~~~~~~~~~li~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  243 (475)
T 1hr6_A          165 LIPSISKYYLLDYRNKFYTPENTVAAF-VGVPHEKALELTGKYLGDWQSTHPPITKKVAQYTGGESCIPPAPVFGNLPEL  243 (475)
T ss_dssp             GGGGCCHHHHHHHHHHHCCGGGEEEEE-ESSCHHHHHHHHHHHHTTCCCCCCCCCCCCCCCCCEEEEECCCCCCSSSCCC
T ss_pred             HHCCCCHHHHHHHHHHHCCCCCCCEEC-CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             707899999999987403875320004-6677999999999983447667888776654346875444320024676030


Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHCC-----------CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             102301000013521135689987776248-----------765322220002686210133322210122013444258
Q gi|254780464|r  236 EHMMLGFNGCAYQSRDFYLTNILASILGDG-----------MSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA  304 (424)
Q Consensus       236 ~~i~~~~~~~~~~~~d~~al~ll~~iLg~g-----------~sSrL~~~lRe~~glaY~v~s~~~~~~~~g~~~i~~~~~  304 (424)
                      +++.++|+++++.++|++++.+++.+||++           ++|||++++|+++|++|++++++..+.+.|+|++++.|.
T Consensus       244 ~~v~~~~~~~~~~~~d~~~l~vl~~iLgg~~s~~~~~~~~g~~srL~~~lre~~gl~ys~~s~~~~~~~~g~f~i~~~~~  323 (475)
T 1hr6_A          244 FHIQIGFEGLPIDHPDIYALATLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYFVENCVAFNHSYSDSGIFGISLSCI  323 (475)
T ss_dssp             EEEEEEEECCCTTCTTHHHHHHHHHHHCEEESSCCSSTTSCTTSHHHHHTTTTCSSEEEEEEEEEECSSCEEEEEEEEEC
T ss_pred             EEEEEEECCCCCCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEC
T ss_conf             35676304565344008999999998668720212013331125999976651474125776303446776346567656


Q ss_pred             CCHHHHHHHHHHHHHHHHC----CCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCC
Q ss_conf             3024777877899998531----489989999999999999985138989999999999996898479899999887279
Q gi|254780464|r  305 KENIMALTSSIVEVVQSLL----ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAIT  380 (424)
Q Consensus       305 ~~~~~~~~~~i~~~i~~l~----~~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~~~~i~~vt  380 (424)
                      |++..++++.+.+++.++.    .+++++||++||+.++.++..+.|++..++..++++++.++++.+++++.+.|++||
T Consensus       324 ~~~~~~~v~~i~~el~~~~~~~~~~it~~eL~raK~~l~~~~~~~~e~~~~~~~~i~~~~l~~~~~~~~~~~~~~i~~VT  403 (475)
T 1hr6_A          324 PQAAPQAVEVIAQQMYNTFANKDLRLTEDEVSRAKNQLKSSLLMNLESKLVELEDMGRQVLMHGRKIPVNEMISKIEDLK  403 (475)
T ss_dssp             GGGHHHHHHHHHHHHHTTTTCTTSCCCHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHSCCCCHHHHHHHHHTCC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCC
T ss_conf             77589999999999999998477899899999999999999998658999999999999996799899999999997879


Q ss_pred             HHHHHHHHHHHCCC----------CCEEEEEECCCCCCCCHHHHHHHH
Q ss_conf             89999999986277----------877999816601089989999988
Q gi|254780464|r  381 CEDIVGVAKKIFSS----------TPTLAILGPPMDHVPTTSELIHAL  418 (424)
Q Consensus       381 ~~di~~~~~~~l~~----------~~~i~~vgp~~~~~P~~~~l~~~l  418 (424)
                      ++||++++++||.+          +++++++| +...+|+.+++....
T Consensus       404 ~~dv~~~a~~~~~~~~~~~~~g~~~~t~~~~g-~~~~~~~~~~~~~~~  450 (475)
T 1hr6_A          404 PDDISRVAEMIFTGNVNNAGNGKGRATVVMQG-DRGSFGDVENVLKAY  450 (475)
T ss_dssp             HHHHHHHHHHHHTTCCCCTTCCCCCCEEEEES-CGGGGCCHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCEEEEEC-CCCCCCCHHHHHHHH
T ss_conf             99999999997278973888438874399955-512240499999983


No 2  
>1pp9_A