BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780464|ref|YP_003064877.1| M16 family peptidase
[Candidatus Liberibacter asiaticus str. psy62]
         (424 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040141|gb|ACT56937.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 424

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT
Sbjct: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER
Sbjct: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT
Sbjct: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML
Sbjct: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA
Sbjct: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV
Sbjct: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG 420
           MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG
Sbjct: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG 420

Query: 421 FRSM 424
           FRSM
Sbjct: 421 FRSM 424


>gi|315122087|ref|YP_004062576.1| M16 family peptidase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495489|gb|ADR52088.1| M16 family peptidase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 424

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/420 (75%), Positives = 371/420 (88%), Gaps = 1/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MNLRISKTSSGITVITEVMP + SAFV VNIR+GSR+ER+EEHGMAHFLEHMLFKGT++R
Sbjct: 1   MNLRISKTSSGITVITEVMPHLKSAFVGVNIRSGSRDEREEEHGMAHFLEHMLFKGTSRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+K+IVEEIEKVGGDINAYTS+EHTSYHA VLK+ VPLAL+IIGDMLSNSSFNPSDIERE
Sbjct: 61  TSKDIVEEIEKVGGDINAYTSVEHTSYHARVLKDDVPLALDIIGDMLSNSSFNPSDIERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+VVLEEIGMSED+ W FL   F E+VWK+QIIGRPILGKP+T++SF  EKIIS++SRNY
Sbjct: 121 RSVVLEEIGMSEDNPWSFLYDHFLEIVWKNQIIGRPILGKPDTVASFGSEKIISYISRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           TA+R+YVVCVG+VDH+ C+ QVE+YFNV      +E++KPAVYVGGEYIQKRDLAEEH+ 
Sbjct: 181 TANRIYVVCVGSVDHDACLRQVENYFNVYPAVTKEENIKPAVYVGGEYIQKRDLAEEHIA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF GCAYQSRDFY T IL SILG GMSSRLFQEVREKRGLCYSISAHH NFSDNGV  I
Sbjct: 241 LGFKGCAYQSRDFYPTKILTSILGGGMSSRLFQEVREKRGLCYSISAHHNNFSDNGVFCI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++ATAKEN++ L S+IVEV+ SLL+ IEQ EI K CAKI A+LI +QE S  RA EISKQ
Sbjct: 301 SAATAKENLVELISAIVEVIHSLLKGIEQSEISKVCAKIRAQLIINQEDSDFRASEISKQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           VMFCG +LC+E+IIDTISAITC DI+ +A++IFSS PT+AILGPP++ +P++SEL+H L+
Sbjct: 361 VMFCGHVLCNEEIIDTISAITCTDIIEIAERIFSSVPTIAILGPPINDIPSSSELMHNLK 420


>gi|227821121|ref|YP_002825091.1| peptidase, family M16 protein [Sinorhizobium fredii NGR234]
 gi|227340120|gb|ACP24338.1| peptidase, family M16 protein [Sinorhizobium fredii NGR234]
          Length = 432

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 294/431 (68%), Gaps = 11/431 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE  +EHG+AH LEHM FKGT +R
Sbjct: 2   MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVDEHGIAHLLEHMAFKGTRRR 61

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F+  ++ RE
Sbjct: 62  SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAIDILADILTESTFDEEELRRE 121

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG ++D   D +  RF+E  ++DQ +GRPILG PET+ SFTP +I  ++ RNY
Sbjct: 122 KHVILQEIGAADDTPDDVVFDRFAETAYRDQTVGRPILGTPETVMSFTPGQIRQYLGRNY 181

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-MKPAVYVGGEYIQKRDLAEEHM 238
           T DRM++V  GAVDH+  V QV+  F+   VA +    +  A Y GG+  + RDL +  +
Sbjct: 182 TTDRMFIVAAGAVDHDSIVRQVQERFSSLPVAPLSPPVLDTARYTGGDSRESRDLMDAQV 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 242 LLGFEGRAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ ++    +I+Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 302 IHAATGGENLPELMPVIIDELRKSSTSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHVPT-- 410
           Q+M  G  + +E++++ +S IT E +  +A ++F  T PTL+ +GP     PM  + +  
Sbjct: 362 QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTAPTLSAIGPLDQLAPMSDILSSL 421

Query: 411 -TSELIHALEG 420
            T   +HAL G
Sbjct: 422 NTKSAVHALAG 432


>gi|255601042|ref|XP_002537592.1| metalloprotease, putative [Ricinus communis]
 gi|223515808|gb|EEF24791.1| metalloprotease, putative [Ricinus communis]
          Length = 432

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/416 (46%), Positives = 287/416 (68%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+T+ MP ++SA + V I++GSRNE ++EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTQTMPHLESAALGVWIKSGSRNETEDEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SARDIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAIDILADILTESAFEEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  +FSE  ++DQ +GRPILG PET+ SF+P++I +++SRNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDKFSETAYRDQTLGRPILGTPETVVSFSPQQIRTYLSRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV H+  V  VE  F ++ +       M+PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVAAGAVKHDEFVKMVEQRFASLPTSPSAPPVMEPARYIGGNVRETRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYSI A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREIRGLCYSIYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +     +IEQ+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSASSIEQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + ++++++ +  IT E +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNQEMMERLEGITVERLTDLAGRLFFDTVPTLSAIGPLEQLAPMEDI 416


>gi|325292170|ref|YP_004278034.1| M16 family peptidase [Agrobacterium sp. H13-3]
 gi|325060023|gb|ADY63714.1| M16 family peptidase [Agrobacterium sp. H13-3]
          Length = 432

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 290/421 (68%), Gaps = 4/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ SSG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MRVNVTRLSSGLTVVTERMPHLESVALGVWIKSGSRNETTAEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESLFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+L+EIG + D   D +   FS + ++DQ IGRPILG PET+ SFT  +I  +++RNY
Sbjct: 121 KNVILQEIGAATDTPDDVIFDNFSGVAYRDQTIGRPILGTPETVQSFTSAQIRHYLARNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DR++VV  GAVDH+  V QVE  F ++  +      ++ A+Y GGE  + RDL +  +
Sbjct: 181 TTDRIFVVAAGAVDHQSFVKQVEERFASLPQLPVTTPVLEKAIYTGGEIRETRDLMDAQV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVRESRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT   ++  L   IV+ ++   + I Q EID+  A+I A+L+  QE    RA ++++
Sbjct: 301 VHAATGGNDLPELMPVIVDELRKSSQTIHQEEIDRARAQIRAQLLMGQESPAARAGQMAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E++++ ++ IT E +  +A ++F  T PTL+ +G P++ +P  S++  A
Sbjct: 361 QMMLYGRPIPNEEMMERLNDITRERLTDLAGRLFFDTVPTLSAIG-PLEQLPPLSDITAA 419

Query: 418 L 418
           L
Sbjct: 420 L 420


>gi|159184464|ref|NP_353810.2| M16 family peptidase [Agrobacterium tumefaciens str. C58]
 gi|159139776|gb|AAK86595.2| peptidase, family M16 [Agrobacterium tumefaciens str. C58]
          Length = 432

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 288/421 (68%), Gaps = 4/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ SSG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MRVNVTRLSSGLTVVTERMPHLESVALGVWIKSGSRNETTAEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESLFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+L+EIG + D   D +   FS + ++DQ IGRPILG P+T+ SFT  +I  +++RNY
Sbjct: 121 KNVILQEIGAATDTPDDVIFDNFSGVAYRDQTIGRPILGTPDTVQSFTSGEIRHYLARNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DR++VV  GAVDHE  V QVE  F ++  V      M+ A+Y GGE  + RDL +  +
Sbjct: 181 TTDRIFVVAAGAVDHESFVKQVEERFASLPLVPAAPPVMEKAIYTGGEIRETRDLMDAQV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREARGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT   ++  L   IV+ ++   E I Q EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 VHAATGGNDLPELIPVIVDELRKSSETIHQDEINRARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E+++  +  IT E +  +A ++F  T PTL+ +G P++ +P  S++  A
Sbjct: 361 QMMLYGRPIPNEEMMTRLEDITRERLTDLAGRLFFDTVPTLSAIG-PLEQLPPLSDITAA 419

Query: 418 L 418
           L
Sbjct: 420 L 420


>gi|222147814|ref|YP_002548771.1| peptidase family M16 [Agrobacterium vitis S4]
 gi|221734802|gb|ACM35765.1| peptidase family M16 [Agrobacterium vitis S4]
          Length = 434

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 291/426 (68%), Gaps = 5/426 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MN+  ++  SG+TV+TE MP ++S  + V +++GSR+E  EEHG+AH LEHM FKGT +R
Sbjct: 1   MNVECTRLPSGLTVVTEKMPHLESVALGVWVKSGSRDETAEEHGIAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+ VPLA++I+ D+L++S+F+  ++ RE
Sbjct: 61  SARQIAEEIENVGGELNAATSTETTSYYARVLKDDVPLAVDILADILTDSAFDDEELIRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++DQ +GR ILG P+T+  FT ++I ++++RNY
Sbjct: 121 KHVILQEIGAAFDTPDDVVFDRFAETAFRDQTVGRGILGTPQTVDGFTSDQIRAYLARNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSV-AKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDHE  V QVE  F+       +   + PA Y GGE  + RDL +  +
Sbjct: 181 TTDRMFVVAAGAVDHESFVRQVEDRFSTLRTKPAVSPIITPARYTGGEVRESRDLMDTQL 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGRAYHARDFYASQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ ++   E IEQ+EID+   +I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELRKSAEQIEQQEIDRSRTQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF--SSTPTLAILGPPMDHVPTTSELIH 416
           Q+M  G  + + ++++ + +IT + +  +A ++F   S PTL+ +G P++ +    +++ 
Sbjct: 361 QMMLYGRPISNPELMERLESITVDRLTDLAGRLFFDGSPPTLSAIG-PLEQLAPMEDILS 419

Query: 417 ALEGFR 422
           AL G R
Sbjct: 420 ALSGSR 425


>gi|150395759|ref|YP_001326226.1| processing peptidase [Sinorhizobium medicae WSM419]
 gi|150027274|gb|ABR59391.1| processing peptidase [Sinorhizobium medicae WSM419]
          Length = 434

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 285/416 (68%), Gaps = 4/416 (0%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R+A++I
Sbjct: 7   TRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTKRRSARQI 66

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            EEIE VGG++NA TS E TSY+A VLK+HVPLA+ I+ D+L+ S F   ++ RE+ V+L
Sbjct: 67  AEEIENVGGEVNAATSTETTSYYARVLKDHVPLAINILADILTESHFEADELRREKQVIL 126

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           +EIG ++D   D +  RF+E  ++ Q IGRPILG PET+ SF+ ++I  ++ RNYT DR 
Sbjct: 127 QEIGAADDTPDDVVFDRFAETAYRGQTIGRPILGTPETVMSFSADQIRQYLGRNYTTDRT 186

Query: 185 YVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           ++V  GAVDH+  + QVE  F ++ +       ++ A Y GG+  + RDL +  ++LGF 
Sbjct: 187 FIVAAGAVDHDTILRQVEERFASLPAEPASAPVIETARYTGGDSRESRDLMDAQVLLGFE 246

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  + +AT
Sbjct: 247 GRAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFGVHAAT 306

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
             EN+  L   IVE ++    +IEQ+EI++  A+I A+L+  QE    RA +I++Q+M  
Sbjct: 307 GGENLPELMPVIVEELRKSSLSIEQQEIERARAQIRAQLLMGQESPAARAGQIARQMMLY 366

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHAL 418
           G  + +E++++ +S IT E +  +A ++F  T PTL+ +G P++H+   ++++ +L
Sbjct: 367 GRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIG-PLEHLAPLNDILSSL 421


>gi|307304251|ref|ZP_07584003.1| processing peptidase [Sinorhizobium meliloti BL225C]
 gi|307320556|ref|ZP_07599971.1| processing peptidase [Sinorhizobium meliloti AK83]
 gi|306893832|gb|EFN24603.1| processing peptidase [Sinorhizobium meliloti AK83]
 gi|306902719|gb|EFN33312.1| processing peptidase [Sinorhizobium meliloti BL225C]
          Length = 433

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/429 (44%), Positives = 287/429 (66%), Gaps = 12/429 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 2   MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTRRR 61

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+H+PLA++I+ D+L+ S+F   ++ RE
Sbjct: 62  SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHLPLAVDILADILTESTFEADELRRE 121

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG ++D   D +  RF+E  ++ Q +GRPILG PET+ SF+ ++I  ++ RNY
Sbjct: 122 KQVILQEIGAADDTPDDVVFDRFAETAYRGQTVGRPILGTPETVMSFSADQIRQYLGRNY 181

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHM 238
           T DR ++V  GAVDH+  V QVE  F       +    ++ A Y GG+  + RDL +  +
Sbjct: 182 TTDRTFIVAAGAVDHDTIVRQVEERFASLPAEPVCAPVIETARYTGGDSRESRDLMDAQV 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 242 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT  EN+  L   IV+ ++    +I+Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 302 VHAATGGENLPELMPVIVDELRKSSLSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV---- 408
           Q+M  G  + +E++++ +S IT E +  +A ++F  T PTL+ +GP     P++ +    
Sbjct: 362 QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIGPLGQLAPLNDILSSL 421

Query: 409 PTTSELIHA 417
            T ++ IHA
Sbjct: 422 TTKADAIHA 430


>gi|195970190|ref|NP_385026.2| putative processing protease protein [Sinorhizobium meliloti 1021]
 gi|187904155|emb|CAC45492.2| Probable processing protease [Sinorhizobium meliloti 1021]
          Length = 432

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/429 (44%), Positives = 287/429 (66%), Gaps = 12/429 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTRRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+H+PLA++I+ D+L+ S+F   ++ RE
Sbjct: 61  SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHLPLAVDILADILTESTFEADELRRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG ++D   D +  RF+E  ++ Q +GRPILG PET+ SF+ ++I  ++ RNY
Sbjct: 121 KQVILQEIGAADDTPDDVVFDRFAETAYRGQTVGRPILGTPETVMSFSADQIRQYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHM 238
           T DR ++V  GAVDH+  V QVE  F       +    ++ A Y GG+  + RDL +  +
Sbjct: 181 TTDRTFIVAAGAVDHDTIVRQVEERFASLPAEPVCAPVIETARYTGGDSRESRDLMDAQV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT  EN+  L   IV+ ++    +I+Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 VHAATGGENLPELMPVIVDELRKSSLSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV---- 408
           Q+M  G  + +E++++ +S IT E +  +A ++F  T PTL+ +GP     P++ +    
Sbjct: 361 QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIGPLGQLAPLNDILSSL 420

Query: 409 PTTSELIHA 417
            T ++ IHA
Sbjct: 421 TTKADAIHA 429


>gi|190890694|ref|YP_001977236.1| processing peptidase [Rhizobium etli CIAT 652]
 gi|218516806|ref|ZP_03513646.1| probable processing peptidase protein [Rhizobium etli 8C-3]
 gi|190695973|gb|ACE90058.1| probable processing peptidase protein [Rhizobium etli CIAT 652]
          Length = 432

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 281/416 (67%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE ++EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETEDEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SAREIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE  ++DQ +GRPILG P+T+ SFTP++I +++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRPILGTPQTVVSFTPQQIRTYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDHE  +  VE  F ++ +       M+ A Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVDHEEFLRMVEDRFASLPTSPSAPPVMEAARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +      I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSANEIHQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDI 416


>gi|327192552|gb|EGE59503.1| putative processing peptidase protein [Rhizobium etli CNPAF512]
          Length = 432

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 280/416 (67%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE ++EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETEDEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SAREIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE  ++DQ +GRPILG P+T+ SFTP++I +++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRPILGTPQTVVSFTPQQIRTYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDHE  +  VE  F  + +       M+ A Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVDHEEFLRMVEDRFAGLPTSPSAPPVMEAARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +      I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSANEIHQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDI 416


>gi|241203438|ref|YP_002974534.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857328|gb|ACS54995.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 432

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 280/416 (67%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK++VPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  TARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE+ ++DQ +GR ILG PET+ SFTP++I  ++SRNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEVAYRDQTLGRAILGTPETVVSFTPQQIRGYLSRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV+HE  +  VE  F N+ +       M+PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVEHEEFLRMVEDRFANLPTAPSAPPVMEPARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +    + I Q+EI++  A+I A+L+   E    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSADAIHQKEIERARAQIRAQLLMGAESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITVERLTDLAGRLFYDTVPTLSAIGPLDQLAPMEDI 416


>gi|222085146|ref|YP_002543676.1| processing protease protein [Agrobacterium radiobacter K84]
 gi|221722594|gb|ACM25750.1| processing protease protein [Agrobacterium radiobacter K84]
          Length = 432

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/419 (44%), Positives = 282/419 (67%), Gaps = 8/419 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++ +SG+TV T+ MP ++S  + V I++GSRNE + EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLASGLTVATQTMPHLESVALGVWIKSGSRNETEAEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VL++ VPLA++I+ D+L+ S+F+  ++ RE
Sbjct: 61  SARQIAEEIENVGGEVNAATSTETTSYYARVLRDDVPLAVDILADILTESAFDEEELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  +FSE+ ++ Q +GR ILG PET+ SF+P +I  ++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDKFSEVAYRGQTLGRAILGTPETVVSFSPAQIRGYLDRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDH+  V QVE  F ++ +       ++PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVAAGAVDHDSFVRQVEERFSSLPTKPSAPPIIEPARYIGGNIRETRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA++LG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGRAYHTRDFYCSQILANVLGGGMSSRLFQEVRELRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   IV+ +      IEQ+EI++  A+I A+L+  QE    RA ++++
Sbjct: 301 IHAATGGENLPELVPVIVDELHKASHKIEQQEIERARAQIRAQLLMGQESPAARAGQVAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHVPTT 411
           Q+M  G  + ++++ + +  IT E +  +A ++F  T PTL+ +GP     PM+ + T+
Sbjct: 361 QMMLYGRPIPNQEMQERLQGITIERLTDLAGRLFFDTVPTLSAIGPLEQLAPMEDIVTS 419


>gi|13476244|ref|NP_107814.1| processing proteinase [Mesorhizobium loti MAFF303099]
 gi|14027005|dbj|BAB53959.1| processing proteinase [Mesorhizobium loti MAFF303099]
          Length = 430

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/404 (45%), Positives = 268/404 (66%), Gaps = 1/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +P I+S  +   +++G+RNER EEHGMAH LEHM FKGT +R
Sbjct: 1   MGVEVSRLSNGLTVATETLPSIESVALGAWVKSGARNERDEEHGMAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA EI  EIE VGG+INA TS+E TSY+A VL + VPLA++I+ D+L  S F+P ++ERE
Sbjct: 61  TAFEIASEIEDVGGEINAATSVETTSYYARVLSDDVPLAVDILADILQESEFDPQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG P+T+ SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDIVFDRFTETAFRHQTIGRSILGTPDTVKSFTSKQLHDFIERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A+RM +V  G + H+  V +VE               + A YVGG++ + RDL +  ++
Sbjct: 181 GAERMVIVAAGDIKHDNFVREVEKQLGGFRSKADSTIPQYAQYVGGDFREDRDLMDAQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  +
Sbjct: 241 LGFEGRAYHVRDFYASQVLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGIFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + +I  L   I++ +Q   ENI Q E+D+  A+  A LI S E    RA +I++Q
Sbjct: 301 HAATGQSDIAELVPVIIDELQKAGENILQEELDRARAQYRAGLIMSAESPASRASQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++  G  +  E++++ +SA+T E +  ++ ++FS+ PTL  +GP
Sbjct: 361 LLLFGRPIAKEELMERLSALTVERLTDLSSRMFSTKPTLTAVGP 404


>gi|116250834|ref|YP_766672.1| peptidase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255482|emb|CAK06558.1| putative peptidase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 432

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 278/416 (66%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK++VPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  TARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE  ++DQ +GR ILG PET+ SFTP++I  ++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRAILGTPETVVSFTPQQIRGYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV+HE  +  VE  F ++ +       M+PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVEHEEFLRMVEDRFASLPTAPSAPPVMEPARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +    + I Q+EI++  A+I A+L+   E    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSADAIHQKEIERARAQIRAQLLMGAESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDI 416


>gi|209548240|ref|YP_002280157.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533996|gb|ACI53931.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 432

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/416 (45%), Positives = 280/416 (67%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE  +EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETADEHGIAHLLEHMAFKGTGRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SARQIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE+ ++DQ +GR ILG PET+ SFTP++I  ++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEVAYRDQTLGRAILGTPETVVSFTPQQIRGYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV+H+  V  VE  F ++ S       M+ A Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVEHDEFVRMVEDRFASLPSEPSAPPVMEAARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +    + I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPQLVPVIIDELHKSADQIHQKEIERARAQIRAQLLMGQESPASRAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNMEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDI 416


>gi|86356624|ref|YP_468516.1| processing protease protein [Rhizobium etli CFN 42]
 gi|86280726|gb|ABC89789.1| probable processing protease protein [Rhizobium etli CFN 42]
          Length = 431

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/416 (45%), Positives = 279/416 (67%), Gaps = 8/416 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE  +EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETADEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SAREIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  +FSE  ++DQ +GR ILG P+T+ SFTP++I +++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDKFSEAAYRDQTLGRAILGTPQTVVSFTPQQIRTYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDH+  +  VE  F ++ +       M+ A YVGG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVDHQEFLRMVEQRFASLPTQPSAPPVMEAARYVGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +      I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSANEIHQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP-----PMDHV 408
           Q+M  G  + + ++++ +  IT + +  +A ++F  T PTL+ +GP     PM+ +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIQRLTDLAGRLFFDTVPTLSAIGPLEQLAPMEDI 416


>gi|260460283|ref|ZP_05808535.1| peptidase M16 domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259033928|gb|EEW35187.1| peptidase M16 domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 430

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/404 (44%), Positives = 268/404 (66%), Gaps = 1/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +P I+S  +   +++G+RNER +EHGMAH LEHM FKGT +R
Sbjct: 1   MGVEVSRLSNGLTVATETLPSIESVALGAWVKSGARNERDDEHGMAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A EI  EIE VGG+INA TS+E TSY+A VL + VPLA++I+ D+L  S F+P ++ERE
Sbjct: 61  SAFEIASEIEDVGGEINAATSVETTSYYARVLSDDVPLAVDILSDILQESEFDPQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG PET+ SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDIVFDRFTETAFRHQTIGRSILGTPETVKSFTSKQLHDFIERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A+RM +V  G + H+  V +VE               + A YVGG++ + RDL +  ++
Sbjct: 181 GAERMVIVAAGDIKHDNFVREVEKQLGGFRSKADSTIPQYAQYVGGDFREDRDLMDAQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  +
Sbjct: 241 LGFEGRAYHVRDFYASQVLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGIFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + +I  L   I++ +Q   E+I Q E+D+  A+  A LI S E    RA +I++Q
Sbjct: 301 HAATGQSDIAELVPVIIDELQKAGESILQEELDRARAQYRAGLIMSAESPASRASQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++  G  +  E++++ +SA+T E +  ++ ++FS+ PTL  +GP
Sbjct: 361 LLLFGRPIAKEELMERLSALTIERLTDLSSRMFSTKPTLTAVGP 404


>gi|163760348|ref|ZP_02167430.1| hypothetical protein HPDFL43_03556 [Hoeflea phototrophica DFL-43]
 gi|162282299|gb|EDQ32588.1| hypothetical protein HPDFL43_03556 [Hoeflea phototrophica DFL-43]
          Length = 432

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/413 (42%), Positives = 286/413 (69%), Gaps = 4/413 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++ +  ++G+TV+TE M  ++S  + V +++GSR+E   EHG+AH LEHM FKGT KR
Sbjct: 1   MKVKTTSLANGVTVVTETMDHLESVALGVWVKSGSRDETANEHGIAHLLEHMAFKGTRKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E T+Y+A VL++HVPLA++I+ D+L++S F+ ++++RE
Sbjct: 61  SARQIAEEIENVGGELNAATSTETTAYYARVLRDHVPLAIDILHDILTDSVFDEAELQRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  +++Q IGRPILG P+T+ SFTP++I  ++SR+Y
Sbjct: 121 KHVILQEIGAANDTPDDVVYDRFTEAAFREQTIGRPILGTPDTVKSFTPDQIRRYLSRHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF--NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           T DR+ VV  GAVDH+  V  V   F  ++        ++  A Y GG+Y + RDL +  
Sbjct: 181 TGDRIVVVAAGAVDHDAFVKLVGERFGQSIQPTGTQLRAIPTASYTGGDYREDRDLMDAQ 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +++GF G AYQ RDFY + +LA+ILG GMSSRLFQEVREKRGLCYS+ A H  FSD+G+ 
Sbjct: 241 VLIGFEGRAYQVRDFYCSQLLANILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDSGIF 300

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I +AT  +++  L   I+  +    E ++++EI++  A++ + L+ SQE    RA +I+
Sbjct: 301 GIHAATGGDDLPELIPVILSELAKAAEGVDEQEINRSRAQVRSGLLMSQESPAARASQIA 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVP 409
           +Q++  G  + + ++++ +  IT E +  +A+++F +TP T++ +GP  + +P
Sbjct: 361 RQMLLFGRPVSNSELMERLENITPERLSDLAERLFFNTPVTVSAIGPVSNLMP 413


>gi|319784683|ref|YP_004144159.1| processing peptidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170571|gb|ADV14109.1| processing peptidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 430

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/404 (44%), Positives = 266/404 (65%), Gaps = 1/404 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +  I+S  +   +++G+RNER +EHGMAH LEHM FKGT +R
Sbjct: 1   MGVEVSRLSNGLTVATETLQSIESVALGAWVKSGARNERDDEHGMAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A EI  EIE VGG+INA TS+E TSY+A VL + VPLA++I+ D+L  S F+P ++ERE
Sbjct: 61  SAFEIASEIEDVGGEINAATSVETTSYYARVLSDDVPLAVDILADILQESEFDPQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG PET+ SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDIVFDRFTETAYRHQTIGRSILGTPETVKSFTSKQLHDFIERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A+RM +V  G + H+  V +VE               + A YVGG++ + RDL +  ++
Sbjct: 181 GAERMVIVAAGDIKHDNFVREVEKQLGGFRSKADSTIPQYAQYVGGDFREDRDLMDAQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD GV  +
Sbjct: 241 LGFEGRAYHVRDFYASQVLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGVFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + +I  L   I++ +Q   E I Q E+D+  A+  A LI S E    RA +I++Q
Sbjct: 301 HAATGQSDIAELVPVIIDELQKAGEKILQEELDRARAQYRAGLIMSAESPASRASQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++  G  +  E++++ +SA+T E +  ++ ++FS+ PTL  +GP
Sbjct: 361 LLLFGRPIAKEELMERLSALTIERLTDLSSRLFSTKPTLTAVGP 404


>gi|110633116|ref|YP_673324.1| peptidase M16-like [Mesorhizobium sp. BNC1]
 gi|110284100|gb|ABG62159.1| peptidase M16-like protein [Chelativorans sp. BNC1]
          Length = 430

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/409 (44%), Positives = 277/409 (67%), Gaps = 11/409 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +P ++S  + V +++GSRNER++EHG+AH LEHM FKGTTKR
Sbjct: 1   MGVEVSRLSNGLTVATETLPHLESVALGVWVKSGSRNEREDEHGIAHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+++A VL++ + LA++I+ D+L++S F+P ++ERE
Sbjct: 61  TALQIATDIEDVGGEINAATSVETTAFYARVLRDDMSLAIDILADILTDSKFDPHELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG P+T++SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDAVFDRFTETAFRHQAIGRSILGTPDTVASFTSQQLRRFMERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-----YVGGEYIQKRDLA 234
            ADRM VV  G V H+  V +VE       +   ++    AV     YVGG+Y + RDL 
Sbjct: 181 GADRMVVVAAGGVTHDEFVREVE-----ARLGSFRDKADTAVPQYSNYVGGDYREHRDLM 235

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           +  ++LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD 
Sbjct: 236 DAQIILGFEGRAYHVRDFYASQMLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDT 295

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           GV  + +AT + ++  L   I+  +Q   E I+Q E+D+  A+  A L+ S+E    RA 
Sbjct: 296 GVFGVHAATGQSDLGELMPVILGELQKAGERIDQAELDRARAQYRAGLMMSRESPASRAS 355

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++++Q++  G  + +E+++D ++ IT E +  ++ ++FSS PT+  +GP
Sbjct: 356 QVARQLLLYGRPIETEELMDRLAGITVERLADLSNRLFSSKPTVTAIGP 404


>gi|90420102|ref|ZP_01228010.1| processing protease, M16 family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335436|gb|EAS49186.1| processing protease, M16 family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 438

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 189/429 (44%), Positives = 287/429 (66%), Gaps = 7/429 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K S+G+T+ TE MP ++SA + + ++AG+R+E  +EHG+AH LEHM FKGT++R
Sbjct: 1   MSVEVTKLSNGLTIATETMPHLESACLGIWVKAGARDEAPQEHGIAHLLEHMAFKGTSRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS+E TSY+A VLK  VPLAL+I+ D+L +S F+  ++ERE
Sbjct: 61  SARQIAEEIEDVGGEMNAATSVETTSYYARVLKNDVPLALDILTDILIDSRFDEQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG +ED   D +   F E  +  QIIGRPILG  ET+ SF+P+ +  +++R+Y
Sbjct: 121 QQVILQEIGAAEDTPDDIVFDHFQEAAFHKQIIGRPILGTRETVKSFSPDDLRGYLARHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKP---AVYVGGEYIQKRDLAE 235
           + D+M V   GAV H   V Q+E+ F    SV+ +     P   A Y GGE+ Q+RDL +
Sbjct: 181 SPDKMIVSAAGAVSHRAIVDQIEAAFGGTASVSPLPLESSPRQAASYTGGEFRQERDLMD 240

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
             M+LGF G AY +RDFY + +L+ ILG GMSSRLFQE+RE+RGLCY+I A H +FSD+G
Sbjct: 241 AQMVLGFEGRAYYARDFYASQVLSLILGGGMSSRLFQEIRERRGLCYAIYAFHWSFSDSG 300

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           +  I +AT +E +  L   I + +      I + E+++  A++ A L+ SQE    RA +
Sbjct: 301 IFGIHAATGEEELAELAPVIADELTRAAAGISEPEVNRARAQMRASLLMSQESPAARAAQ 360

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSEL 414
           I++Q++F G+ + +E++I  + AIT   +  +A++ F  T PTLA +G P+  +P+   L
Sbjct: 361 IARQMLFNGATITNEELIARLEAITAPRLADLAERTFVGTVPTLAAIG-PVSRLPSRDVL 419

Query: 415 IHALEGFRS 423
              L G  S
Sbjct: 420 AERLAGASS 428


>gi|114706689|ref|ZP_01439590.1| hypothetical protein FP2506_13094 [Fulvimarina pelagi HTCC2506]
 gi|114538081|gb|EAU41204.1| hypothetical protein FP2506_13094 [Fulvimarina pelagi HTCC2506]
          Length = 436

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/409 (43%), Positives = 276/409 (67%), Gaps = 9/409 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +I++  +G+TV+++ M  ++SA +   ++ G+R+E + EHG+AH LEHM FKGT +R
Sbjct: 1   MTQQITRLDNGLTVVSDRMDNLESAALGFWVKTGARDEHEGEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS+E TSY+A VLK+ VPLAL+I+ D+L NS F+P ++ERE
Sbjct: 61  SARDIAEEIENVGGELNAGTSVESTSYYARVLKDDVPLALDILSDILLNSRFDPVELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG +ED   D +   F E  + DQI+GRPILG  +++ SF+P  + +++ R Y
Sbjct: 121 QHVILQEIGAAEDTPDDIVFDHFQETAFTDQIVGRPILGTRDSVRSFSPSDLRAYLDRQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFN-----VCSVAKIKESMKPAVYVGGEYIQKRDLA 234
             DR+ V   GAV+H+  V+QV S F      +   A +K S   A Y GGEY ++RDLA
Sbjct: 181 GPDRIVVSAAGAVEHDAIVAQVSSLFEHRRSPILEPANVKRS--AARYTGGEYRERRDLA 238

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           +  +++GF G  Y  RDFY + +L+ +LG GMSSRLFQE+RE+RGLCYSI A H +FSD+
Sbjct: 239 DAQLLIGFEGRPYYQRDFYSSQVLSMVLGGGMSSRLFQEIRERRGLCYSIYAFHWSFSDS 298

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I +AT +E +  L  +IVE +    E I   E+ +  A++ + L+  QE   +RA 
Sbjct: 299 GLFGIHAATGEEELQELGETIVEELVKASEEISDTEVVRARAQMRSSLMMGQESPAVRAG 358

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           ++++Q+MF G+I+ SE++ D ++AI    +  +A ++F    PTLA +G
Sbjct: 359 QMARQLMFNGAIISSEELFDRLAAIDAARLKDLAGRLFIDGAPTLAAIG 407


>gi|304393517|ref|ZP_07375445.1| processing peptidase subunit beta [Ahrensia sp. R2A130]
 gi|303294524|gb|EFL88896.1| processing peptidase subunit beta [Ahrensia sp. R2A130]
          Length = 448

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 175/419 (41%), Positives = 276/419 (65%), Gaps = 4/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+ +++ S+G+TV+T+ M  ++SA + V ++AGSR+ER  EHG+AH LEHM FKGT  RT
Sbjct: 23  NVEVTRLSNGLTVVTDRMQHLESAALGVWVKAGSRDERASEHGIAHLLEHMAFKGTASRT 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I  +IE VGGD+NA TS E TS++A VLK+ VPLA++I+ D+L+NS F+ +++ RE+
Sbjct: 83  ARDIAVQIENVGGDVNAATSAETTSFYARVLKDDVPLAVDILADILNNSLFDENELAREQ 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+EIG + D+  D +   F  + ++DQ +GRPI+G PET+SSF    I S++S +Y 
Sbjct: 143 HVILQEIGAAHDNPEDIVFDEFQAVAFRDQALGRPIMGTPETVSSFRANDIRSYLSDHYH 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
              M +   G VDH+  V   E  F        +E  K   Y GGE +  RD  E  +++
Sbjct: 203 GPNMVLAASGNVDHDAIVKMAEKRFAHFGNQLAREPEK-GFYTGGEALLVRDHQEAQIVM 261

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G AY +RDFY +N+L+ +LG GMSSRLFQE+REKRGLCYSI A H+ +SD G+  + 
Sbjct: 262 GFEGRAYHARDFYASNVLSMMLGGGMSSRLFQEIREKRGLCYSIYAFHQGYSDTGLFGVH 321

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           +AT + ++  L   I++ ++   E I Q E+D+  A+I A L+ S E    RA +I++Q+
Sbjct: 322 AATEESDLGELMPVIIDELKKAGEGISQDELDRARAQISAGLLMSLESPASRAGQIARQI 381

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           +  G  + ++++++ ++A+T E +  ++ ++F  + PT+A +G P+  VP  + L  AL
Sbjct: 382 LLFGRPIPNDELMERLNALTIERLRDLSARLFIENMPTIAAIG-PVSGVPDQAALADAL 439


>gi|148559996|ref|YP_001258500.1| zinc protease [Brucella ovis ATCC 25840]
 gi|148371253|gb|ABQ61232.1| hypothetical zinc protease [Brucella ovis ATCC 25840]
          Length = 430

 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 167/405 (41%), Positives = 266/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++SA + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESAALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|306845111|ref|ZP_07477691.1| Insulinase-like peptidase, family M16 [Brucella sp. BO1]
 gi|306274526|gb|EFM56321.1| Insulinase-like peptidase, family M16 [Brucella sp. BO1]
          Length = 430

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 265/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVGNSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|153007943|ref|YP_001369158.1| processing peptidase [Ochrobactrum anthropi ATCC 49188]
 gi|151559831|gb|ABS13329.1| processing peptidase [Ochrobactrum anthropi ATCC 49188]
          Length = 430

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ S+G+T+ T+ M  ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLSNGLTIATDTMSHVESVALGIWVKAGARNEAADRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  VPLA++I+ D+L+ S F+ +++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDVPLAIDILSDILTASKFDEAELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT   +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSADLRQYMDEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G VDH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGVDHDAFVKEVEKRLGGFRAHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ +LG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMVLGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   +++ +    ++I   E+D+  A+  A L+ SQE +  RA ++++Q
Sbjct: 301 HAATGRDELVELVPVLIDELHKAADSISLEEVDRARAQYRASLLMSQESAASRAGQVARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F  S PT+A +GP
Sbjct: 361 FLLYGRPVENSELMDRLSLITPERLTDLAGRLFLDSKPTIAGVGP 405


>gi|254709627|ref|ZP_05171438.1| Insulinase-like peptidase, family M16 [Brucella pinnipedialis
           B2/94]
 gi|256031120|ref|ZP_05444734.1| Insulinase-like peptidase, family M16 [Brucella pinnipedialis
           M292/94/1]
 gi|261317159|ref|ZP_05956356.1| processing peptidase [Brucella pinnipedialis B2/94]
 gi|265988197|ref|ZP_06100754.1| processing peptidase [Brucella pinnipedialis M292/94/1]
 gi|261296382|gb|EEX99878.1| processing peptidase [Brucella pinnipedialis B2/94]
 gi|264660394|gb|EEZ30655.1| processing peptidase [Brucella pinnipedialis M292/94/1]
          Length = 430

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 266/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E+ ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTEIAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|254712957|ref|ZP_05174768.1| Insulinase-like peptidase, family M16 [Brucella ceti M644/93/1]
 gi|254716689|ref|ZP_05178500.1| Insulinase-like peptidase, family M16 [Brucella ceti M13/05/1]
 gi|254718657|ref|ZP_05180468.1| Insulinase-like peptidase, family M16 [Brucella sp. 83/13]
 gi|256060617|ref|ZP_05450783.1| Insulinase-like peptidase, family M16 [Brucella neotomae 5K33]
 gi|256368936|ref|YP_003106442.1| processing protease [Brucella microti CCM 4915]
 gi|261218494|ref|ZP_05932775.1| processing peptidase [Brucella ceti M13/05/1]
 gi|261320656|ref|ZP_05959853.1| processing peptidase [Brucella ceti M644/93/1]
 gi|261324613|ref|ZP_05963810.1| peptidase [Brucella neotomae 5K33]
 gi|265983638|ref|ZP_06096373.1| processing peptidase [Brucella sp. 83/13]
 gi|306837794|ref|ZP_07470658.1| Insulinase-like peptidase, family M16 [Brucella sp. NF 2653]
 gi|306842233|ref|ZP_07474896.1| Insulinase-like peptidase, family M16 [Brucella sp. BO2]
 gi|255999094|gb|ACU47493.1| processing protease [Brucella microti CCM 4915]
 gi|260923583|gb|EEX90151.1| processing peptidase [Brucella ceti M13/05/1]
 gi|261293346|gb|EEX96842.1| processing peptidase [Brucella ceti M644/93/1]
 gi|261300593|gb|EEY04090.1| peptidase [Brucella neotomae 5K33]
 gi|264662230|gb|EEZ32491.1| processing peptidase [Brucella sp. 83/13]
 gi|306287613|gb|EFM59060.1| Insulinase-like peptidase, family M16 [Brucella sp. BO2]
 gi|306407135|gb|EFM63350.1| Insulinase-like peptidase, family M16 [Brucella sp. NF 2653]
          Length = 430

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 265/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|239831352|ref|ZP_04679681.1| processing peptidase [Ochrobactrum intermedium LMG 3301]
 gi|239823619|gb|EEQ95187.1| processing peptidase [Ochrobactrum intermedium LMG 3301]
          Length = 432

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 165/405 (40%), Positives = 265/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ S+G+T+ T+ M  ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 3   MGVEVTRLSNGLTIATDTMSHVESVALGIWVKAGARNEAADRHGIAHLLEHMAFKGTENR 62

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  VPLA++I+ D+L+ S F+ +++ERE
Sbjct: 63  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDVPLAIDILSDILTASKFDEAELERE 122

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 123 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMDEQY 182

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G VDH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 183 SADRMVVTAAGGVDHDAFVREVEKRLGGFRAHNTAPTLDLAHYVGGDFRENRELMDAQVL 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ +LG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 243 IGFEGRAYHVRDFYASQLLSMVLGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   +++ +    ++I   E+D+  A+  A L+ SQE +  RA ++++Q
Sbjct: 303 HAATGRDELVELVPVLIDELHKAADSISLEEVDRARAQYRASLLMSQESAASRAGQVARQ 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT + +  +A ++F  S PT+A +GP
Sbjct: 363 FLLYGRPVENSELMDRLSLITPQRLTDLAGRLFLDSKPTIAGVGP 407


>gi|256254523|ref|ZP_05460059.1| Insulinase-like peptidase, family M16 [Brucella ceti B1/94]
 gi|260168251|ref|ZP_05755062.1| processing protease [Brucella sp. F5/99]
 gi|261221700|ref|ZP_05935981.1| peptidase [Brucella ceti B1/94]
 gi|261757714|ref|ZP_06001423.1| processing peptidase [Brucella sp. F5/99]
 gi|260920284|gb|EEX86937.1| peptidase [Brucella ceti B1/94]
 gi|261737698|gb|EEY25694.1| processing peptidase [Brucella sp. F5/99]
          Length = 430

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 265/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGHAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|225626988|ref|ZP_03785027.1| Peptidase M16 domain protein [Brucella ceti str. Cudo]
 gi|225618645|gb|EEH15688.1| Peptidase M16 domain protein [Brucella ceti str. Cudo]
          Length = 432

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 265/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 3   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 62

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 63  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 122

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 123 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 182

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 183 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 243 IGFEGHAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 303 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 363 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 407


>gi|294851859|ref|ZP_06792532.1| processing protease [Brucella sp. NVSL 07-0026]
 gi|294820448|gb|EFG37447.1| processing protease [Brucella sp. NVSL 07-0026]
          Length = 430

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 265/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEVPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|62289464|ref|YP_221257.1| processing protease [Brucella abortus bv. 1 str. 9-941]
 gi|82699390|ref|YP_413964.1| insulinase-like peptidase [Brucella melitensis biovar Abortus 2308]
 gi|189023713|ref|YP_001934481.1| Insulinase-like peptidase, family M16 [Brucella abortus S19]
 gi|254688775|ref|ZP_05152029.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 6 str.
           870]
 gi|254693259|ref|ZP_05155087.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696905|ref|ZP_05158733.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729808|ref|ZP_05188386.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 4 str.
           292]
 gi|256257022|ref|ZP_05462558.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 9 str.
           C68]
 gi|260545783|ref|ZP_05821524.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260754261|ref|ZP_05866609.1| processing peptidase [Brucella abortus bv. 6 str. 870]
 gi|260757481|ref|ZP_05869829.1| processing peptidase [Brucella abortus bv. 4 str. 292]
 gi|260761306|ref|ZP_05873649.1| processing peptidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883286|ref|ZP_05894900.1| peptidase [Brucella abortus bv. 9 str. C68]
 gi|261213508|ref|ZP_05927789.1| processing peptidase [Brucella abortus bv. 3 str. Tulya]
 gi|297247877|ref|ZP_06931595.1| processing protease [Brucella abortus bv. 5 str. B3196]
 gi|62195596|gb|AAX73896.1| processing protease [Brucella abortus bv. 1 str. 9-941]
 gi|82615491|emb|CAJ10465.1| Insulinase-like peptidase, family M16:Peptidase M16 inactive
           [Brucella melitensis biovar Abortus 2308]
 gi|189019285|gb|ACD72007.1| Insulinase-like peptidase, family M16 [Brucella abortus S19]
 gi|260097190|gb|EEW81065.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260667799|gb|EEX54739.1| processing peptidase [Brucella abortus bv. 4 str. 292]
 gi|260671738|gb|EEX58559.1| processing peptidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674369|gb|EEX61190.1| processing peptidase [Brucella abortus bv. 6 str. 870]
 gi|260872814|gb|EEX79883.1| peptidase [Brucella abortus bv. 9 str. C68]
 gi|260915115|gb|EEX81976.1| processing peptidase [Brucella abortus bv. 3 str. Tulya]
 gi|297175046|gb|EFH34393.1| processing protease [Brucella abortus bv. 5 str. B3196]
          Length = 430

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|256044197|ref|ZP_05447104.1| processing peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563556|ref|ZP_05834042.1| processing peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|265990612|ref|ZP_06103169.1| peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260153572|gb|EEW88664.1| processing peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|263001396|gb|EEZ13971.1| peptidase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 430

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|225852019|ref|YP_002732252.1| processing protease [Brucella melitensis ATCC 23457]
 gi|256264476|ref|ZP_05467008.1| peptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|225640384|gb|ACO00298.1| processing protease [Brucella melitensis ATCC 23457]
 gi|263094807|gb|EEZ18545.1| peptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408513|gb|ADZ65578.1| processing protease [Brucella melitensis M28]
 gi|326538230|gb|ADZ86445.1| processing protease [Brucella melitensis M5-90]
          Length = 430

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|254707789|ref|ZP_05169617.1| Insulinase-like peptidase, family M16 [Brucella pinnipedialis
           M163/99/10]
 gi|261315275|ref|ZP_05954472.1| processing peptidase [Brucella pinnipedialis M163/99/10]
 gi|261304301|gb|EEY07798.1| processing peptidase [Brucella pinnipedialis M163/99/10]
          Length = 430

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRKLMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|237814951|ref|ZP_04593949.1| Peptidase M16 domain protein [Brucella abortus str. 2308 A]
 gi|237789788|gb|EEP63998.1| Peptidase M16 domain protein [Brucella abortus str. 2308 A]
          Length = 490

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 61  MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 120

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 121 TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 180

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 181 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 240

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 241 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 300

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 301 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 360

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 361 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 420

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 421 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 465


>gi|17987734|ref|NP_540368.1| processing peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|17983454|gb|AAL52632.1| zinc protease [Brucella melitensis bv. 1 str. 16M]
          Length = 490

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 166/405 (40%), Positives = 264/405 (65%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 61  MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 120

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 121 TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 180

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 181 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 240

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 241 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 300

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 301 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 360

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 361 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 420

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 421 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 465


>gi|256113012|ref|ZP_05453909.1| processing protease [Brucella melitensis bv. 3 str. Ether]
 gi|265994444|ref|ZP_06107001.1| peptidase [Brucella melitensis bv. 3 str. Ether]
 gi|262765557|gb|EEZ11346.1| peptidase [Brucella melitensis bv. 3 str. Ether]
          Length = 430

 Score =  342 bits (877), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 165/405 (40%), Positives = 263/405 (64%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+   +  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARTQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|49474007|ref|YP_032049.1| processing protease protein [Bartonella quintana str. Toulouse]
 gi|49239510|emb|CAF25866.1| Processing protease protein [Bartonella quintana str. Toulouse]
          Length = 424

 Score =  340 bits (872), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 255/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETFSQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS E T+Y A VLK  +PLA++I+ D+L  S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSTETTAYFARVLKNDIPLAIDILADILMYSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG P+T+ SFT   + SF+ + Y
Sbjct: 121 KQVVFQEIGAARDIPDDIVFDHFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMDKQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV+HE  + +VES+F       I      A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVEHENFLQEVESHFRTFRPHSIAPLTNLANYVGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRAYHARDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +    +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKELLPVILDELSKASKNIHANELQRARAQYRASLTMSQENPSSQANLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   + I+ +  IT   +  +A ++F +STPTLA +GP
Sbjct: 361 MLLYGRPIPLSETIERLELITPARLTDLAHRLFINSTPTLAAVGP 405


>gi|23501384|ref|NP_697511.1| processing protease [Brucella suis 1330]
 gi|161618454|ref|YP_001592341.1| hypothetical protein BCAN_A0490 [Brucella canis ATCC 23365]
 gi|254703832|ref|ZP_05165660.1| hypothetical protein Bsuib36_07882 [Brucella suis bv. 3 str. 686]
 gi|260566914|ref|ZP_05837384.1| processing peptidase [Brucella suis bv. 4 str. 40]
 gi|261754483|ref|ZP_05998192.1| processing peptidase [Brucella suis bv. 3 str. 686]
 gi|23347279|gb|AAN29426.1| processing protease [Brucella suis 1330]
 gi|161335265|gb|ABX61570.1| hypothetical protein BCAN_A0490 [Brucella canis ATCC 23365]
 gi|260156432|gb|EEW91512.1| processing peptidase [Brucella suis bv. 4 str. 40]
 gi|261744236|gb|EEY32162.1| processing peptidase [Brucella suis bv. 3 str. 686]
          Length = 430

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 263/405 (64%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++ G+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKVGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + DRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SVDRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP 405


>gi|163842764|ref|YP_001627168.1| hypothetical protein BSUIS_A0510 [Brucella suis ATCC 23445]
 gi|163673487|gb|ABY37598.1| hypothetical protein BSUIS_A0510 [Brucella suis ATCC 23445]
          Length = 430

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 164/405 (40%), Positives = 263/405 (64%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + DRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SVDRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF   AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEARAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNEPTIAGVGP 405


>gi|328545004|ref|YP_004305113.1| peptidase M16-like protein [polymorphum gilvum SL003B-26A1]
 gi|326414746|gb|ADZ71809.1| Peptidase M16-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 428

 Score =  337 bits (865), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 174/405 (42%), Positives = 256/405 (63%), Gaps = 3/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R +   +G+TVIT+ MP + +A + V +R GSR+E  +E+G+ H LEHM FKGTT R
Sbjct: 1   MEVRRTTLDNGLTVITDRMPHLKTAALGVWVRTGSRSETPDENGITHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA+ I E+IE VGG++NA TS+EHT+Y+A VL E VPLAL+++ D+L NS F+P ++ RE
Sbjct: 61  TARAIAEQIEAVGGELNASTSVEHTNYYARVLAEDVPLALDLLSDILQNSVFDPEELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG ++D   D     F E  W DQ IGRPILG P T+S FT + + +++   Y
Sbjct: 121 QHVILQEIGAAQDSPEDRAFDLFQEAAWPDQAIGRPILGTPATVSGFTRDALDTYLKSRY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M +   GAVDH+  V + E  F+  S A+      P  Y GGE    +DL E  ++
Sbjct: 181 RGPDMVLAAAGAVDHDDIVRRAEDKFSGFS-AEPAAPCVPGFYRGGESRLAKDLMEAQIL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G  Y+S D+Y   ILAS+LG GMSSRLFQEVRE RGLCY+I + H  FSD G+  +
Sbjct: 240 IGFEGRPYKSDDYYAIQILASVLGGGMSSRLFQEVRETRGLCYAIYSFHWAFSDTGLFGL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E+I  L   ++  ++    +I + E+ +  A+I A L+ + E    RA +I++Q
Sbjct: 300 HAATGEEDIGELMPVVLGELERTAADITEEEVARARAQIRAGLMMALESPAARAGQIARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
           ++  G  L  E+I   I A++ + +  VA + F+ S PTL  +GP
Sbjct: 360 ILIHGRTLSLEEISRKIDAVSADMVRRVAAETFAGSAPTLTGVGP 404


>gi|163867887|ref|YP_001609091.1| processing protease protein [Bartonella tribocorum CIP 105476]
 gi|161017538|emb|CAK01096.1| processing protease protein [Bartonella tribocorum CIP 105476]
          Length = 424

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 173/405 (42%), Positives = 255/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ + + S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MDVDVCRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK  +PLA++I+ D+L +S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKSDIPLAIDILADILMHSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++ Q +GR ILG  +TI SFT   +  F+++ Y
Sbjct: 121 KQVIFQEIGAAHDTPDDIVFDHFTETAFRHQSLGRSILGTAKTIRSFTSADLHDFINKQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VE+                A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVKHESFLKEVENRLGTFRSYSTASPTNLANYVGGDFREYRDLMDTQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY +RDFY T IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRAYHARDFYATQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +    +NI+  E+ +   +  A LI SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKELLPVILDELSKTSKNIQANELQRAQTQYRANLIMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   + I+ ++ IT + +  +A ++F SSTPTL  +GP
Sbjct: 361 ILLYGRPIPMSETIERLNLITPKRLTDLAHRLFTSSTPTLTAVGP 405


>gi|307941655|ref|ZP_07657010.1| processing peptidase subunit beta [Roseibium sp. TrichSKD4]
 gi|307775263|gb|EFO34469.1| processing peptidase subunit beta [Roseibium sp. TrichSKD4]
          Length = 428

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 169/420 (40%), Positives = 270/420 (64%), Gaps = 4/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++R +   +G+TV+T+ MP + +A + + ++ GSR+ER E++G+ H LEHM FKGT +R
Sbjct: 1   MDVRTTVLDNGLTVVTDRMPHLKTAALGIWVKTGSRSERVEQNGITHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A++I EEIE VGG++NA TS+EHT+Y+A VL E VPLA++++ D+L NS F+  +++RE
Sbjct: 61  NARQIAEEIEAVGGELNAATSIEHTNYYARVLAEDVPLAVDMLSDILQNSVFDGEELKRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D     F    W DQ IGRPILG PE +  FTP+ +  ++   Y
Sbjct: 121 QHVILQEIGAAADTPEDKAFDLFQSTAWPDQSIGRPILGTPEGVLGFTPDALNQYLHERY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M +   GAVDH+  V      F   S     +  + A Y GGE   ++DL E  ++
Sbjct: 181 RGPDMVLAAAGAVDHDQLVELAAQKFGAISQEAAGQG-EHASYKGGEVRIEKDLMEAQIL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G  Y+S+D+Y   ILASI+G GMSSRLFQE+REK GLCY+I + H  FSD G+  +
Sbjct: 240 IGFEGRPYKSKDYYAIQILASIMGGGMSSRLFQEIREKHGLCYAIYSFHWAFSDTGLFGL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT++E++ AL   I++ ++S  E I   E+++  A+I A L+ + E    RA +I++Q
Sbjct: 300 HAATSQEDLTALMPMILDELRSAGETISDAEVNRSRAQIRAGLMMALESPAARAGQIARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G +L  +++   I A+T  +I  VA++ F ++ PTL  +G P+D + + +++ ++L
Sbjct: 360 ILVHGRVLPMDEVSAKIEAVTAAEIRRVAQETFLNAVPTLTAVG-PVDKLMSVNDIANSL 418


>gi|240850094|ref|YP_002971487.1| processing protease [Bartonella grahamii as4aup]
 gi|240267217|gb|ACS50805.1| processing protease [Bartonella grahamii as4aup]
          Length = 424

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 172/405 (42%), Positives = 254/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ I + S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MDVDICRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETSTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK  +PLA++I+ D+L +S F+ +++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKSDIPLAIDILADILMHSKFDDNELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++ Q +GR ILG  +TI SFT   +  F+++ Y
Sbjct: 121 KQVIFQEIGAAHDTPDDIVFDHFTETAFRHQSLGRSILGTAKTIQSFTSTDLHDFINKQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VES                A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVKHESFLREVESRLGTFRSHSTAPLTNLANYVGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRAYHARDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +   +  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKELIPVILDELSKVSKNIHANELQRAQTQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
           ++  G  +   + I+ ++ IT + +  +A ++F+ STPTL  +GP
Sbjct: 361 ILLYGRPIPISETIERLNLITPKRLTDLAHRLFTNSTPTLTAVGP 405


>gi|261751828|ref|ZP_05995537.1| processing peptidase [Brucella suis bv. 5 str. 513]
 gi|261741581|gb|EEY29507.1| processing peptidase [Brucella suis bv. 5 str. 513]
          Length = 460

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 159/386 (41%), Positives = 251/386 (65%), Gaps = 1/386 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 61  MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 120

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 121 TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 180

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 181 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 240

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 241 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 300

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 301 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 360

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 361 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 420

Query: 360 VMFCGSILCSEKIIDTISAITCEDIV 385
            +  G  + + +++D +S IT E + 
Sbjct: 421 FLLYGRPVENSELLDRLSLITPERLT 446


>gi|254701287|ref|ZP_05163115.1| Insulinase-like peptidase, family M16 [Brucella suis bv. 5 str.
           513]
          Length = 400

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 159/383 (41%), Positives = 250/383 (65%), Gaps = 1/383 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCE 382
            +  G  + + +++D +S IT E
Sbjct: 361 FLLYGRPVENSELLDRLSLITPE 383


>gi|49475244|ref|YP_033285.1| processing protease protein [Bartonella henselae str. Houston-1]
 gi|49238049|emb|CAF27256.1| Processing protease protein [Bartonella henselae str. Houston-1]
          Length = 426

 Score =  328 bits (842), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 173/405 (42%), Positives = 255/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+  +G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLRNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS E T+Y A VLK  +PLA++I+ D+L +S F+  ++ERE
Sbjct: 61  TAFQIASDIEDVGGEINATTSTETTAYFARVLKNDIPLAIDILADILMHSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG P+T+ SFT   + SF++++Y
Sbjct: 121 KQVVFQEIGAARDVPDDVVFDYFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMNKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VES  +       +     A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVQHENFLQEVESRLSTFRPHSTEPLTNLANYVGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHARDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDIGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +  A+  A L  +QE    +A  I++Q
Sbjct: 301 HAATGQEKLKELLPVILDELSKVSKNIHTNELQRARAQYRATLTMAQENPSSQANFIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   + I+ +  IT   +  +A ++F ++TPTLA +GP
Sbjct: 361 ILLYGREIPLSETIERLELITPARLTDLAGRLFINATPTLAAVGP 405


>gi|254471856|ref|ZP_05085257.1| peptidase, M16 family [Pseudovibrio sp. JE062]
 gi|211959058|gb|EEA94257.1| peptidase, M16 family [Pseudovibrio sp. JE062]
          Length = 423

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 263/409 (64%), Gaps = 5/409 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++++K  +G+TV+T+ M  + +  + + ++AGSR+E ++E+G+ H LEHM FKGTTKR
Sbjct: 1   MAVKLTKLENGLTVVTDQMEYLKTTALGIWVKAGSRSEGEQENGITHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A+EI EEIE VGG++NA TS+EHT+Y+   L + VPL L+I+ D+L +S  +  ++ RE
Sbjct: 61  NAREIAEEIEAVGGEMNASTSVEHTNYYVRTLADDVPLGLDILSDILQDSIIDADELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG ++D   D +     E  W +Q +GRPILG PET++ F+ + I  +V R Y
Sbjct: 121 KHVILQEIGAAQDTPDDQVFDVLLETAWPNQPLGRPILGTPETVNGFSADAIRQYVERKY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           TA  M +   GAV+HE  V    + F+  S +   E    A YVGGE   +RDL E  ++
Sbjct: 181 TASDMVLAAAGAVEHEALVDLARANFSKLSNSAPDED-NLAQYVGGEGAIERDLQELQII 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y+  D+Y   +LASILG GMSSRLFQEVREKRGLCYS+ A H  F+D G   +
Sbjct: 240 LGFEGLPYEHEDYYAVQVLASILGGGMSSRLFQEVREKRGLCYSVYAFHWAFADTGFFGV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT  E+   LT  +V+ ++ + + + ++E+ +  A++ + L+ + E    RA ++++Q
Sbjct: 300 HAATGPEDAAELTEVLVDQLKEIAKGVSEKEVSRAKAQLRSGLLMALESPAARAGQLARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGP--PM 405
           VM  G  +  E++   ++A++ + +  +A+K+F++  PT   +GP  PM
Sbjct: 360 VMIYGHPVAIEELEKRLNAVSADRLQVLAEKLFATDNPTFVKVGPKAPM 408


>gi|182677714|ref|YP_001831860.1| peptidase M16 domain-containing protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633597|gb|ACB94371.1| peptidase M16 domain protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 421

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 170/405 (41%), Positives = 251/405 (61%), Gaps = 3/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + I+   SG+ +IT+ MP + +A + V I AGSR+ER EEHG++H LEHM FKGT +R
Sbjct: 1   MTVEITTLPSGLRIITDAMPHLATASLGVWIGAGSRHERPEEHGLSHLLEHMAFKGTHRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGGD+NA TS E T+Y+A VL +  PLAL+I+ D+L+ S F+P ++ERE
Sbjct: 61  SAREIAEEIESVGGDLNAATSTEQTAYYAHVLAQDTPLALDILADILTESLFDPRELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG  ED   D +   F+   + DQ +GRPILG P  ++SF P  I +++S +Y
Sbjct: 121 KDVILQEIGAVEDTPDDLVFDLFNARAFPDQPLGRPILGTPAHVTSFGPTMIGNYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            +  M +   GAV+H+  V +    F    V +  + + PA Y GGE   KR L + H++
Sbjct: 181 RSAAMVIGAAGAVEHQKIVDEAARRFASLPV-REAQILVPAHYQGGEIRLKRKLEQAHIV 239

Query: 240 LGFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +GF G +Y  +D FY   I A+  G GMSSRLFQEVREKRGL YSISA H  ++D G+  
Sbjct: 240 VGFEGLSYHDQDSFYAMQIFANATGGGMSSRLFQEVREKRGLAYSISAFHWGYADAGLFG 299

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
             +AT   +I  L    ++ +      + + EI +  A++   L+ + E    R  +I++
Sbjct: 300 FYAATGARDIAELMPVALDCLAEATTGLTEVEIRRAKAQMKVSLLAALESPSARVEQIAR 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           Q++    +L  E+I++ I AIT ED+  V +    S PTLA +GP
Sbjct: 360 QLIAFDRVLTHEEIVERIDAITLEDVCRVGQAALKSAPTLAAIGP 404


>gi|220920315|ref|YP_002495616.1| peptidase M16 domain-containing protein [Methylobacterium nodulans
           ORS 2060]
 gi|219944921|gb|ACL55313.1| peptidase M16 domain protein [Methylobacterium nodulans ORS 2060]
          Length = 431

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 165/419 (39%), Positives = 258/419 (61%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           +LRI++  +G+TV TE MP + +A + V + AGSR+ER +EHG++H +EHM FKGT +R+
Sbjct: 13  SLRITRLPNGLTVATEPMPGVATATLGVWVGAGSRHERPQEHGLSHLIEHMAFKGTCRRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I E+IE VGGDINA TS E TSY A VL E + +AL++IGD+L+NS F+  ++ RE+
Sbjct: 73  ARAIAEDIENVGGDINAATSAEQTSYTARVLGEDIGVALDVIGDILTNSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F+E  + DQ IGRPILG+PETI SF    I  +++R YT
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFTEAAFPDQPIGRPILGRPETIQSFDRRAIEVYLAREYT 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            DRM +   GAV+HE  V   E +F     A+     +  +Y+GGE    R L + +++L
Sbjct: 193 PDRMVLAAAGAVEHEAIVEAAERHFGALP-ARTAPDAEAGLYLGGERRMLRKLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ A +LG G++SRL+ EVRE RGL Y I A H  FSD G+  I 
Sbjct: 252 GLPGLSFRDEGYYALHLFAQVLGGGLTSRLWHEVRETRGLAYEIHAFHWPFSDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + TA  ++ AL    V  + +   +IE+ E+ +  A++   L+ + E    R   I++Q+
Sbjct: 312 AGTAGADLPALVEVTVACLGNAAASIEETELARAKAQLKVSLLSALETPGGRIERIARQI 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           +  G ++ +E+II  + A+T E +    + + +  PTLA +G P+  +P+   + +AL+
Sbjct: 372 LAWGRVIPAEEIIAKVDAVTPEQVRAAGRAVMAGAPTLAAIG-PIRKLPSLDAVGNALK 429


>gi|319898537|ref|YP_004158630.1| processing protease protein [Bartonella clarridgeiae 73]
 gi|319402501|emb|CBI76044.1| processing protease protein [Bartonella clarridgeiae 73]
          Length = 427

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 170/405 (41%), Positives = 257/405 (63%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+++ T  MP I+S  + + ++ GSRNE  ++HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLSIATHKMPQIESVALGIWVKVGSRNETFKQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLKE +PLA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFKIATDIEDVGGEINATTSIETTAYFARVLKEDIPLAIDILADIMTCSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++ Q +GR ILG  +T+ SFT   + +F+++ Y
Sbjct: 121 KQVIFQEIGATCDVPDDIVFDHFTETAFRHQSLGRSILGTQQTVQSFTSADLHNFMNQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV+HE  + QVES             +  A Y+GG++ + RDL +  ++
Sbjct: 181 SADRMVVVATGAVEHEDFLRQVESCLGTFRSHSTAPLINLANYIGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHAHDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVILDELCKISKNIHTNELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   ++ + +  IT E +  +AK++F +S PT A +GP
Sbjct: 361 MLLYGRPIPISEMTECLELITLEQLTDLAKRLFINSNPTFAAVGP 405


>gi|319408227|emb|CBI81880.1| processing protease protein [Bartonella schoenbuchensis R1]
          Length = 430

 Score =  325 bits (834), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 170/405 (41%), Positives = 257/405 (63%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA+TS+E T+Y A VLK+ +PLA++I+ D++  S F+  ++ERE
Sbjct: 61  TAFKIAADIEDVGGEINAHTSIETTAYFARVLKDDIPLAIDILSDIMICSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +   F+E  ++ Q +GR ILG P+T+ SFT   + SF++++Y
Sbjct: 121 KQVIIQEIGATYDVPDDIVFDHFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMNKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV+HE  + +VES  +             A Y+GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVNHESFLREVESRLSTFRSHSTTSFTNLANYIGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI + H  FSD G+  I
Sbjct: 241 LGFEGRPYHARDFYTAQILSIILGGGMSSRLFQEVREKRGLCYSIYSFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +    +NI + E+ +  A+  A    SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVILDELSKASKNIHESELQRARAQYRANFTISQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
           ++     +   ++I+ +  IT + +  +A  +F+ S PTLA +GP
Sbjct: 361 MLLYDRPIPVSEMIERLELITPKRLTELATHLFTNSKPTLAAIGP 405


>gi|254501728|ref|ZP_05113879.1| peptidase, M16 (pitrilysin) family [Labrenzia alexandrii DFL-11]
 gi|222437799|gb|EEE44478.1| peptidase, M16 (pitrilysin) family [Labrenzia alexandrii DFL-11]
          Length = 429

 Score =  325 bits (833), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 257/424 (60%), Gaps = 10/424 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  +   +G+TV+T+ MP + +A + V +R GSR E  +++G+ H LEHM FKGT  R
Sbjct: 1   MKVETTVLENGLTVVTDQMPHLKTAALGVWVRTGSRAENADQNGITHLLEHMAFKGTKSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I EEIE VGG++NA TS+EHT+Y+A +L E +PLA++I+ D+L NS+F   ++ RE
Sbjct: 61  SARGIAEEIEAVGGELNASTSIEHTNYYARILAEDLPLAVDILADILQNSTFEAEELVRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG S D   D     F    W +Q IGRPILG PET+  F  + +  +++  Y
Sbjct: 121 QHVILQEIGASNDAPEDQAFDLFQATAWPEQAIGRPILGTPETVQGFGRDSLNDYLASRY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP---AVYVGGEYIQKRDLAEE 236
            A  M +   GAVDH+  VS     F   +     E   P   A Y GGE +  +DL E 
Sbjct: 181 RAPDMVLSAAGAVDHDELVSLARQKFGAIN----SEPAAPDPDARYSGGEKLLNKDLMEA 236

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
            +++GF G  Y+++D+Y   ILAS+LG GMSSRLFQE+REK GLCY+I + H  FSD G+
Sbjct: 237 QVLIGFEGRPYKAKDYYAIQILASVLGGGMSSRLFQEIREKHGLCYAIYSFHWAFSDTGL 296

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
             I +AT+ E++ AL   I + + S    I + E+ +  A+I A L+ + E    RA +I
Sbjct: 297 FGIHAATSHEDLGALMPMIADELVSAAHTITEDEVARSRAQIRAGLMMALESPAARAGQI 356

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELI 415
           ++Q++  G +L  ++I   I A+T  DI   A   F  +TPTL  +G P++ + T  EL 
Sbjct: 357 ARQILVHGRVLAPDEISAKIEAVTAADIREAAYNTFVGTTPTLTAIG-PINGIMTADELA 415

Query: 416 HALE 419
             L+
Sbjct: 416 ARLQ 419


>gi|319405300|emb|CBI78914.1| processing protease protein [Bartonella sp. AR 15-3]
          Length = 427

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 167/405 (41%), Positives = 258/405 (63%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  MP I+S  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHKMPQIESVALGIWVKVGSRNETFIQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK+ +PLA++I+ D+++ S F+  +++RE
Sbjct: 61  TAFKIATDIEDVGGEINATTSIETTAYFARVLKKDIPLAIDILADIMTCSKFDEDELDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++DQ +GR ILG  +T+ SFT   + +F+++ Y
Sbjct: 121 KQVIFQEIGATCDAPDDIVFDHFTETAFRDQSLGRSILGTQKTVQSFTSADLRNFMNQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  G+++HE  + QVES             +  A Y+GG++ + R+L +  ++
Sbjct: 181 SADRMIVVAAGSIEHESFLRQVESCLGTFRPHSTAPLVNLANYIGGDFREYRNLMDTQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHAHDFYTAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVILDELYKISKNIHTNELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   ++ + +  IT E +  +AK +F +S+PTLA +GP
Sbjct: 361 MLLYGRPIPISEMTECLELITLEQLTDLAKHLFINSSPTLAAVGP 405


>gi|118590738|ref|ZP_01548139.1| peptidase, family M16 [Stappia aggregata IAM 12614]
 gi|118436714|gb|EAV43354.1| peptidase, family M16 [Stappia aggregata IAM 12614]
          Length = 418

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 171/413 (41%), Positives = 255/413 (61%), Gaps = 10/413 (2%)

Query: 12  ITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEK 70
           +TV+T+ MP + +A + V +R GSR E   ++G+ H LEHM FKGT  RTA+ I EEIE 
Sbjct: 1   MTVVTDQMPHLKTAALGVWVRTGSRAETVHQNGITHLLEHMAFKGTKTRTARGIAEEIEA 60

Query: 71  VGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMS 130
           VGG++NA TS+EHT+Y+A +L E  PLA++I+ D+L NS+F+  ++ RE++V+L+EIG +
Sbjct: 61  VGGELNASTSIEHTNYYARILAEDTPLAVDILADILQNSTFDAQELTREQHVILQEIGAA 120

Query: 131 EDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVG 190
            D   D     F E  W +Q IGRPILG PET+  F  + + ++++  Y A  M +   G
Sbjct: 121 NDSPDDQAFDLFQETAWPEQAIGRPILGTPETVQGFNRDALNAYLADRYRAPDMVLAAAG 180

Query: 191 AVDHEFCVSQVESYFNVCSVAKIKESMKP---AVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
           AV+HE  V+     F   +     E   P   A Y GGE ++ ++L E  +++GF G  Y
Sbjct: 181 AVEHEALVALAREKFGGFN----SEPAAPESEARYRGGETLRPKELMEAQVLIGFEGQPY 236

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
           +S D+Y   ILAS+LG GMSSRLFQE+REK GLCY+I + H  FSD G+  + +AT++E+
Sbjct: 237 KSADYYAIQILASVLGGGMSSRLFQEIREKHGLCYAIYSFHWAFSDTGLFGLHAATSQED 296

Query: 308 IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
           + AL   IVE + +  + I   E+ +  A+I A L+ + E    RA +I++Q++    +L
Sbjct: 297 LAALMPMIVEELIAATQTITDEEVARSRAQIRAGLMMALESPAARAGQIARQILVHNRVL 356

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHALE 419
             ++I   I A+T  DI  VA + F  T PTL  +G P+D + T  EL   L+
Sbjct: 357 DPDEISSKIEAVTAADIRRVAHQTFVGTVPTLTAIG-PVDGIMTADELAGRLQ 408


>gi|319406871|emb|CBI80506.1| processing protease protein [Bartonella sp. 1-1C]
          Length = 427

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 170/405 (41%), Positives = 253/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  MP I+S  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHKMPQIESVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK+ +PLA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKKDIPLAIDILADIMTCSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG  +T+ SFT   + +F+ + Y
Sbjct: 121 KQVVFQEIGATCDVPDDIVFDYFTETAFRHQSLGRSILGTQKTVQSFTSADLHNFMKQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  G+V+HE  + QVES             +  A Y GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGSVEHESFLRQVESCLGTFQPHSTAPLVNLANYTGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGSPYHAHDFYAAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L    ++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKTLLPVTLDELCKISKNIHINELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   +I + +  IT E +  +AK +F +S PTLA +GP
Sbjct: 361 MLLYGRPIPISEITECVELITLEQLTDLAKHLFINSKPTLAAVGP 405


>gi|121601771|ref|YP_988730.1| M16 family peptidase [Bartonella bacilliformis KC583]
 gi|120613948|gb|ABM44549.1| peptidase, M16 family [Bartonella bacilliformis KC583]
          Length = 422

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 170/405 (41%), Positives = 252/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ IS+ S+G+T+ T  M  IDS  + + ++ GSRNE+  +HG+AH LEHM FKGT  R
Sbjct: 1   MSVDISRLSNGLTIATHTMQHIDSVALGIWVKVGSRNEKSTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  EIE VGG+INA TS+E T+Y A VLK  + LA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFKIASEIEDVGGEINATTSIETTAYFARVLKNDISLAIDILSDIMTCSKFDEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++DQ +GR ILG P+TI S T + + SF++  Y
Sbjct: 121 KQVVFQEIGATCDVPDDIIFDHFTETAFRDQSLGRSILGTPKTIQSLTSDDLRSFMNEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VES  ++            A Y GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVQHESFLREVESRLSIFRPYSKTPLANFAHYTGGKFHEHRDLMDTQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y ++DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  I
Sbjct: 241 LGFEGYPYHTQDFYTAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +  +  L   I++ +  + +NI   E+ +  A+  A LI SQE    +A  I++Q
Sbjct: 301 HTATGQRELETLFPVILDELSKVGQNIHISELQRAQAQYRANLIMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
           ++  G  +   +    +  +T + +  +A  + + S PTLA +GP
Sbjct: 361 ILLYGRPIPISETTGHLDLVTPQRLTNLANNLITNSKPTLATVGP 405


>gi|319403859|emb|CBI77445.1| processing protease protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 427

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 169/405 (41%), Positives = 254/405 (62%), Gaps = 2/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  MP I+S  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHKMPQIESVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK+ +PLA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKKDIPLAIDILADIMTCSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG  +T+ SFT   + +F+ + Y
Sbjct: 121 KQVVFQEIGATCDVPDDIVFDYFTETAFRHQSLGRSILGTQKTVQSFTSADLHNFMKQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  G+V+HE  + QVES  +          +  A Y GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGSVEHESFLRQVESCLSTFQPHSTAPLVNLANYTGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHAHDFYAAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L    ++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVTLDELYKISKNIHINELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           ++  G  +   ++ + +  IT E +  +AK +F +S PTLA +GP
Sbjct: 361 MLLYGRPIPISEMTECVELITLEQLTDLAKHLFINSKPTLAAVGP 405


>gi|170740578|ref|YP_001769233.1| processing peptidase [Methylobacterium sp. 4-46]
 gi|168194852|gb|ACA16799.1| processing peptidase [Methylobacterium sp. 4-46]
          Length = 431

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 158/403 (39%), Positives = 245/403 (60%), Gaps = 2/403 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            LR+++  +G TV TE MP + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  TLRVTRLPNGFTVATEPMPGVATATLGVWVGAGSRHERPQEHGLSHLIEHMAFKGTRTRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ + E+IE VGGDINA TS E TSY A VL E V +AL++IGD+L+NS +  +++ RE+
Sbjct: 73  ARAVAEDIENVGGDINAATSAEQTSYTARVLGEDVGVALDVIGDILTNSVYEEAELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F+E  + DQ IGRPILG+PETI  F    I ++++R YT
Sbjct: 133 GVILQEHAAVEDTPDDVVYDAFTEAAFPDQPIGRPILGRPETIQGFDRPAIEAYLAREYT 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            DRM +   GAV HE  V+  E +F +       E++ P +Y GGE    R L + +++L
Sbjct: 193 PDRMVLAAAGAVSHEAIVAAAERHFGILPARAAPEAV-PGLYRGGERRMARKLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ A +LG G++SRL+ EVRE RGL Y I A H  FSD G+  I 
Sbjct: 252 GLPGLSFRDEGYYALHLFAQVLGGGLTSRLWHEVRETRGLAYEIHAFHWPFSDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + TA  ++ AL    +  + +    IE  E+ +  A++   L+ + E    R   I++Q+
Sbjct: 312 AGTAGADLSALVEVTIGCLGAAAGAIELAELARAKAQLKVSLLSALETPGGRIERIARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  G ++ +E+II  + A+T + +    + + +  PTLA +GP
Sbjct: 372 LAWGRVIPAEEIIAKVDAVTLDQVRAAGRSVMAGAPTLAAIGP 414


>gi|217977436|ref|YP_002361583.1| peptidase M16 domain protein [Methylocella silvestris BL2]
 gi|217502812|gb|ACK50221.1| peptidase M16 domain protein [Methylocella silvestris BL2]
          Length = 421

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 164/419 (39%), Positives = 250/419 (59%), Gaps = 2/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ RI+   SG+ V+T+ MP +++A + V I AGSR+E + EHG++H LEHM FKGT +R
Sbjct: 1   MSARITTLPSGLRVVTDAMPHLETASLGVWIGAGSRHESRSEHGLSHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I EEIE  GGD+NA TS EHT+Y+A VL E  PLA++I+ D+L+ S+F+  ++ERE
Sbjct: 61  SARAIAEEIEAAGGDLNAATSTEHTAYYAHVLAEDAPLAVDILADILTESTFDKEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG  +D   D +   F+   +  Q IGRPILG P+ I+SF  E I +++  +Y
Sbjct: 121 KGVILQEIGAVDDTPDDLVFDLFNATAFPGQPIGRPILGTPDQIASFGREAIGAYLDSHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            +D   +   GA+DHE    +VE  F+  +      +   AVY GGE   KR L + H++
Sbjct: 181 ASDATVIGAAGAIDHEQICDEVERRFSALAPRAAAAAAPAAVYQGGEIRLKRRLEQAHIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G +Y S +FY   + A+ +G GMSSRLFQEVRE RGL YSI A H  +SD G+   
Sbjct: 241 IGFEGLSYASEEFYALQVFANAVGGGMSSRLFQEVRETRGLAYSIHAFHWGYSDTGLFGF 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT+ +++  L    ++ +     ++ + E  +  A++   L+ + E    R  +I++Q
Sbjct: 301 YAATSAKDVAELMPVALDCLAEAALSLSEDEARRAKAQMKVSLLTALESPSPRCEQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           VM    +L  E+II  I  +   DI     +   S PT+A +G P+  VP    +   L
Sbjct: 361 VMAFDRVLSREEIIGAIDRLDIADIRAAGAQALRSNPTVAAIG-PVSKVPAPDRVAQRL 418


>gi|158423864|ref|YP_001525156.1| mitochondrial processing peptidase-like protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330753|dbj|BAF88238.1| mitochondrial processing peptidase-like protein [Azorhizobium
           caulinodans ORS 571]
          Length = 426

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 255/404 (63%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            ++ +   +GITV+++ MP + +A + + + AG+R+E ++EHG++H LEHM FKGT +R+
Sbjct: 7   GVKTTTLPNGITVVSDAMPHLGTASLGIWVGAGARDEGEQEHGISHLLEHMAFKGTRRRS 66

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I EEIE+VGGDINA TS+E TSY+  VL E V L ++I+ D+L+  +F P ++ RE+
Sbjct: 67  ARRIAEEIEQVGGDINAATSVEQTSYNVRVLGEDVGLGMDILSDILTEPAFAPEELAREK 126

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV+++EIG   D   D +   F E  +  Q +GR ILG P+T+ SF P  + +++ R Y 
Sbjct: 127 NVIVQEIGAVMDTPDDLVFDLFQERAFPGQAVGRSILGTPDTVRSFDPAGLGAYLGRTYR 186

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
             RM V   GAV+H+  V++        +  + K    PA+Y GG  +  RDL + H++L
Sbjct: 187 GPRMVVSAAGAVNHDQLVAEAAERLGTIA-GETKPEAAPALYAGGSILTPRDLEQVHVVL 245

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +Y+   ++   +L++ILG GMSSRLFQ+VRE+RGLCYSI + H +++D G+  I 
Sbjct: 246 GLEGRSYKHPQYHAAQVLSNILGGGMSSRLFQDVREERGLCYSIYSFHWSYADTGIFAIY 305

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T + ++  LT+ +++ +++  E I + E+ +  A++   L+ + E S  RA ++++Q+
Sbjct: 306 AGTDEGDVGELTNVVIDQLEAAGETITETELARAKAQMKVGLLAALESSGARADQLARQL 365

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP 403
           +    I+  E+I+  + A+T + +   A+ + +   PTLA +GP
Sbjct: 366 LAFNRIIPVEEIVAKVEAVTVDAVRQAARDLVAGGRPTLAAIGP 409


>gi|67458730|ref|YP_246354.1| Zn-dependent peptidase [Rickettsia felis URRWXCal2]
 gi|75536810|sp|Q4UML9|Y338_RICFE RecName: Full=Uncharacterized zinc protease RF_0338
 gi|67004263|gb|AAY61189.1| Mpp [Rickettsia felis URRWXCal2]
          Length = 412

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/404 (40%), Positives = 246/404 (60%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  ISK  +G+TV+T  MP +DS  + +  + GSR E  EE G++HFLEHM FKGTT RT
Sbjct: 4   NFNISKLKNGLTVLTYNMPYVDSVAINLITKVGSRYENSEEEGISHFLEHMAFKGTTTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE +++GG  NAYT  E T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AKQIAEEFDEIGGHFNAYTGHEKTIYYARVLSENCDKALNILADIIQNSIFAEEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  S+D+  D +  +F   V+KDQ +G+PILG  +T+SSFT E  +SF+ ++Y 
Sbjct: 124 QVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGKPILGASKTLSSFTKEHFLSFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  +Y+   G VDH+  VS  E  F+     + K +  PA Y+GG     +DL +  ++L
Sbjct: 184 AGNLYLSVAGNVDHDKIVSSAERLFSSLKQGE-KSNFLPAKYIGGNSFINKDLEQTTLIL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G  Y + +  Y T +LA I G GMSSRLFQ +REK GL Y++ +++  +SD+GV  I
Sbjct: 243 GFEGTPYINLERLYRTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSTYSDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   +   +  + E + + E+ +   ++ + L+ +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLYKELKTEITKMTEKVNEEEMIRAKTQLRSNLLMAQEKVAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I+ I  +DI+  A KIFSS  T AI+GP
Sbjct: 363 YAAFGKYIPPEEIMEIITNIKADDIINTANKIFSSITTSAIIGP 406


>gi|329114646|ref|ZP_08243405.1| Putative zinc protease [Acetobacter pomorum DM001]
 gi|326696126|gb|EGE47808.1| Putative zinc protease [Acetobacter pomorum DM001]
          Length = 436

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 158/409 (38%), Positives = 253/409 (61%), Gaps = 3/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + I++  SG+TV+TE M  +++      +  G+R+E  EE+G++HFLEHM FKGTT R+A
Sbjct: 20  INITRLPSGLTVVTERMERVETVSFGAYVATGTRHETAEENGVSHFLEHMAFKGTTSRSA 79

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I EEIE VGG INAYT+ E T Y+  +LKE++ L ++IIGD+L+NS+F+P+++ERER 
Sbjct: 80  LRIAEEIENVGGHINAYTAREQTVYYVKLLKENLGLGVDIIGDILTNSTFDPAEMERERG 139

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F E  + DQ +GRP LG    I   + E ++ ++  +YT 
Sbjct: 140 VILQEIGQANDTPDDVIFDHFQETAFPDQPMGRPTLGTESLIRDMSRETLMRYMKAHYTT 199

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D M V   G + HE  V +V+ +F   S +    ++  A Y GGE+ Q ++L + H++LG
Sbjct: 200 DNMIVAAAGNLHHEDVVQRVQQHFANLSSSSAPVTLS-ARYGGGEFRQVKELDQAHVVLG 258

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F    Y+  D++   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F+D G+  I +
Sbjct: 259 FPSFGYEDPDYFPALLLSTVLGGGMSSRLFQEIREKRGLVYSVYSFNAPFTDGGIFGIYA 318

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T  +    L    +E +  +   + + E+ +  A++ A L+ S E +  R  +I++Q+ 
Sbjct: 319 GTGAKECAELVPVTLEELNKIQRYVTEEELVRARAQLKASLLMSLESTGSRCEQIARQLQ 378

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
             G I+ + + +  I A+   DI   A +IF+ TPTLA LG P++H+P+
Sbjct: 379 IFGRIIPTAETVRKIEAVNAGDICRAASRIFTGTPTLAALG-PIEHIPS 426


>gi|258542754|ref|YP_003188187.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633832|dbj|BAH99807.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636891|dbj|BAI02860.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639944|dbj|BAI05906.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643000|dbj|BAI08955.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646055|dbj|BAI12003.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649108|dbj|BAI15049.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652095|dbj|BAI18029.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655152|dbj|BAI21079.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 421

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 160/413 (38%), Positives = 252/413 (61%), Gaps = 11/413 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + I++  SG+TV+TE M  +++      +  G+R+E  EE+G++HFLEHM FKGTT R+A
Sbjct: 5   INITRLPSGLTVVTERMERVETVSFGAYVATGTRHETAEENGVSHFLEHMAFKGTTSRSA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I EEIE VGG INAYT+ E T Y+  +LKE++ L ++IIGD+L+NS+F+P+++ERER 
Sbjct: 65  LRIAEEIENVGGHINAYTAREQTVYYVKLLKENLGLGVDIIGDILTNSTFDPAEMERERG 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F E  + +Q +GRP LG    I   + E ++ ++  +YT 
Sbjct: 125 VILQEIGQANDTPDDVVFDHFQETAFPNQPMGRPTLGTENLIREMSRETLMRYMKAHYTT 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV----YVGGEYIQKRDLAEEH 237
           D M V   G + HE  V +VE +F     A +  S  PA     Y GGE+ Q ++L + H
Sbjct: 185 DNMIVAAAGNLHHEDVVQRVEQHF-----ANLSSSSAPATLSARYGGGEFRQVKELDQAH 239

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LGF    Y   D++   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F+D G+ 
Sbjct: 240 VVLGFPSFGYGDPDYFPALLLSTVLGGGMSSRLFQEIREKRGLVYSVYSFNAPFTDGGIF 299

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T  +    L    +E +  +   + + E+ +  A++ A L+ S E +  R  +I+
Sbjct: 300 GIYAGTGAKECAELVPVTLEELNKIQRYVTEEELVRARAQLKASLLMSLESTGSRCEQIA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +Q+   G I+ + + +  I A+   DI   A +IF+ TPTLA LG P++H+P+
Sbjct: 360 RQLQIFGRIIPTAETVSKIEAVNAGDICRAASRIFTGTPTLAALG-PIEHIPS 411


>gi|154247453|ref|YP_001418411.1| peptidase M16 domain-containing protein [Xanthobacter autotrophicus
           Py2]
 gi|154161538|gb|ABS68754.1| peptidase M16 domain protein [Xanthobacter autotrophicus Py2]
          Length = 421

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 150/408 (36%), Positives = 257/408 (62%), Gaps = 9/408 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++IS   +G+TVIT+ M  + +A + + + AG+R+E+++EHG++H LEHM FKGT +R
Sbjct: 1   MSVKISVLDNGVTVITDEMSHLGTASLGIWVGAGARDEQEDEHGISHLLEHMAFKGTRRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I EEIE+VGGDINA TS+E T+Y+  VL E V L ++I+ D+L+  +F P ++ERE
Sbjct: 61  SARRIAEEIEQVGGDINAATSVEQTTYNVRVLGEDVGLGIDILADILTEPAFAPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG   D   D +   F E  +  Q +GR ILG P+T+ +F+ +++ +++ R Y
Sbjct: 121 KNVIVQEIGAVMDTPDDLVFDLFQEQAFPGQSVGRSILGTPDTVRAFSRDQLGAYLGRTY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              RM V   GAV+H+  V +      + + A  K  +  A Y GG  +  RDL + H++
Sbjct: 181 RGPRMVVAAAGAVEHDRLVEEAGQRLKIIAPAT-KPELPQATYGGGTRLLARDLEQVHVL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG  GC+++  +++   +LA++LG GMSSRLFQ+VRE RGLCYSI A H ++ D G+  +
Sbjct: 240 LGLEGCSFKDPEYHAVQVLANVLGGGMSSRLFQDVREDRGLCYSIYAFHWSYQDTGLFGV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   ++  L++++++ +    E + + E+ +  A++   L+ + E S  RA ++++Q
Sbjct: 300 YAGTDTGDVEELSNAVIDQILDTAETVTELEVARAKAQMKVGLLAALESSGARADQLARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKK----IFSSTPTLAILGP 403
           ++  G ++  E+I+  + A+   D+ GV +     I    PTL  +GP
Sbjct: 360 ILGFGRVIPVEEIVARVDAV---DVAGVRRAAQGLIGRGRPTLTAIGP 404


>gi|298290606|ref|YP_003692545.1| peptidase M16 domain protein [Starkeya novella DSM 506]
 gi|296927117|gb|ADH87926.1| peptidase M16 domain protein [Starkeya novella DSM 506]
          Length = 428

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 157/423 (37%), Positives = 257/423 (60%), Gaps = 14/423 (3%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+K  SG+TV+T+ MP + +A + +   AGSR+E  +EHG++H LEHM FKGT +R+A+
Sbjct: 10  RITKLDSGVTVVTDAMPHLATASLGIWAGAGSRDEEPDEHGISHLLEHMAFKGTKRRSAR 69

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I EEIE VGGDINA TS+EHT+Y+A VL E VPLA++++ D+L+  +F+P ++ RE NV
Sbjct: 70  AIAEEIEAVGGDINAATSVEHTTYNARVLAEDVPLAIDVLSDILAEPAFDPEELTREHNV 129

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +++EIG + D   D +   F E  +  Q IGR ILG P+++ SF P+++ ++++RNY A 
Sbjct: 130 IVQEIGAALDTPDDLVFDLFQERAFPGQPIGRSILGTPQSVRSFGPDRLRAYLARNYRAP 189

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV----YVGG-EYIQKRDLAEEH 237
           ++ V   GAVDH+  V++V+               KPA     Y GG E    RDL + H
Sbjct: 190 KLIVAAAGAVDHDSIVAEVDRRLG-----GFGREDKPAPVAGHYQGGVEIGGGRDLEQAH 244

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +++G  G +Y+   F+   +  ++LG GMSSRLFQEVRE RGLCY++ + H  ++D G+ 
Sbjct: 245 LLIGLPGLSYRDPGFHALQVFTNVLGGGMSSRLFQEVREARGLCYAVYSFHWGYADTGLF 304

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            + + T   ++  L   +V+ +   ++ + + E+ +  A+    L+ + E S  RA +++
Sbjct: 305 GVYAGTDGGDVDELVDVVVDEIAGAIDTMTEVELARSKAQAKVGLLAALESSGARADQLA 364

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP--PMDHVPTTSEL 414
           +Q++  G  +  E+I+  + A+T E      + + +   PT A LGP  P++     +E 
Sbjct: 365 RQMLAFGRPIPLEEIVAKVEAVTLEGAKAAGRALIARGRPTFAALGPAKPLESAARIAER 424

Query: 415 IHA 417
           + A
Sbjct: 425 LSA 427


>gi|296532606|ref|ZP_06895310.1| possible peptidase [Roseomonas cervicalis ATCC 49957]
 gi|296267066|gb|EFH12987.1| possible peptidase [Roseomonas cervicalis ATCC 49957]
          Length = 421

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 156/402 (38%), Positives = 250/402 (62%), Gaps = 2/402 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R+++  +G+T+++E MP +++  +   + AG+R+E   E+G +HFLEHM FKGT +R A
Sbjct: 5   VRLTRLPNGLTIVSETMPRVETVSIGAYVHAGTRDESAAENGASHFLEHMAFKGTARRDA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I  EIE VGG +NAYT+ E+T+Y+A VLKE +PLA +IIGD+L++S+F P ++ERER 
Sbjct: 65  AAIAREIENVGGHLNAYTARENTAYYAKVLKEDMPLAADIIGDILTHSTFIPEEMERERG 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F    + +Q +GRP LG   T+     E +  ++ R+Y  
Sbjct: 125 VILQEIGQANDTPDDIVFDHFQATAFPEQPMGRPTLGTETTVGGMGREVLTGYMRRHYGP 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM V   GA++HE  V  V  +F    +     + + A Y GGE+ ++RDL + H++LG
Sbjct: 185 SRMVVAAAGALEHEKLVELVGRHFADLPLVSPSPA-ETARYGGGEFREERDLDQVHVVLG 243

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G A  +   Y   +L+++LG GMSSRLFQE+REKRGL YSI +  + F D+G+  + +
Sbjct: 244 FEGPAVATAGHYPAMLLSTLLGGGMSSRLFQEIREKRGLVYSIYSFTQMFRDSGLFALYA 303

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T +E    L    +E ++ +  ++ Q E+D+  A++ A ++ S E +  R  ++++Q+ 
Sbjct: 304 GTGEEQAAELVPVALEELRRVQHDVTQEELDRAKAQLRASVLMSLESTGSRCEQLARQIQ 363

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             G I+  E+    I+A+T + +  VA +IF S PTLA LGP
Sbjct: 364 VHGRIIPVEETKAKIAAVTVDQVQAVAAQIFRSRPTLAALGP 405


>gi|157803431|ref|YP_001491980.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           canadensis str. McKiel]
 gi|157784694|gb|ABV73195.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           canadensis str. McKiel]
          Length = 413

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 156/406 (38%), Positives = 244/406 (60%), Gaps = 3/406 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +S   +G+T++T  MP ++S  + + ++ GSR E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFHVSTLKNGLTILTYNMPYVNSVAINLIVKVGSRYENPEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE +++GG  NAYT  E T Y+A VL E+   AL I+ D++ NS F+  DI +E 
Sbjct: 64  AKQIAEEFDEIGGHFNAYTGHEKTVYYARVLSENCNKALNILADIIQNSIFSEEDIVKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  S+D+  D +  +F   V+KDQ +G+ ILG  +T++SFT E  +SF+ ++Y 
Sbjct: 124 QVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGKSILGTSKTLASFTKEHFLSFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  +Y+   G VDH   V   E  F+      IK S  PA Y+GG    K+DLA+  ++L
Sbjct: 184 ARNLYLSVAGNVDHNKIVCTAEQLFSSLKQG-IKSSFLPAKYIGGNSFIKKDLAQTTLIL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G  Y + +  Y T + A I G GMSSRLFQ +RE+ GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTPYINLERLYRTQLFAIIFGGGMSSRLFQHIRERLGLAYAVGSYNSTYIDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   +   +  + E + + E+ +   ++ + L+ +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLCKELKNEITKMTEKVNEEEMIRAKTQLRSNLLMAQEKVAYKSEEIGKH 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPM 405
               G  +  E+I++ I+ I  +DI+  A KIFS T T AI+GP +
Sbjct: 363 YAAFGKYISPEEIMEIITNIKADDIINTANKIFSGTTTSAIIGPSI 408


>gi|114328918|ref|YP_746075.1| M16 family peptidase [Granulibacter bethesdensis CGDNIH1]
 gi|114317092|gb|ABI63152.1| peptidase, M16 family [Granulibacter bethesdensis CGDNIH1]
          Length = 426

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/417 (36%), Positives = 252/417 (60%), Gaps = 3/417 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R+++  SG+TV+TE M  +++      +  G+R+E   E+G++HFLEHM FKGT +R+A
Sbjct: 10  VRLTRLPSGLTVVTERMERVETVSFGAYVGVGTRHETAAENGVSHFLEHMAFKGTERRSA 69

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EEIE VGG INAYT+ E T+Y+  VLKE+  LA +IIGD+L++S+F+ ++ ERER 
Sbjct: 70  AQIAEEIEAVGGHINAYTAREQTAYYVKVLKENTDLAADIIGDILTHSTFDAAEFERERG 129

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F E  +  Q +GRP LG    I     + +  ++ R+Y A
Sbjct: 130 VILQEIGQANDTPDDIIFDHFQETAFPGQPMGRPTLGTETIIRGLERDAVAGYMRRHYAA 189

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             M V   GA++H+  V  V+ +F     +   ++  PA Y GGE+ + RDL + H++LG
Sbjct: 190 SNMVVAAAGALEHDRIVDLVQQHFADLPASTALDA-SPADYKGGEFRENRDLDQVHIVLG 248

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F   +Y   D++ T +L+++LG GMSSRLFQE+REKRGL YS+      F D G+  I +
Sbjct: 249 FPSVSYADPDYFPTMLLSTLLGGGMSSRLFQEIREKRGLVYSVYTFSLPFLDGGLFGIYA 308

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T ++    L    +  +  +  ++ ++E+ +  A++ A ++ S E +  R  +I++Q  
Sbjct: 309 GTGEQEAKELIPVTLAELLRVQNDVTEQELQRARAQVKASVLMSLESTGSRCEQIARQYQ 368

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
             G ++ + + +  I A+T +D+  VA  +F ++PTLA LG P  HVP  + +  +L
Sbjct: 369 IFGRLVPTSETVAKIDAVTLDDVRRVAAALFRASPTLATLG-PAGHVPDLARISGSL 424


>gi|170748007|ref|YP_001754267.1| processing peptidase [Methylobacterium radiotolerans JCM 2831]
 gi|170654529|gb|ACB23584.1| processing peptidase [Methylobacterium radiotolerans JCM 2831]
          Length = 431

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 162/418 (38%), Positives = 249/418 (59%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           +LR ++  +G+TV+TE MP + +A + V + AGSRNER +E G++H +EHM FKGT  R+
Sbjct: 13  SLRTTRLPNGVTVVTEPMPGVATASLGVWVGAGSRNERADEAGLSHLIEHMAFKGTRTRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I EEIE VGG+INA TS E TSY A VL E   LAL+++GD+L++S F+  ++ RE+
Sbjct: 73  AQKIAEEIENVGGEINAATSTEGTSYTARVLGEDAGLALDVVGDILTDSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F+E  + DQ +GRPILG+PETI SF    I +++ R YT
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFTEAAFPDQPVGRPILGRPETIRSFDEAGIRAYLDREYT 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            DR+ V   GAV HE  V+  E +F     AK   +  P VY GGE    R L + ++++
Sbjct: 193 PDRIVVAGAGAVAHEAIVAAAERHFGALP-AKTAPASVPGVYGGGERRMPRKLEQANVVI 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ A +LG G++SRL+QEVRE RGL Y I A H  FSD G+  I 
Sbjct: 252 GLPGLSFRDERYYALHMFAQVLGGGLTSRLWQEVRETRGLAYEIQAFHWPFSDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + TA  ++  L    +        +++  EI +  A++   L+ + E    R    ++Q+
Sbjct: 312 AGTAGADLPELVDVTLAATARAARDLDATEIARAKAQLKVSLLSALETPGGRIERNARQI 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +  G ++ + ++ID + A+T  D+   A  +   TPTLA +G P+  +P    +  AL
Sbjct: 372 LAWGRVIPAGEVIDKVDAVTVADVRAAAAAMLQGTPTLAAIG-PIRKLPALDRIAGAL 428


>gi|90426267|ref|YP_534637.1| peptidase M16-like [Rhodopseudomonas palustris BisB18]
 gi|90108281|gb|ABD90318.1| peptidase M16-like [Rhodopseudomonas palustris BisB18]
          Length = 429

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 244/404 (60%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K  SG+TV+T+ MP + +A + V    G R+E+ +EHG++H LEHM FKGTTKR
Sbjct: 1   MSVEVTKLPSGLTVVTDTMPHLQTAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EIVEEIE VGGD+NA TS E T+Y+A V+K+ VPLAL+++ D+L+N SF P ++ERE
Sbjct: 61  SSREIVEEIEAVGGDLNAGTSTETTAYYARVMKDDVPLALDVLSDILANPSFVPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q +GR +LG P+T+  F  + +  ++S++Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEHLNELCYPEQPMGRSLLGTPQTLKGFDRDTLQGYLSKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V +V++ F     A     +      GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHQQIVDEVQNRFKSFDAAPAPAPLPALFGPGGSKVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  ++LG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGLPQTDPSLFSLQVFTNVLGGGMSSRLFQEVREKRGLCYSIYTFHAPYTDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVIVDVINDAVETLTEAEISRAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G  L  E+++  I A++ E     A+ + S S P +  LG
Sbjct: 361 MLAYGRPLPVEELVAKIDAVSVESTSKAARALLSRSRPAVVALG 404


>gi|157826939|ref|YP_001496003.1| protease [Rickettsia bellii OSU 85-389]
 gi|157802243|gb|ABV78966.1| protease [Rickettsia bellii OSU 85-389]
          Length = 412

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 152/404 (37%), Positives = 244/404 (60%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G+AHFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGNRYENPEEEGIAHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E T Y++ VL E+   AL II D++ NS+F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHEKTVYYSRVLSENCNKALAIIADIVQNSAFAEEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  ++D+  D +  +F   V+KDQ +G+PILG  +T+ +F  +  + F  ++Y 
Sbjct: 124 QVILQEIAHAQDNPDDLVYEKFYNSVFKDQPLGKPILGTSKTLETFNRDHFLKFTGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+  Y+   G VDHE  V + E  F+  +  + K +  PA Y+GG     +DL +  ++L
Sbjct: 184 AENFYLSIAGNVDHEEIVKEAERLFSSLTQGE-KSNFSPAKYIGGHSFINKDLEQTTLIL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T +LA I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEMLYQTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSPYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L + +   ++ + E ++Q EI++   +I + L  +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLAAELKNEIKRMAEQVKQEEIERARTQIRSNLQMAQEKVAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I  I   DI+  A +IFSS+ T A++GP
Sbjct: 363 YAVFGKYISPEEIMEIIMNIKAADIIQTANRIFSSSATSAVIGP 406


>gi|91205337|ref|YP_537692.1| protease [Rickettsia bellii RML369-C]
 gi|122425770|sp|Q1RJ61|Y522_RICBR RecName: Full=Uncharacterized zinc protease RBE_0522
 gi|91068881|gb|ABE04603.1| protease [Rickettsia bellii RML369-C]
          Length = 412

 Score =  299 bits (766), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 153/404 (37%), Positives = 243/404 (60%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + GSR E   E G+AHFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGSRYENPGEEGIAHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E T Y++ VL E+   AL II D++ NS+F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHEKTVYYSRVLSENCNKALAIIADIVQNSAFAEEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  ++D+  D +  +F   V+KDQ +G+PILG  +TI +F  +  + F  ++Y 
Sbjct: 124 QVILQEIAHAQDNPDDLVYEKFYNSVFKDQPLGKPILGTSKTIETFNRDHFLKFTGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+  Y+   G VDHE  V + E  F+  +  + K +  PA Y+GG     +DL +  ++L
Sbjct: 184 AENFYLSIAGNVDHEEIVKEAERLFSSLTQGE-KSNFSPAKYIGGHSFINKDLEQTTLIL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T +LA I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLERLYQTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSPYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L + +   ++ + E ++Q EI++   +I + L  +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLAAELKNEIKRMAEQVKQEEIERARTQIRSNLQMAQEKVAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I  I   DI+  A +IFSS+ T A++GP
Sbjct: 363 YAVFGKYISPEEIMEIIMNIKAADIIQTANRIFSSSATSAVIGP 406


>gi|209966889|ref|YP_002299804.1| Peptidase, M16 family [Rhodospirillum centenum SW]
 gi|209960355|gb|ACJ00992.1| Peptidase, M16 family [Rhodospirillum centenum SW]
          Length = 419

 Score =  298 bits (764), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 152/403 (37%), Positives = 241/403 (59%), Gaps = 2/403 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R++   +G+ V T+ MP + +A V V I  GSR+E +  +G+AH +EHMLFKGT +R 
Sbjct: 3   GVRVTTLPNGLRVATDPMPGVQTASVGVWIGVGSRHEPEAANGVAHLVEHMLFKGTDRRD 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I  EIE VGG +NAYT  EHT+Y+A VLKE V LAL+++ DM+ +S F+P+D+++ER
Sbjct: 63  AFRISAEIEDVGGHLNAYTGREHTTYYAKVLKEDVALALDLLADMIQHSRFDPADLDKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VV++EIG +ED   D +   +    ++ Q +GRPILG  E +++   E +  +V+ NYT
Sbjct: 123 QVVIQEIGQAEDTPDDIIYDHWLATAFRGQALGRPILGTAEVVAALPREALTGYVAANYT 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  M V   G V+H+  V  V   F        + +++   + GG++ + RDL + H++L
Sbjct: 183 AANMVVAAAGNVEHDRVVDLVARLFGGLPAGTAQSAVR-VDWNGGDFREDRDLEQLHILL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF+G      D+Y + +L+++LG GMSSRLFQEVREKRGL YS+ +     +D GV  I 
Sbjct: 242 GFDGVPLPDPDYYASQVLSTLLGGGMSSRLFQEVREKRGLVYSVHSFAWPMTDAGVFGIY 301

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T  E    L   + + V+++   +   E+ +  A++ A  + S E +  RA +++  +
Sbjct: 302 AGTGPERTEELVPVVCDQVRAIANGLSPEEVTRARAQLKASQLMSLESTTNRAEQLAHAL 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +     +  E+II  + A+  + +  VA +IF S P LA LGP
Sbjct: 362 LVFDRPVPPEEIIARVDAVDADALRRVAARIFGSRPVLAALGP 404


>gi|254465329|ref|ZP_05078740.1| Zn-dependent peptidase family protein [Rhodobacterales bacterium
           Y4I]
 gi|206686237|gb|EDZ46719.1| Zn-dependent peptidase family protein [Rhodobacterales bacterium
           Y4I]
          Length = 420

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 159/408 (38%), Positives = 245/408 (60%), Gaps = 3/408 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++    ++G  +++E MP ++SA V + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVQQHTLANGFRIVSEHMPGLESAAVGIWVTAGGRHERLEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I EEIE VGG INAYTS E T+Y+A VLK+ VPLA+++IGD+L N  F+  +IE E
Sbjct: 61  SALQIAEEIEDVGGYINAYTSREVTAYYARVLKDDVPLAVDVIGDILLNPVFDQREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E  ++ Q +GR ILG  E + SF+ E +  FVS +Y
Sbjct: 121 RGVILQEIGQSLDTPDDVIFDWLQEESYRGQPLGRTILGPAERVRSFSREDLEGFVSEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   G VDH+  V   E  F   + AK   + + A + GGE  Q +DL + H  
Sbjct: 181 GPGQMILAAAGGVDHDALVRLAEQLFGHMA-AKPDFTAEGATFTGGEARQVKDLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+ +  Y   I AS LG GMSSRLFQEVREKRGLCY+I +   +++D G + +
Sbjct: 240 LAFEGPGYRDQSMYTAQIYASALGGGMSSRLFQEVREKRGLCYTIFSQAGSYADTGSMTV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++   +++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGEQLAELAGITIDEMKRAADDMSDAEVERARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMD 406
           V   G +   E+ I+ I A+T +D+  +A+ +  + P  LA+ GP  D
Sbjct: 360 VQIWGKVPSLERTIERIDAVTTKDVRTLAEAMAVTAPAALALYGPVAD 407


>gi|83312488|ref|YP_422752.1| Zn-dependent peptidase [Magnetospirillum magneticum AMB-1]
 gi|82947329|dbj|BAE52193.1| Predicted Zn-dependent peptidase [Magnetospirillum magneticum
           AMB-1]
          Length = 420

 Score =  296 bits (757), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 143/404 (35%), Positives = 256/404 (63%), Gaps = 6/404 (1%)

Query: 3   LRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++ +SG+ ++T+ M  +++  + V + AG+R+E  E +G++H LEHM FKGT +R+A
Sbjct: 4   IRETRLNSGLKIVTDPMDTVETVSLGVWVDAGTRHEPAEINGVSHLLEHMAFKGTARRSA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EE++ VGG +NAYT+ +HT+Y+A VLKE   LAL+II D+L NS+    ++ RE+ 
Sbjct: 64  LDIAEEMDAVGGHLNAYTARDHTAYYAKVLKEDAALALDIISDILQNSTLEAEELGREQA 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV++EI  + D   D +   F    + DQ +GRP+LG  E + + + ++++ ++  NY+A
Sbjct: 124 VVVQEINQAIDTPDDIIFDHFQATAYPDQPLGRPVLGSEELVRAMSRDQVMGYLRGNYSA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSV--AKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            RM +   G +DH+  V+   + F+      A + +  +   YVGG+Y ++RDL + H++
Sbjct: 184 PRMVLSASGRIDHDHLVAAAGAAFSQLPPHHAAVTDQAR---YVGGDYREERDLEQVHVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF+G AY   D+Y  ++L+++LG GMSSRLFQEVREKRGL YSI +   +++D G+  +
Sbjct: 241 VGFDGVAYDDPDYYSASVLSTLLGGGMSSRLFQEVREKRGLVYSIYSFASSYNDGGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T ++ +  L   + + +  +   + + E+ +  A++ A ++ S E +  R  ++++Q
Sbjct: 301 YAGTGEDEVAELIPVMCDEIVKVCGGVNEPEVQRARAQLKASILMSLESTTSRCEQLARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           V+  G  +   ++++ + AIT ED   VA+++F+ TPT A +GP
Sbjct: 361 VVIYGRPVPVAEVVEKVEAITAEDCARVARRLFAGTPTFAAIGP 404


>gi|91975303|ref|YP_567962.1| peptidase M16-like [Rhodopseudomonas palustris BisB5]
 gi|91681759|gb|ABE38061.1| peptidase M16-like [Rhodopseudomonas palustris BisB5]
          Length = 429

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 151/404 (37%), Positives = 244/404 (60%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ +SK  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT+R
Sbjct: 1   MSVEVSKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+++I EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N SF   ++ERE
Sbjct: 61  TSRDIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPSFAADELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q IGR +LG  +T+ SF  +K+ S++S +Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKSFNRDKLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V +V   F     A   +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHKRVVEEVSHRFASFDAAPAPKPQPAMFGAGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G     +  +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGLPQSDKSLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYTDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T  ++   +   IV+V+   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPDDAPEMMEVIVDVINDAVETLTDAEIARAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G  L  ++++  I A++ +    VA+++ S S P +  LG
Sbjct: 361 ILAYGRPLSVDELVAKIDAVSIDTTRHVARELLSRSRPAVVALG 404


>gi|144899407|emb|CAM76271.1| Zn-dependent peptidases [Magnetospirillum gryphiswaldense MSR-1]
          Length = 420

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 141/404 (34%), Positives = 260/404 (64%), Gaps = 4/404 (0%)

Query: 2   NLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+T+ M  ++SA + + + AG+R+E  E +G++H LEHM FKGT +R+
Sbjct: 3   GVRETTLPSGLRVLTDPMDTVESASLGLWVDAGTRHEPAEINGISHLLEHMAFKGTERRS 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I EE++ VGG +NAYT+ +HT+Y+A VLKE   LAL+I+ D+L NS+ +  ++ RE+
Sbjct: 63  ARAIAEEMDAVGGHLNAYTARDHTAYYAKVLKEDSALALDILADILQNSTVDAEELAREQ 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VV++EI  S D   D +   F    + DQ +GRP+LG  E + + + + ++ +++ +Y+
Sbjct: 123 AVVVQEINQSFDTPDDIIFDHFQTTAFPDQPLGRPVLGTEELVRAMSRDTVLGYMATHYS 182

Query: 181 ADRMYVVCVGAVDHEFCVSQV-ESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           A RM +   G +DH+  V    +++ ++ + A +  +  PA+Y GGEY ++RD+ + +++
Sbjct: 183 APRMVLSAAGRIDHDQLVELAGKAFADLPTAADVMPA--PALYKGGEYREERDIEQVNLV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG+ G +Y   D+Y  ++L+++LG GMSSRLFQE+REKRGL YSI +   +++D G+  I
Sbjct: 241 LGYGGVSYDDPDYYTASVLSTLLGGGMSSRLFQEIREKRGLVYSIYSFASSYADGGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T ++ +  L   + + V  + + ++  E+ +  A++ A ++ S E +  R  ++++Q
Sbjct: 301 YAGTGEDEVEELVPVLCDEVVKITQGVDADELQRARAQLKASILMSLESTSSRCEQLARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           V+  G  + +++++D + AI    I  VA+++F++ PT+A +GP
Sbjct: 361 VLVYGRPIPTQEVVDKVEAIDGAQIARVARRLFATPPTIAAIGP 404


>gi|316932384|ref|YP_004107366.1| processing peptidase [Rhodopseudomonas palustris DX-1]
 gi|315600098|gb|ADU42633.1| processing peptidase [Rhodopseudomonas palustris DX-1]
          Length = 429

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 152/405 (37%), Positives = 244/405 (60%), Gaps = 4/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +SK  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT+R
Sbjct: 1   MTVEVSKLPSGLTVVTDTMPHLETASLGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EI EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N SF   ++ERE
Sbjct: 61  SSREIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPSFEAEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG S+D   D +    +E+ + +Q IGR +LG  +T+ +F+ EK+ S++S +Y
Sbjct: 121 KSVIVQEIGASQDTPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKNFSREKLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY-VGGEYIQKRDLAEEHM 238
               M V   GAVDH   V +V   F     +   +  +PA++  GG  +  RDL + H+
Sbjct: 181 RGPDMVVAAAGAVDHARIVEEVSHRFASFDASPAPKP-QPAMFGAGGSRVVHRDLEQAHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G    +   +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  +SD G   
Sbjct: 240 TLALEGLPQGAPTLFSMQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYSDTGFFG 299

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + + T   +   +   IV+V+   ++ +   EI +  A++ A L+ + E    RA ++++
Sbjct: 300 LYTGTDPADAPEMMEVIVDVINDAVDTLTDAEISRAKAQMKAGLLMALESCSSRAEQLAR 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
            ++  G  L  ++++  I A+T +      + + S S P +  LG
Sbjct: 360 HILAYGRPLPVDELVGRIDAVTIDTAREAGRTLLSRSRPAVVALG 404


>gi|27376293|ref|NP_767822.1| mitochondrial processing peptidase-like protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27349433|dbj|BAC46447.1| mitochondrial processing peptidase-like protein [Bradyrhizobium
           japonicum USDA 110]
          Length = 429

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/404 (37%), Positives = 240/404 (59%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ISK +SG+TV+T+ MP +++A + V    G R+E+  EHG++H LEHM FKGTTKR
Sbjct: 1   MSVEISKLASGLTVVTDKMPHLETAALGVWAGVGGRDEKPNEHGISHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EIVEEIE VGGD+NA TS E TSY+A VLK  VPLAL+++ D+L+N +F P ++ERE
Sbjct: 61  SSREIVEEIEAVGGDLNAGTSTETTSYYARVLKADVPLALDVLADILANPAFEPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG ++D   D +    +E+ + DQ +GR +LG  +T+ +F  + +  ++S +Y
Sbjct: 121 KNVIVQEIGAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTAKTLRAFNRDMLRGYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V++ E  F         +        GG  +  R+L + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHSQVVAEAEKRFASFEGTPGPKPQAAQFGKGGAKVVHRELEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVREKRGLCYSI + H  ++D G   +
Sbjct: 241 LALEGVPQNDLSLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYSFHAPYTDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVVVDVMNDSVETLTEAEIARAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           V+  G     ++++  I A++ E     A+ + S S P +  LG
Sbjct: 361 VLAYGRPQTVQELVARIDAVSVESTRDAARALLSRSRPAVVALG 404


>gi|39933917|ref|NP_946193.1| putative protease [Rhodopseudomonas palustris CGA009]
 gi|192289336|ref|YP_001989941.1| peptidase M16 domain protein [Rhodopseudomonas palustris TIE-1]
 gi|39647764|emb|CAE26284.1| putative protease [Rhodopseudomonas palustris CGA009]
 gi|192283085|gb|ACE99465.1| peptidase M16 domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 429

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/405 (37%), Positives = 243/405 (60%), Gaps = 4/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +SK  SG+T++T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT+R
Sbjct: 1   MTVEVSKLPSGLTIVTDTMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T++EI EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N SF   ++ERE
Sbjct: 61  TSREIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPSFEAEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q IGR +LG  +T+ SF+ EK+ S++S +Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKSFSREKLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY-VGGEYIQKRDLAEEHM 238
               M V   GAVDH   V +V   F         +  +PA++  GG  +  RDL + H+
Sbjct: 181 RGPDMVVAAAGAVDHARIVEEVSHRFASFDGTPAPKP-QPAMFGAGGSRVVHRDLEQAHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G    +   +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  +SD G   
Sbjct: 240 TLALEGLPQSAPTLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYSDTGFFG 299

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + + T   +   +   IV+V+   ++ +   EI +  A++ A L+ + E    RA ++++
Sbjct: 300 LYTGTDPADAPEMMEVIVDVINDAVDTLTDAEISRAKAQMKAGLLMALESCSSRAEQLAR 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
            ++  G  L  ++++  I A+T +      + + + S P +  LG
Sbjct: 360 HILAYGRPLPVDELVGRIDAVTIDTAREAGRTLLARSRPAVVALG 404


>gi|299134062|ref|ZP_07027255.1| processing peptidase [Afipia sp. 1NLS2]
 gi|298590809|gb|EFI51011.1| processing peptidase [Afipia sp. 1NLS2]
          Length = 429

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/384 (39%), Positives = 237/384 (61%), Gaps = 3/384 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + I+K  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGT  R
Sbjct: 1   MAVEITKLPSGLTVVTDAMPHLETAALGVWTGVGGRDEKLDEHGISHLLEHMAFKGTASR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T++EIVE+IE VGGD+NA TS E T+Y+A V+K  VPLA++++ D+L+N SF+  ++ERE
Sbjct: 61  TSREIVEQIEAVGGDLNAATSSESTAYYARVMKADVPLAIDVLSDILANPSFDTDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG + D   D +     E+ + DQ +GR +LG PET+++FT +K+  +++ +Y
Sbjct: 121 KSVIVQEIGAAMDTPDDAVFEYLGELAYPDQPMGRSLLGTPETLATFTRDKLRGYLTTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY-VGGEYIQKRDLAEEHM 238
               M V   GA+DH   V+ VE  F      +  +S KPAV+  GG  + +RDL + H+
Sbjct: 181 RGPDMVVAASGAIDHRRIVADVEQRFAGFGADEGPKS-KPAVFGKGGSRVVRRDLEQAHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G        +   +  +ILG GMSSRLFQEVREKRGLCYSI   H+ +SD G   
Sbjct: 240 TLALEGIPQSDPALFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHQPYSDTGFFS 299

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + + T   +   +   IV+ +   +E + + EI +  A++ A L+ + E    RA ++++
Sbjct: 300 LYTGTDPTDAPEMMEVIVDEMNEAVETLTEAEIARAKAQMKAGLLMALESCSARAEQLAR 359

Query: 359 QVMFCGSILCSEKIIDTISAITCE 382
            V+  G  L  E++I  I  ++ E
Sbjct: 360 HVLAYGRPLSIEEMIARIDNVSVE 383


>gi|115526748|ref|YP_783659.1| peptidase M16 domain-containing protein [Rhodopseudomonas palustris
           BisA53]
 gi|115520695|gb|ABJ08679.1| peptidase M16 domain protein [Rhodopseudomonas palustris BisA53]
          Length = 429

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 153/406 (37%), Positives = 246/406 (60%), Gaps = 6/406 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K +SG+TV+T+ MP +++A + V    G R+ER  EHG++H LEHM FKGT  R
Sbjct: 1   MSVEVTKLASGLTVVTDHMPHLETAALGVWTGVGGRDERPNEHGISHLLEHMAFKGTLTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EIVEEIE VGGD+NA TS E T+Y+A VLK  VPLAL+++ D+L+N +F P ++ERE
Sbjct: 61  SSREIVEEIEAVGGDLNAATSTETTAYYARVLKADVPLALDVLSDILANPAFEPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q +GR +LG P+T+ +F  + + S++S +Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEYLNELCYPEQPMGRSLLGTPQTLKAFDRDTLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-KPAVY-VGGEYIQKRDLAEEH 237
               M V   GAVDH+  V +V   F   S    K  + +PA++  GG  +  RDL + H
Sbjct: 181 RGPEMVVSAAGAVDHKQVVEEVTRRF--ASFQNHKAPLPQPAMFGAGGTKVVHRDLEQAH 238

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + L   G        +   +  + LG GMSSRLFQEVREKRGLCYSI   H  +SD G  
Sbjct: 239 LTLALEGLPQLDPSLFSLQVFTNALGGGMSSRLFQEVREKRGLCYSIYTFHAPYSDTGFF 298

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            + + T  E+   +   IV+V+   ++ + + E+ +  A++ A L+ + E    RA +++
Sbjct: 299 GLYTGTDPEDAPEMMEVIVDVIGETVDTLTEAEVARAKAQMKAGLLMALESCSSRAEQLA 358

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           + +M  G  L + ++I  I A++ E      + +   S P +A LG
Sbjct: 359 RHMMAYGRPLPAAELIARIEAVSVESAGKAGRALLERSRPAVAALG 404


>gi|259418020|ref|ZP_05741939.1| Peptidase M16 inactive domain family protein [Silicibacter sp.
           TrichCH4B]
 gi|259346926|gb|EEW58740.1| Peptidase M16 inactive domain family protein [Silicibacter sp.
           TrichCH4B]
          Length = 420

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 161/416 (38%), Positives = 244/416 (58%), Gaps = 4/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++     +G  ++TE MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKQDTLPNGFRIVTEYMPGLQSAALGIWVSAGGRHERLEQNGVAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VLK+ V LAL++IGD++ NS F+  +IE E
Sbjct: 61  TALQIAEAIEDVGGYINAYTSREVTAYYARVLKDDVDLALDVIGDIVLNSVFDEREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  ++DQ IGR ILG  E + SFT E +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEESYRDQAIGRSILGPAERVRSFTKEDLRRFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V      F      K ++ ++ A +VGGE  + + L + H+ 
Sbjct: 181 GPGQMILSAAGAVDHDRLVKAATEMFGDLE-PKQQDVVETASFVGGEARRDKALEQAHVA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F   +Y++ D Y   I A+ LG GMSSRLFQEVREKRGLCY+I +    + D G++ I
Sbjct: 240 LAFESPSYRADDIYTAQIYAAALGGGMSSRLFQEVREKRGLCYTIFSQAGAYEDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + TA E +  L    V+ ++   +++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTAGEQVADLVGITVDELKRAADDMSDAEVERARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSEL 414
           V     +   E  ++ I A+T  D+  +A +I    P  LA+ GP  D  P+  E+
Sbjct: 360 VQIWDRVPSLEATVEKIDAVTTADVRAMAAQIAREAPAALALYGPVAD-APSLEEI 414


>gi|126737273|ref|ZP_01753008.1| peptidase, M16 family protein [Roseobacter sp. SK209-2-6]
 gi|126721858|gb|EBA18561.1| peptidase, M16 family protein [Roseobacter sp. SK209-2-6]
          Length = 420

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/415 (37%), Positives = 239/415 (57%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+LR     +G  +++E +P + SA + + + AG RNER E++G+AHFLEHM FKGT KR
Sbjct: 1   MSLRQDTLPNGFRIVSEDIPGLQSASIGIWVTAGGRNERLEQNGIAHFLEHMAFKGTKKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E +E VGG INAYTS E T+Y+A VLK+ VPLAL+++ D+L N  F+P +IE E
Sbjct: 61  SALQIAEAVEDVGGYINAYTSREVTAYYARVLKDDVPLALDVLADILLNPVFDPHEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  +++Q +GR ILG  E +S+F+ + +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEESYRNQPLGRTILGPAERVSAFSRDDLTQFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V      F     ++   +M+PA + GGE  Q++ L + H  
Sbjct: 181 GPEQMILSASGAVDHDALVKMAGDLFGGMK-SRPALAMEPARFTGGEARQEKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I A I+G GMSSRLFQEVREKRGLCY+I A     +D G   I
Sbjct: 240 LSFESPGYRDDAIYTAQIYAGIMGGGMSSRLFQEVREKRGLCYTIFAQAGAHADTGCTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++   E+++  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEQLAELAHITVDEMKRAAEDLSDAEVERARAQMKAGLLMGLESPTNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V   G +   E  +  I A+  ED+  +A+K+    P    L  P+   P  + L
Sbjct: 360 VQIWGRVPSLEDTVRLIDAVQNEDVRALAEKLALQAPVAMALYGPVSGAPDLTAL 414


>gi|86751675|ref|YP_488171.1| peptidase M16-like [Rhodopseudomonas palustris HaA2]
 gi|86574703|gb|ABD09260.1| Peptidase M16-like [Rhodopseudomonas palustris HaA2]
          Length = 429

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/405 (36%), Positives = 244/405 (60%), Gaps = 4/405 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ +SK  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTTKR
Sbjct: 1   MSVEVSKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           ++++I EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N  F   ++ERE
Sbjct: 61  SSRDIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPVFEAEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q IGR +LG  +T+  F  +K+ S+++ +Y
Sbjct: 121 KSVIVQEIGAAQDMPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKGFNRDKLQSYLATHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY-VGGEYIQKRDLAEEHM 238
               M V   GAVDH+  V +V   F         +  +PA++  GG  +  RDL + H+
Sbjct: 181 RGPDMVVAAAGAVDHKRVVEEVSHRFASFDATPAPKP-QPAMFGAGGSRVVHRDLEQAHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G     +  +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  ++D G   
Sbjct: 240 TLALEGLPQSDKSLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYADTGFFG 299

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + + T  ++   +   IV+V+   +E +   EI +  A++ A L+ + E    RA ++++
Sbjct: 300 LYTGTDPDDAPEMMEVIVDVINDAVETLTDAEIARAKAQMKAGLLMALESCSSRAEQLAR 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
            V+  G  L  ++++  I A++ E     A+ + + S P +  LG
Sbjct: 360 HVLAYGRPLSVDELVGKIDAVSIETTRQAARDLLTRSRPAVVALG 404


>gi|296115095|ref|ZP_06833736.1| processing peptidase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978196|gb|EFG84933.1| processing peptidase [Gluconacetobacter hansenii ATCC 23769]
          Length = 421

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/412 (38%), Positives = 249/412 (60%), Gaps = 5/412 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + +++  SG+TV+TE M  +++A     + AG+ +E   E+G++HFLEHM FKGT  RTA
Sbjct: 5   INVTRLPSGLTVVTERMERVETASFGAYVAAGTCHEDARENGVSHFLEHMAFKGTATRTA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I EEIE VGG INAYT+ EHT+Y+  +LKE +PL ++IIGD+L++SSF P ++ERER 
Sbjct: 65  AGIAEEIENVGGHINAYTAREHTAYYVKLLKEDLPLGVDIIGDILTHSSFAPDELERERG 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F E  + +Q +GRP LG    I   T + +++++  +YTA
Sbjct: 125 VILQEIGQANDTPDDIVFDHFQETAFPNQPMGRPTLGTEGGIREMTRKTLMTYMRTHYTA 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-YVGGEYIQKRDLAEEHMML 240
               +   G + H+  V  VE +F       I     P V YVGGE+ Q+R+L + H++L
Sbjct: 185 RNTIIAAAGNLHHDAVVEMVEKHFRDLPQTDIPPC--PGVTYVGGEFAQRRELDQAHIVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF    Y   D+Y T +L+++LG GMSSRLFQE+REKRGL YS+ + +  F   G+  I 
Sbjct: 243 GFPSVGYGDPDYYPTLLLSTLLGGGMSSRLFQEIREKRGLVYSVYSFNAPFRQGGLFGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T +  +  L    +E ++ +   + Q E+D+  A++ + L+ S E +  R  ++++Q+
Sbjct: 303 AGTGESQVADLIPVTLEELRKVQGQVAQNELDRARAQLKSSLLMSLESTGSRCEQLARQL 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTS 412
                ++   + +  I A+T  D+  VA ++F  TPTL  LG P+ H+P  +
Sbjct: 363 QIFDRLVPIHETVQRIDAVTIADVQRVAARVFHGTPTLTSLG-PVRHMPPVA 413


>gi|126733556|ref|ZP_01749303.1| peptidase, M16 family protein [Roseobacter sp. CCS2]
 gi|126716422|gb|EBA13286.1| peptidase, M16 family protein [Roseobacter sp. CCS2]
          Length = 422

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/416 (36%), Positives = 244/416 (58%), Gaps = 2/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +++   S+G  ++TE MP + SA + + ++AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTIQLHTLSNGFRIVTEDMPGLKSASIGIWVQAGGRHERVEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL++   L L++I D+L N  F+P++IE E
Sbjct: 61  SALQIAESIEDVGGYINAYTSREMTAYYARVLEDDTTLGLDVISDILLNPVFDPAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E+ + DQ +GR ILG  E +SSF+ + +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEVAYPDQALGRTILGPSERVSSFSRDDLQRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             ++M +   GA+DH+  ++Q E+ F ++ +VA+  + M+PA + GGE  + +DL + H 
Sbjct: 181 GPNQMILSAAGAIDHDAVIAQAEALFGHLPAVARAPDLMQPAAFGGGERRENKDLEQVHF 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G  Y     Y   I A+ +G GMSSRLFQE+RE RGLCY+I A    + D G+  
Sbjct: 241 ALALEGPTYLDPAIYTAQIYANAMGGGMSSRLFQEIRENRGLCYTIFAQAGAYEDTGLTT 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I + T+ E I  L +  ++ ++   +++   E+ +  A++ A L+   E    RA  +++
Sbjct: 301 IYAGTSAEQIGELANITIDEMKRAADDMSAAEVARARAQMKAGLLMGLESPSNRAERLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
            +   G I   ++ I+ I  +T  D+  +A ++     T   L  P +  PT   L
Sbjct: 361 LLSIWGRIPSIDETIEHIDDVTTGDVKDLAGQMAGQAGTALALYGPAEAAPTLDAL 416


>gi|310815265|ref|YP_003963229.1| peptidase, M16 family protein [Ketogulonicigenium vulgare Y25]
 gi|308754000|gb|ADO41929.1| peptidase, M16 family protein [Ketogulonicigenium vulgare Y25]
          Length = 421

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/416 (38%), Positives = 244/416 (58%), Gaps = 3/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++I   S+G  + TEVMP + SA + + + AG R+E  +E+G+AHFLEHM FKGT  R
Sbjct: 1   MTVQIHTLSNGFRIATEVMPGLQSATIGIWVSAGGRHEAPQENGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL     LAL+I+ D+L N +F+ ++IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSRETTAYYARVLSGDTALALDIVADILLNPTFDLNEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E+ ++DQ IGR ILG  E +SSF    +  FV+++Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEVCYQDQAIGRSILGPAERVSSFQQADLRRFVAQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ-KRDLAEEHM 238
           T ++M +   G VDH+  V Q ES F     A    +++PA +  GE  + K+ L + H 
Sbjct: 181 TPEQMILCAAGGVDHDAIVRQAESLFGHLPPANRLSAIEPARFTVGERREIKKSLEQVHF 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G   ++ D Y   + ++ LG GMSSRLFQEVREKRGLCY+I A      D G   
Sbjct: 241 ALAIEGPGVRASDIYTAQLWSTALGGGMSSRLFQEVREKRGLCYTIFAQTGASEDTGATT 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I + T+ E I+ L+   +  +    +++ Q E+D+  A++ A L+  QE S  RA  +++
Sbjct: 301 IYAGTSSEQILDLSRITMTELARAADDLSQAELDRARAQMKAGLLMGQESSSNRAERLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
            +   G +    + +  I A+   ++ G A ++ ++  +LA+ G P D  P+ ++L
Sbjct: 361 MLALWGRVPDLSEAVAKIDAVNLSELRGFAAQMAAAPMSLALYG-PADQAPSLADL 415


>gi|146343463|ref|YP_001208511.1| putative zinc protease (mpp-like) [Bradyrhizobium sp. ORS278]
 gi|146196269|emb|CAL80296.1| putative zinc protease (mpp-like) [Bradyrhizobium sp. ORS278]
          Length = 429

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 145/404 (35%), Positives = 238/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++K  +G+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MGVEVTKLPTGLTVVTDTMPHLETAALGVWAGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EIVE IE VGGD+NA TS E T+Y+A VLK  VPLAL+++ D+L+N SF P ++ERE
Sbjct: 61  SAREIVEAIEAVGGDLNAGTSTETTAYYARVLKADVPLALDVLSDILANPSFVPEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG ++D   D +    +E+ + DQ +GR +LG  +T+ +F  +K+  ++S +Y
Sbjct: 121 KNVIVQEIGAAQDTPDDVVFEHLNELCFPDQPMGRSLLGTAKTLEAFDRDKLHGYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V  V   F   +  +  +    A   GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHHRVVEDVSRRFASFNGGEGPKPQPAAFGKGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVRE RGLCYS+   H  +SD G   +
Sbjct: 241 LALEGVPQADPSLFSLQVFTNILGGGMSSRLFQEVRENRGLCYSVYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+++ + +E + + E+ +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVVVDIIGNAVETLSEAEVARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G     ++++  I A++ E     A+ + + S P +  LG
Sbjct: 361 ILAYGRPQTLQEMVAKIEAVSVESTRDAARALLARSKPAVVALG 404


>gi|188582690|ref|YP_001926135.1| processing peptidase [Methylobacterium populi BJ001]
 gi|179346188|gb|ACB81600.1| processing peptidase [Methylobacterium populi BJ001]
          Length = 431

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 150/423 (35%), Positives = 244/423 (57%), Gaps = 11/423 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L +S+  +G+TV TE +P + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  GLTVSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+
Sbjct: 73  ARKIAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y 
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYV 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV----YVGGEYIQKRDLAEE 236
            +RM +   GAV+H   V   E +F       +K    PAV    Y GGE   ++ L + 
Sbjct: 193 PERMVLAAAGAVEHAEIVEAAERHFG-----GLKSVEAPAVVAGIYGGGERRMQKRLEQA 247

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           +++LG  G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  FSD G+
Sbjct: 248 NLVLGLPGLSFRDEGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFSDCGL 307

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
             I + T+  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    
Sbjct: 308 FGIGAGTSGADLAELVDVTIATTRETAERLDAAELARAKAQLKVSLLTALETPGGRIERN 367

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIH 416
           ++Q++  G ++  +++I  + A+  E +    + +    PTLA +G P+  +P    +  
Sbjct: 368 ARQLLAWGRVIPPQELIAKVDAVEIEHVRAAGRTLLQGAPTLAAIG-PVKGLPPLPRVAA 426

Query: 417 ALE 419
           AL+
Sbjct: 427 ALQ 429


>gi|86137974|ref|ZP_01056550.1| peptidase, M16 family protein [Roseobacter sp. MED193]
 gi|85825566|gb|EAQ45765.1| peptidase, M16 family protein [Roseobacter sp. MED193]
          Length = 420

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/415 (36%), Positives = 240/415 (57%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++  + ++G  +++E MP + SA + + + AG RNER E++G+AHFLEHM FKGT +R
Sbjct: 1   MSVQQHQLANGFRIVSEAMPGLQSASIGIWVTAGGRNERLEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E +E VGG INAYTS E T+Y+A VLK+ VPLAL+++ D+L N  F+P +IE E
Sbjct: 61  SALQIAEAVEDVGGYINAYTSREVTAYYARVLKDDVPLALDVLADILRNPVFDPHEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ +GR ILG  E +S+F  E +  FVS +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEQSYHDQPLGRTILGPAERVSAFNREDLTQFVSEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH   V   E  F   + A+    M+PA + GGE    +DL + H  
Sbjct: 181 GPGQMILSAAGAVDHAALVKLAEDLFGDMT-ARPSLVMEPAQFTGGEARHVKDLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I ++++G GMSSRLFQEVREKRGLCYSI A     +D G   I
Sbjct: 240 LSFESPGYRDEAIYTAQIYSAVMGGGMSSRLFQEVREKRGLCYSIFAQAGAHADTGSTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L    V+ ++    ++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGDQVEELAHITVDEMKRAASDMSDAEVERARAQMKAGMLMGLESPTNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V     +   ++ +  I A++ ED+  +A+ +    P+   L  P++  P+ + L
Sbjct: 360 VQIWDRVPALDETVKLIDAVSTEDVRAMAELLAVKAPSAMALYGPVEGAPSLTAL 414


>gi|218531509|ref|YP_002422325.1| processing peptidase [Methylobacterium chloromethanicum CM4]
 gi|218523812|gb|ACK84397.1| processing peptidase [Methylobacterium chloromethanicum CM4]
          Length = 431

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 244/419 (58%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L +S+  +G+TV TE +P + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  GLTVSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+
Sbjct: 73  ARKIAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y 
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYV 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM +   GAV+H   V   E +F          ++   VY GGE   ++ L + +++L
Sbjct: 193 PERMVLAAAGAVEHAEIVEAAERHFGGLKPVAAPPAVA-GVYGGGERRMQKRLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I 
Sbjct: 252 GLPGLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q+
Sbjct: 312 AGTSGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           +  G ++  +++I  + A+  E +    + +    PTLA +G P+  +P+ + +  AL+
Sbjct: 372 LAWGRVIPPQELIAKVDAVEVEHVRAAGRALLRGAPTLAAIG-PVKGLPSLARVASALQ 429


>gi|163852668|ref|YP_001640711.1| processing peptidase [Methylobacterium extorquens PA1]
 gi|163664273|gb|ABY31640.1| processing peptidase [Methylobacterium extorquens PA1]
          Length = 431

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 244/419 (58%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L +S+  +G+TV TE +P + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  GLTVSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+
Sbjct: 73  ARKIAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y 
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYV 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM +   GAV+H   V   E +F          ++   VY GGE   ++ L + +++L
Sbjct: 193 PERMVLAAAGAVEHAEIVEAAERHFGGLKPVAAPPAVA-GVYGGGERRMQKRLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I 
Sbjct: 252 GLPGLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q+
Sbjct: 312 AGTSGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           +  G ++  +++I  + A+  E +    + +    PTLA +G P+  +P+ + +  AL+
Sbjct: 372 LAWGRVIPPQELIAKVDAVEVEHVRAAGRTLLRGAPTLAAIG-PVKGLPSLARVASALQ 429


>gi|254562428|ref|YP_003069523.1| protease [Methylobacterium extorquens DM4]
 gi|254269706|emb|CAX25678.1| putative protease [Methylobacterium extorquens DM4]
          Length = 431

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 244/419 (58%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L +S+  +G+TV TE +P + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  GLTVSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+
Sbjct: 73  ARKIAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y 
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYV 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM +   GAV+H   V   E +F          ++   VY GGE   ++ L + +++L
Sbjct: 193 PERMVLAAAGAVEHAEIVEAAERHFGGLKSVAAPPAVA-GVYGGGERRMQKRLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I 
Sbjct: 252 GLPGLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q+
Sbjct: 312 AGTSGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           +  G ++  +++I  + A+  E +    + +    PTLA +G P+  +P+ + +  AL+
Sbjct: 372 LAWGRVIPPQELIAKVDAVEVEHVRAAGRALLRGAPTLAAIG-PVKGLPSLARVASALQ 429


>gi|240140001|ref|YP_002964478.1| putative protease [Methylobacterium extorquens AM1]
 gi|240009975|gb|ACS41201.1| putative protease [Methylobacterium extorquens AM1]
          Length = 431

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 244/419 (58%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L +S+  +G+TV TE +P + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  GLTVSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+
Sbjct: 73  ARKIAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y 
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYV 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM +   GAV+H   V   E +F          ++   VY GGE   ++ L + +++L
Sbjct: 193 PERMVLAAAGAVEHAEIVEAAERHFGGLKPVAAPPAVA-GVYGGGERRMQKRLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I 
Sbjct: 252 GLPGLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q+
Sbjct: 312 AGTSGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           +  G ++  +++I  + A+  E +    + +    PTLA +G P+  +P+ + +  AL+
Sbjct: 372 LAWGRVIPPQELIAKVDAVEVEHVRAAGRALLRGAPTLAAIG-PVKGLPSLARVATALQ 429


>gi|148252423|ref|YP_001237008.1| putative zinc protease [Bradyrhizobium sp. BTAi1]
 gi|146404596|gb|ABQ33102.1| putative zinc protease [Bradyrhizobium sp. BTAi1]
          Length = 429

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 240/404 (59%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++K  +G+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MGVEVTKLPTGLTVVTDTMPHLETAALGVWAGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EIVE IE VGGD+NA TS E T+Y+A VLK  VPLAL+++ D+L+N SF P ++ERE
Sbjct: 61  SAREIVEAIEAVGGDLNAGTSTETTAYYARVLKADVPLALDVLSDILANPSFVPEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG ++D   D +    +E+ + DQ +GR +LG  +T+  F  +K+  +++ +Y
Sbjct: 121 KNVIVQEIGAAQDTPDDVVFEHLNELCFPDQPMGRSLLGTAKTLQGFDRDKLHGYLATHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V  V   F   + A   + +  A   GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHQQVVEDVTRRFASFNGAPAPKPLPAAFGKGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVRE RGLCYS+   H  +SD G   +
Sbjct: 241 LALEGVPQADPSLFSLQVFTNILGGGMSSRLFQEVRENRGLCYSVYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+++ + +E + + E+ +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVVVDIIGNAVETLSEAEVARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G     ++++D I A++ E     A+ + + S P +  LG
Sbjct: 361 ILAYGRPQTLQEMVDKIEAVSVESTRDAARALLARSKPAVVALG 404


>gi|92115894|ref|YP_575623.1| peptidase M16-like [Nitrobacter hamburgensis X14]
 gi|91798788|gb|ABE61163.1| peptidase M16-like protein [Nitrobacter hamburgensis X14]
          Length = 429

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/404 (36%), Positives = 237/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K  SG+TV+T+ MP +++A + V    G R+E+  EHG++H LEHM FKGTT R
Sbjct: 1   MSVDVTKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPNEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGGD+NA T +E T+Y+A V+K  VPLAL+++ D+LSN +F   ++ERE
Sbjct: 61  SAREIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLSDILSNPNFAADELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+ +EIG ++D   D +    +E+ + DQ +GR +LG PET+  F  + +  +++ +Y
Sbjct: 121 KSVIEQEIGAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTPETLKRFNGDSLHGYLATHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAV+H+  V++VE  F     A   +        GG  +  RDL + H+ 
Sbjct: 181 RGPNMVVAAAGAVEHKAVVAEVERRFASFDAAPAPKPQAAKFGKGGSKVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G     R  +   +   ++G GMSSRLFQEVREKRGLCYSI A H  ++D G   +
Sbjct: 241 LALEGLPQTDRSLFSLQVFTHLIGGGMSSRLFQEVREKRGLCYSIYAFHAPYADTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+V+   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVVVDVINEAVETLTDTEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G      +++  I A++ E    VA+ I + S P +  LG
Sbjct: 361 ILVYGRPQSVAELMARIDAVSIESTRDVARDILTRSRPAVVALG 404


>gi|209883844|ref|YP_002287701.1| peptidase M16 domain protein [Oligotropha carboxidovorans OM5]
 gi|209872040|gb|ACI91836.1| peptidase M16 domain protein [Oligotropha carboxidovorans OM5]
          Length = 429

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 148/383 (38%), Positives = 229/383 (59%), Gaps = 1/383 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + I+K  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGT  R
Sbjct: 1   MAVEITKLPSGLTVVTDAMPHLETAALGVWTGVGGRDEKLDEHGISHLLEHMAFKGTASR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA+EIVE+IE VGGD+NA TS E T+Y+A VLK  VPLA++++ D+L + SF+  ++ERE
Sbjct: 61  TAREIVEQIEAVGGDLNAATSSESTAYYARVLKADVPLAIDVLSDILVSPSFDTEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG + D   D +     E+ + DQ +GR +LG P T+++FT +K+  +++ +Y
Sbjct: 121 KSVIVQEIGAAMDTPDDAVFEYVGELAYPDQPMGRSLLGTPATLATFTRDKLRGYLTTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V+ VE  F   S     + +      GG  + +RDL + H+ 
Sbjct: 181 RGPDMVVAASGAVDHARIVADVEQRFAGFSADAGPKPVPAQFGKGGSRVVRRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  S+LG GMSSRLFQEVREKRGLCYSI   H+ +SD G   +
Sbjct: 241 LALEGVPQSDPSLFSLQVFTSVLGGGMSSRLFQEVREKRGLCYSIYTFHQPYSDTGFFSL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+ +   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVIVDEMNEAVETLTPEEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCE 382
           V+  G  L  E++I  I  +T E
Sbjct: 361 VLSYGRPLSIEEMIARIDNVTVE 383


>gi|58040297|ref|YP_192261.1| putative processing protease protein [Gluconobacter oxydans 621H]
 gi|58002711|gb|AAW61605.1| Putative processing protease protein [Gluconobacter oxydans 621H]
          Length = 421

 Score =  289 bits (740), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 146/418 (34%), Positives = 253/418 (60%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            + +++  +G+T+ITE M  +++      +  G+R+E  + +G++HFLEHM FKGT +R+
Sbjct: 4   TIEVTRLDNGLTIITERMDRVETVSFGAYVSIGTRDETADNNGVSHFLEHMAFKGTERRS 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I EEIE VGG INAYT+ E T+Y+  +LK  + L ++IIGD+L++S+F  ++IERER
Sbjct: 64  ASRIAEEIENVGGYINAYTARETTAYYVKLLKNDLALGVDIIGDILTHSTFLDAEIERER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +  +F E  + +Q +GRP LG  E +S+ T + ++S++  +YT
Sbjct: 124 GVILQEIGQANDTPDDIIFDQFQERAFPEQPMGRPTLGSEERVSTMTRDTLMSYMREHYT 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
              + +   G + H+  V  V+ +F      +     + A Y GGE    R+L + H+++
Sbjct: 184 THNITIAAAGNLHHQQVVDLVKDHFRDLPTHQTPRP-RAASYEGGELRTTRELDQAHLVM 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF   +Y   D Y   IL+++LG GMSSRLFQE+RE+RGL YS+ +    FSD+G+  + 
Sbjct: 243 GFPSVSYMHPDHYAVMILSTLLGGGMSSRLFQEIRERRGLVYSVYSFASPFSDSGLFGLY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T +E    L   +++ ++ L + +   E+ +  A++ + L+ S E +  R  ++++Q+
Sbjct: 303 AGTGEEQTAELVPVMIDELKRLQDGLSAEELSRARAQLKSSLLMSLESTGSRCEQLARQI 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
                 + + + +  I A+T EDI+ VA+ IFS TPT   +G P+D++P+  ++   L
Sbjct: 363 QVHNRPVPTAETVGKIDAVTEEDILRVARTIFSGTPTFTAIG-PIDNMPSLEDITARL 419


>gi|56697902|ref|YP_168273.1| M16 family peptidase [Ruegeria pomeroyi DSS-3]
 gi|56679639|gb|AAV96305.1| peptidase, M16 family [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 154/415 (37%), Positives = 240/415 (57%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R  + ++G  +++E MP + SA + + + AG R+ER +++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRQDQLANGFRIVSENMPGLQSAAIGIWVTAGGRHERIDQNGIAHFLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VLKE V LAL++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLKEDVALALDVIGDIVLNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  ++DQ +GR ILG  E +S+F+   + +FV+ NY
Sbjct: 121 RGVILQEIGQAHDTPDDVIFDWLQEESYRDQPLGRTILGPVERVSAFSRADLSAFVADNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   E  F   +  K   ++ PA++ GGE  +++ L + H  
Sbjct: 181 GPEQMILSATGAVDHDLLVRLAEEMFGHLTPRKGALAV-PALFTGGEARREKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G  Y+    Y   I +S LG GMSSRLFQEVRE RGLCY+I A    ++D G   I
Sbjct: 240 LALEGPGYRDDAIYTAQIYSSALGGGMSSRLFQEVREVRGLCYTIFAQTGAYADTGTTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    ++ ++   E++ + E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSAGQVAELAGITIDEMKRAAEDMSEAEVARARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V   G +   E  +  I A+T  D+   A+++    P    L  P+   P  +EL
Sbjct: 360 VQIWGKVPSLEDTVARIDAVTTADVRAFAEQMAVEAPAALALYGPVSAAPNLAEL 414


>gi|126725946|ref|ZP_01741788.1| peptidase, M16 family protein [Rhodobacterales bacterium HTCC2150]
 gi|126705150|gb|EBA04241.1| peptidase, M16 family protein [Rhodobacterales bacterium HTCC2150]
          Length = 421

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 161/416 (38%), Positives = 242/416 (58%), Gaps = 3/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +I    +G  ++TE MP + SA V V + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MKPQIHTLPNGFRIVTEAMPGMKSASVGVWVNAGGRHERIEQNGIAHFLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I EEIE VGG INAYT+ E T+++A VL+  VPLA+++I D+L N +F+  +IE E
Sbjct: 61  TALQIAEEIEDVGGYINAYTTREVTAFYARVLENDVPLAVDVIADILRNPTFDEKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     +  + DQ IGR ILG  E + SF    + +FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDLIFDWLQDAAYPDQPIGRTILGPAERVRSFDQADLANFVTDHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            AD+M +   GAVDH+  V Q E+ F      + K   +PA +  GE  + +DL + H  
Sbjct: 181 RADQMILAAAGAVDHDEIVRQAEALFGDMP-QRSKLQFEPAKFHSGERREVKDLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L     +Y   D Y + I AS LG GMSSRLFQEVREKRGLCY+I A   +++D G++ I
Sbjct: 240 LALQCPSYMDDDVYTSQIYASALGGGMSSRLFQEVREKRGLCYTIFAQAGSYADTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ ++I  L +  V+ ++    +I + EI +   ++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGDDIDDLATLTVDELKRAATDISEVEIARARTQMKAGMLMGLESPSNRAERLARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSEL 414
           +     I   ++I++ I A+   D+ G A+K+       LA+ GP     P    L
Sbjct: 360 LAIWDRIPDLDEIVERIDAVNATDVRGFAEKMAHGNEIALALYGPMAADAPDLDGL 415


>gi|23012724|ref|ZP_00052739.1| COG0612: Predicted Zn-dependent peptidases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 431

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 145/419 (34%), Positives = 245/419 (58%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L +++  +G+TV TE +P + +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  GLTVTRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTASRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+
Sbjct: 73  ARQIAEDIENVGGEINAATSTECTSYTARVLGEDTGVALDVLGDILTRSVFDDGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F E  + DQ IGRPILG+PETI+ F    I ++++R Y 
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETITRFDRAAIEAYIAREYV 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM +   GAV+H   V   + +F   + A+  + +    Y GGE    + L + +++L
Sbjct: 193 PERMVLAAAGAVEHAEIVEAAQRHFGGLTAAEAPQVVA-GRYGGGERRMAKKLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++  D+Y  ++ +  LG G++SRL+ EVRE RGL Y I A H  FSD G+  I 
Sbjct: 252 GLPGLSFRDDDYYALHLFSQALGGGLTSRLWHEVRETRGLAYDIQAFHWPFSDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+  ++  L    +   ++  E ++  E+ +  A++   L+ + E    R    ++Q+
Sbjct: 312 AGTSGADLPELVDVTIATTRAAAEQLDAAELARAKAQLKVSLLSALETPGGRIERNARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           +  G ++  +++I  + A+  E +    + +    PTLA +G P+  +P  + +  AL+
Sbjct: 372 LAWGRVIPPQELIAKVDAVEVEHVREAGRTLLQGAPTLAAIG-PVKGLPPLARIAGALQ 429


>gi|157825424|ref|YP_001493144.1| mitochondrial protease [Rickettsia akari str. Hartford]
 gi|157799382|gb|ABV74636.1| mitochondrial protease [Rickettsia akari str. Hartford]
          Length = 412

 Score =  286 bits (733), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 147/404 (36%), Positives = 242/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E+T Y+  VL E+   A+ I+ D++ NS F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHENTVYYVRVLSENCDKAVNILADIIQNSIFADEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V++DQ +G+ ILG  +TI++FT E  ++F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYRDQPLGKLILGTTKTIAAFTQEHFLTFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFIHKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQTIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTETVSAEEIIRAKTQLRSNLQMAQEKNAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I+ I  +DI+  A KIFS T T AI+GP
Sbjct: 363 YSVFGKYISPEEIMEIITNIKTDDIINTANKIFSGTTTSAIIGP 406


>gi|260575704|ref|ZP_05843701.1| peptidase M16 domain protein [Rhodobacter sp. SW2]
 gi|259022102|gb|EEW25401.1| peptidase M16 domain protein [Rhodobacter sp. SW2]
          Length = 419

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 160/418 (38%), Positives = 245/418 (58%), Gaps = 4/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R+    +G+ V+TE MP + SA V + ++AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRLDTLPNGLRVVTEAMPGLQSASVGIWVQAGGRHERPEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I EEIE VGG INAYTS E T+Y+A VL   V LAL++I D++ N  F+P +IE E
Sbjct: 61  TALQIAEEIEDVGGFINAYTSKEMTAYYARVLSADVALALDVISDIVLNPVFDPKEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E+ + DQ  GR ILG  E +S+F    +  FV+ +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEVSYPDQPFGRTILGTAERVSAFARADLTGFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   G VDH+  ++Q ++ F          +++PA + G E  + +DL + H  
Sbjct: 181 GPDQMILAAAGGVDHDAILAQAQAIFGGLKPVG-ASAIQPARFSGAERREVKDLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F   +Y   D Y+  I A+ LG GMSSRLFQ++RE+RGLCYSI A    + D G + I
Sbjct: 240 LAFEAPSYLHPDVYIAQIYATALGGGMSSRLFQKIREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E I  LT   ++ ++    ++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEEIGDLTQLTIDELKRAAGDMAEAEVARARAQLKAGLLMGLESPSSRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +   G +    + +  I A+T  D+   A ++ +S   LA+ GP  D  PT  E+I A
Sbjct: 360 LSIFGRVPDVAEAVAKIDAVTTADVRRYAGQMAASPAALALYGPVQD-APTL-EVIRA 415


>gi|34580763|ref|ZP_00142243.1| protease [Rickettsia sibirica 246]
 gi|28262148|gb|EAA25652.1| protease [Rickettsia sibirica 246]
          Length = 412

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 147/404 (36%), Positives = 242/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   +I + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQIRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP
Sbjct: 363 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGP 406


>gi|260431064|ref|ZP_05785035.1| processing peptidase subunit beta [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414892|gb|EEX08151.1| processing peptidase subunit beta [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 420

 Score =  286 bits (732), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 150/415 (36%), Positives = 241/415 (58%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R+ + ++G  +++E MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRLDQLTNGFRIVSEQMPGLQSAAIGIWVTAGGRHERIEQNGIAHFLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VLK+ V LA+++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLKDDVALAMDVIGDIVLNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  ++DQ +GR ILG  E +S+F+ + + +FV+ +Y
Sbjct: 121 RGVILQEIGQAHDTPDDVIFDWLQEESYRDQPLGRTILGPTERVSAFSRDDLSTFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAVDH+  +   E  F      K   + +PA + GGE  + + L + H  
Sbjct: 181 APDQMILSAAGAVDHDQLMKLAEEMFGHLQPRKGLPA-EPARFTGGEARRDKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L      Y+  + Y   I ++ LG GMSSRLFQEVRE RGLCY+I A    ++D G   I
Sbjct: 240 LALESPGYRDDEIYTAQIYSTALGGGMSSRLFQEVRETRGLCYTIFAQTSAYADTGTTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L +  ++ ++   E++   E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSADQVGELATITIDEMKRAAEDMSPEEVARARAQMKAGILMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V   G +   E+ +  I A++  D+   A+K+    P    L  P+   PT  +L
Sbjct: 360 VQIWGRVPPLEETVAKIDAVSTADVRAFAEKMAVQAPAALALYGPVGGAPTLEQL 414


>gi|23014797|ref|ZP_00054596.1| COG0612: Predicted Zn-dependent peptidases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 421

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 141/405 (34%), Positives = 255/405 (62%), Gaps = 7/405 (1%)

Query: 3   LRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++ +SG+ ++T+ M  +++  + V + AG+R+E  E +G++H LEHM FKGT +R+A
Sbjct: 4   IRETRLNSGLKIVTDPMETVETVSLGVWVDAGTRHEPVEINGVSHLLEHMAFKGTARRSA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EE++ VGG +NAYT+ +HT+Y+A VLKE   LAL+II D+L NS+    ++ RE+ 
Sbjct: 64  LDIAEEMDAVGGHLNAYTARDHTAYYAKVLKEDAALALDIISDILQNSTLEAEELGREQA 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV++EI  + D   D +   F    + DQ +GRP+LG  E + + + ++++ ++  NY+A
Sbjct: 124 VVVQEINQAIDTPDDIIFDHFQATAYPDQPLGRPVLGSEELVRAMSRDQVMGYMRGNYSA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSV--AKIKESMKPAVYVGGEYIQKR-DLAEEHM 238
            RM +   G +DH+  V+   + F+      A + +  +   YVGG++ ++R +L + H+
Sbjct: 184 PRMVLSASGRIDHDHLVATAGAAFSQLPPHHAAVTDQAR---YVGGDFREERSELEQVHV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++GF+G AY   D+Y  ++L+++LG GMSSRLFQEVREKRGL YSI +   +++D G+  
Sbjct: 241 VVGFDGVAYDDPDYYSASVLSTLLGGGMSSRLFQEVREKRGLVYSIYSFASSYNDGGLFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + + T ++ +  L   + + +  +   +   E+ +  A++ A ++ S E +  R  ++++
Sbjct: 301 VYAGTGEDEVAELIPVMCDEIVKVCGGVNDAEVQRARAQLKASILMSLESTTSRCEQLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           QV+  G  +   ++++ + AIT ED   VA+++F+ TPT A +GP
Sbjct: 361 QVVIYGRPVPVAEVVEKVEAITAEDCARVARRLFAGTPTFAAIGP 405


>gi|330993427|ref|ZP_08317362.1| Putative zinc protease [Gluconacetobacter sp. SXCC-1]
 gi|329759457|gb|EGG75966.1| Putative zinc protease [Gluconacetobacter sp. SXCC-1]
          Length = 421

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 250/418 (59%), Gaps = 5/418 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + +++  SG+T++TE M  +++  +   + AG+ NE   E+G++HFLEHM FKGT+ RTA
Sbjct: 5   INVTRLDSGLTIVTERMDRVETVSLGAYVAAGTCNETTPENGVSHFLEHMAFKGTSTRTA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I EEIE VGG INAYT+ EHT+Y+  +LKE++ L  +IIGD+L++SS  P ++ERER 
Sbjct: 65  AGIAEEIENVGGHINAYTAREHTAYYVKLLKENLDLGADIIGDILTHSSLAPDELERERG 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F E  + DQ +GRP LG    I   +   +++++  +YTA
Sbjct: 125 VILQEIGQANDTPDDIVFDHFQETAFPDQAMGRPTLGTEAGIQGMSRATLVNYMGTHYTA 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-YVGGEYIQKRDLAEEHMML 240
               +   G ++H   V  V+ +F       +    +PAV YVGG + ++RDL + H++L
Sbjct: 185 GNTIIAAAGNLEHARVVDLVQRHFADLPTGTVPP--QPAVNYVGGAFTRERDLDQAHIVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF    Y   D+Y   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F   G+  I 
Sbjct: 243 GFPSMPYGDMDYYPALLLSTLLGGGMSSRLFQEIREKRGLVYSVYSFNAPFRQGGLFGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T +  +  L    +E ++ +   +   E+ +  A++ + L+ S E +  R  ++++Q+
Sbjct: 303 AGTGEAQVADLVPVTLEELRKVRHTVNAAELARARAQLKSSLLMSLESTGSRCEQLARQL 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
                ++ + + +  I A+T  D+  VA +IFS  PTLA LG P+ +VP+   +  AL
Sbjct: 363 QIFDRLIPTAETVRRIDAVTIADVQRVATRIFSGRPTLASLG-PVSNVPSLDSIAGAL 419


>gi|157828171|ref|YP_001494413.1| mitochondrial protease [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932869|ref|YP_001649658.1| peptidase, M16 family [Rickettsia rickettsii str. Iowa]
 gi|157800652|gb|ABV75905.1| mitochondrial protease [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907956|gb|ABY72252.1| peptidase, M16 family [Rickettsia rickettsii str. Iowa]
          Length = 412

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 147/404 (36%), Positives = 242/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENVEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGHGFINKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  L  E+I++ I +I  +DI+  A KIFS T T AI+GP
Sbjct: 363 YSVFGQYLSPEEIMEIIMSIQADDIINTANKIFSGTITSAIIGP 406


>gi|238650423|ref|YP_002916275.1| protease [Rickettsia peacockii str. Rustic]
 gi|238624521|gb|ACR47227.1| protease [Rickettsia peacockii str. Rustic]
          Length = 412

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 242/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP
Sbjct: 363 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGP 406


>gi|229586465|ref|YP_002844966.1| protease [Rickettsia africae ESF-5]
 gi|228021515|gb|ACP53223.1| protease [Rickettsia africae ESF-5]
          Length = 411

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 242/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 3   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 63  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 123 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 183 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNDFINKELEQTSLVL 241

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 242 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 302 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP
Sbjct: 362 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGP 405


>gi|126729106|ref|ZP_01744920.1| peptidase, M16 family protein [Sagittula stellata E-37]
 gi|126710096|gb|EBA09148.1| peptidase, M16 family protein [Sagittula stellata E-37]
          Length = 420

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 157/416 (37%), Positives = 243/416 (58%), Gaps = 4/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++IS  S+G  ++TE MP + SA + + + AG R+ER E++G+AHFLEHM FKGTT+R
Sbjct: 1   MTVQISTLSNGFRIVTEKMPGLQSAALGLWVTAGGRHERVEQNGIAHFLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VLK    LA++++ D+L N  F+  +I+ E
Sbjct: 61  TALQIAESIEDVGGYINAYTSREVTAYYARVLKADTALAVDVLADILRNPIFDEKEIDTE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  + +Q IGR ILG+ E + +F+   +  FV  +Y
Sbjct: 121 RHVILQEIGQAHDTPDDIIFDWLQEKAYPNQPIGRTILGEAERVEAFSRADLQQFVHEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V Q E  F    + +   + + A++ GGE  + +DL + HM 
Sbjct: 181 GPGQMILSAAGAVDHDALVKQAEGLFGDL-LPRPGRNAEGALFHGGEMRRVKDLEQAHMA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+   FY   I A  LG GMSSRLFQE+REKRGLCY+I A    ++D G+  I
Sbjct: 240 LAFEAPGYRDPGFYTAQIYAIALGGGMSSRLFQEIREKRGLCYTIFAQSGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    V+ ++   + +   EI++  +++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGSEMGELLDLTVDEMKRAADTMSDAEIERARSQMKAGLLMGLESPSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAK-KIFSSTPTLAILGPPMDHVPTTSEL 414
           V   G +   E+ +  I A+T E ++  A+ ++  S   LA+ G P+D  P+  +L
Sbjct: 360 VQIWGKVPPIEETVARIDAVTREGVLAFAEAQVAQSAAALALYG-PVDGAPSLEKL 414


>gi|255261299|ref|ZP_05340641.1| peptidase, M16 family [Thalassiobium sp. R2A62]
 gi|255103634|gb|EET46308.1| peptidase, M16 family [Thalassiobium sp. R2A62]
          Length = 421

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/415 (37%), Positives = 237/415 (57%), Gaps = 1/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + + + S+G  ++TE MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVELHRLSNGFRIVTEHMPGLQSASLGIWVLAGGRHERIEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A +I E IE VGG INAYTS E T+Y+A VL   VPLAL++I D++ N  F+P +IE E
Sbjct: 61  NALQIAEAIEDVGGYINAYTSREMTAYYARVLAGDVPLALDVISDIVLNPVFDPKEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ +GR ILG  E +SSF+ + +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDIVFDWLQEESYPDQALGRTILGPSERVSSFSWDDLSGFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V+  E  F      + + +  PA ++GGE    +DL + H  
Sbjct: 181 GPEQMVLSAAGAVDHDTLVAAAEKLFGHLPRTENRSTTVPAKFLGGERRVIKDLEQVHFA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G  Y+  + Y   I +S  G GMSSRLFQEVRE+RGLCY+I A    + D G+  I
Sbjct: 241 LALEGPDYRDPEIYTAQIFSSAFGGGMSSRLFQEVRERRGLCYTIFAQAGAYEDTGMTTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E I  L    ++ ++   +++  +E+ +  A++ A L+   E    RA  +++ 
Sbjct: 301 YAGTSAEQIGELAQITMDELKRSADDMSAQEVARARAQMKAGLLMGLESPSNRAERLARL 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +     I   E+ I  I+ ++  D+   A K+ +   T   L  P+D  P+  EL
Sbjct: 361 IAIWDRIPPLEETISNINDVSTGDVRAFAAKMATRAGTAMALYGPVDAAPSLDEL 415


>gi|85715320|ref|ZP_01046303.1| peptidase M16 [Nitrobacter sp. Nb-311A]
 gi|85697966|gb|EAQ35840.1| peptidase M16 [Nitrobacter sp. Nb-311A]
          Length = 429

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 235/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K SSG+TVIT+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MSVDVTKLSSGLTVITDDMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGGD+NA T +E T+Y+A V+K  VPLAL+++ D+LSN SF   ++E E
Sbjct: 61  SAREIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLSDILSNPSFETKELECE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG ++D   D +    +E+ + DQ IGR +LG PET+  F  + +  ++  +Y
Sbjct: 121 KGVIEQEIGAAQDTPDDVVFEHLNELCYPDQPIGRSLLGTPETLKRFNSDMLHGYLKAHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GA++H+  V++VE  F         +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAIEHKAVVAEVEQRFASFDDTPAPQPPSAKFGGGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G +      +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGVSQTDASLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYADTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVVVDVISEAVETLTEAEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G      +++  I A++ E     A+ + + S P +  LG
Sbjct: 361 MLVYGRPQSVPELMARIDAVSVESTCDAARILLARSRPAVVALG 404


>gi|239947859|ref|ZP_04699612.1| peptidase, M16 family [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|241116862|ref|XP_002401644.1| metalloprotease, putative [Ixodes scapularis]
 gi|215493188|gb|EEC02829.1| metalloprotease, putative [Ixodes scapularis]
 gi|239922135|gb|EER22159.1| peptidase, M16 family [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 412

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/422 (35%), Positives = 245/422 (58%), Gaps = 15/422 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILTDIIQNSIFADEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGSGFINKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQTIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYKEIKNEIIKMTEKVNTEEIIRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
               G  +  E+I++ I +I  +DI+  A KIF    T AI+GP            H L+
Sbjct: 363 YSVFGKYISPEEIMEIIMSIKADDIINTANKIFRGATTSAIIGP------------HDLQ 410

Query: 420 GF 421
           GF
Sbjct: 411 GF 412


>gi|326403980|ref|YP_004284062.1| putative peptidase M16 [Acidiphilium multivorum AIU301]
 gi|325050842|dbj|BAJ81180.1| putative peptidase M16 [Acidiphilium multivorum AIU301]
          Length = 417

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 155/417 (37%), Positives = 245/417 (58%), Gaps = 3/417 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++++K  SG+T++TE M  +++         G+R+E   E+G++HFLEHM FKGT +R+A
Sbjct: 1   MQVTKLDSGLTILTERMDRVETVSFGAYAGVGTRHETAAENGVSHFLEHMAFKGTERRSA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I E IE VGG INAYTS E T+Y+  +LKE + L ++IIGD+L +S+F+P++ ERER 
Sbjct: 61  AAIAEAIEDVGGHINAYTSREQTAYYVKLLKEDLSLGIDIIGDILCHSTFDPAEFERERG 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F    + DQ +G P LG  E I +  P+ +  ++  +YT 
Sbjct: 121 VILQEIGQANDTPDDIVFDHFQLAAYPDQPMGWPTLGTEEIIRAIGPDALRRYMKAHYTP 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G ++H   V  V  +F     A   E + PA Y GGEY + RDL + H++LG
Sbjct: 181 ENLVIAASGNLEHARVVDLVAKHFADLPAATRAEPL-PADYAGGEYRELRDLDQAHLVLG 239

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F    Y   DF+   +L+++LG GMSSRLFQE+REKRGL YSI +      D G+  I +
Sbjct: 240 FPAVGYADPDFHAAMLLSTLLGGGMSSRLFQEIREKRGLVYSIYSFALPARDAGLFGIYA 299

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T +     L    +  +  + +++ + E+ +  A++ A L+ S E +  R  +I++Q  
Sbjct: 300 GTGEAEAAELVPVTLGELAKVRQSVSEAELRRARAQVKAGLLMSLESTGSRCEQIARQWQ 359

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
             G I+ + + +  I A+T +DI  VA +IF + PTLA +G P+  VP   ++I  L
Sbjct: 360 IFGRIVPTAETVAKIDAVTVDDITSVATRIFRAKPTLAAIG-PVGRVPQMPKIIERL 415


>gi|15892216|ref|NP_359930.1| mitochondrial protease [Rickettsia conorii str. Malish 7]
 gi|29839594|sp|Q92IX7|Y293_RICCN RecName: Full=Uncharacterized zinc protease RC0293
 gi|15619351|gb|AAL02831.1| protease [Rickettsia conorii str. Malish 7]
          Length = 412

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 240/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDAIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ + Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKYYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AANLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYKEIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP
Sbjct: 363 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGP 406


>gi|157964285|ref|YP_001499109.1| protease [Rickettsia massiliae MTU5]
 gi|157844061|gb|ABV84562.1| Mitochondrial protease-like protein [Rickettsia massiliae MTU5]
          Length = 437

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 145/404 (35%), Positives = 241/404 (59%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  M  ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 29  NFNVSKLKNGLTILTYNMSYVNSVAINLIAKVGARYENAEEEGISHFLEHMAFKGTKTRT 88

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 89  AKQIAEEFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFADEEIAKEY 148

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 149 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 208

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 209 AENLYLSIAGNIDHDKIVIIAEQLFSALKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 267

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y + +  Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 268 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFII 327

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + +  +QE++  ++ EI K 
Sbjct: 328 YASTAHDKLELLYREIKNAIIKMTEQVSTEEILRAKTQLRSNVQMAQEKNTYKSEEIGKN 387

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP
Sbjct: 388 YSVFGKYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGP 431


>gi|148260781|ref|YP_001234908.1| processing peptidase [Acidiphilium cryptum JF-5]
 gi|146402462|gb|ABQ30989.1| processing peptidase [Acidiphilium cryptum JF-5]
          Length = 421

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/418 (37%), Positives = 245/418 (58%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            ++++K  SG+T++TE M  +++         G+R+E   E+G++HFLEHM FKGT +R+
Sbjct: 4   TVQVTKLDSGLTILTERMDRVETVSFGAYAGVGTRHETAAENGVSHFLEHMAFKGTERRS 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I E IE VGG INAYTS E T+Y+  +LKE + L ++IIGD+L +S+F+P++ ERER
Sbjct: 64  AAAIAEAIEDVGGHINAYTSREQTAYYVKLLKEDLSLGIDIIGDILCHSTFDPAEFERER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +   F    + DQ +G P LG  E I +  P+ +  ++  +YT
Sbjct: 124 GVILQEIGQANDTPDDIVFDHFQLAAYPDQPMGWPTLGTEEIIRAIGPDALRRYMKAHYT 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            + + +   G ++H   V  V  +F     A   E + PA Y GGEY + RDL + H++L
Sbjct: 184 PENLVIAASGNLEHARVVDLVAKHFADLPAATRAEPL-PADYAGGEYRELRDLDQAHLVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF    Y   DF+   +L+++LG GMSSRLFQE+REKRGL YSI +      D G+  I 
Sbjct: 243 GFPAVGYADPDFHAAMLLSTLLGGGMSSRLFQEIREKRGLVYSIYSFALPARDAGLFGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T +     L    +  +  + +++ + E+ +  A++ A L+ S E +  R  +I++Q 
Sbjct: 303 AGTGEAEAAELVPVTLGELAKVRQSVSEAELRRARAQVKAGLLMSLESTGSRCEQIARQW 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
              G I+ + + +  I A+T +DI  VA +IF + PTLA +G P+  VP   ++I  L
Sbjct: 363 QIFGRIVPTAETVAKIDAVTVDDITNVATRIFRAKPTLAAIG-PVGRVPQMPKIIERL 419


>gi|89071033|ref|ZP_01158250.1| peptidase, M16 family protein [Oceanicola granulosus HTCC2516]
 gi|89043421|gb|EAR49638.1| peptidase, M16 family protein [Oceanicola granulosus HTCC2516]
          Length = 421

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 151/416 (36%), Positives = 236/416 (56%), Gaps = 3/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++     +G  ++TE+MP + SA + + + AG R+ER +++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKTHTLPNGFRIVTELMPSMKSAALGIWVNAGGRHERADQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I EEIE VGG INAYTS E T+Y+A VL+E V L L++I D+L N  F+  +IE E
Sbjct: 61  SALQIAEEIEDVGGYINAYTSREMTAYYARVLEEDVDLGLDLISDILLNPVFDEREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E+ + DQ +GR ILG PE +  F  + + SFV  +Y
Sbjct: 121 RGVILQEIGQSHDTPDDVVFDWLQEVAYPDQPMGRSILGLPERVQGFGRDDLTSFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V   E  F       +    +PA + GGE   K+ L + H  
Sbjct: 181 GPGQMILAAAGAVDHDHLVRLAEDLFGHLKPVNLTFQTEPARFGGGERRVKKRLEQVHFA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L  +G  Y+  + Y   + A+ LG GMSSRLFQE+RE RGLCY+I A    ++D G+  I
Sbjct: 241 LALDGPDYRDPEIYTAQVYATALGGGMSSRLFQELRENRGLCYTIFAQAGAYADAGMTTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + TA + I +     ++ ++   +++   EI +  A++ A ++   E    RA  +++ 
Sbjct: 301 YAGTAADQIESFAHLTIDEMKRAADDLSDAEIARARAQMKAGMLMGLESPSNRAERLARM 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGPPMDHVPTTSEL 414
           +   G +   ++ ++ I A+  +D+     K+     T +AI G P++  PT   L
Sbjct: 361 ISIWGRVPTIDETVERIDAVGRDDVRAFGAKMAGQAGTAMAIYG-PIERAPTLQAL 415


>gi|119387019|ref|YP_918074.1| peptidase M16 domain-containing protein [Paracoccus denitrificans
           PD1222]
 gi|119377614|gb|ABL72378.1| peptidase M16 domain protein [Paracoccus denitrificans PD1222]
          Length = 421

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/404 (38%), Positives = 237/404 (58%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +RIS   +G+ V++  MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R+
Sbjct: 3   QIRISTLPNGLRVVSRDMPGLHSAAIGIWVNAGCRDERAEQNGIAHFLEHMAFKGTARRS 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EIVE IE VGG INAYTS + TSY+A VL   V LAL++I D++ N  F+  +IE ER
Sbjct: 63  ALEIVESIENVGGYINAYTSRDVTSYYARVLAGDVELALDVISDIVMNPVFDQREIEVER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +     E  + DQ +GR ILG  E +S F  + +  F+  +Y 
Sbjct: 123 GVILQEIGQALDTPDDVIFDWLQEAAYPDQPMGRTILGPAERVSRFGRDDLSGFIGEHYG 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM V   GAV+H+  + QVE+ F     A+     +PA + G E  + + L + H  L
Sbjct: 183 PERMIVSAAGAVEHDRILRQVEAIFGHLP-ARALTKREPARWQGAEARRVKGLEQAHFAL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            F G  YQ+ DFY   I  S LG GMSSRLFQ++RE++GLCYSI A      D G++ I 
Sbjct: 242 AFEGPGYQAPDFYAAQIWTSALGGGMSSRLFQKLREEKGLCYSIFAQSGFHDDTGMVTIY 301

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+ E I  L +  V+ ++   E++ + E+ +  A++ A L+   E    +A  +++ +
Sbjct: 302 AGTSGEQIADLATLTVDELKRSAEDMTETEVARARAQLKAGLLMGLESPTGQAERMARSL 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
              G +    ++ + I A+T   I   A+++ + + P LA+ GP
Sbjct: 362 SIWGRVPDPAEVAERIDAVTVAAIRAHAERLIAHARPALALYGP 405


>gi|288957795|ref|YP_003448136.1| hypothetical protein AZL_009540 [Azospirillum sp. B510]
 gi|288910103|dbj|BAI71592.1| hypothetical protein AZL_009540 [Azospirillum sp. B510]
          Length = 419

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 143/404 (35%), Positives = 239/404 (59%), Gaps = 4/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R++   +G+ V T+ MP + S  +   +  G+RNE    +G+AH +EHMLFKGT +R+
Sbjct: 3   SIRVTTLPNGLRVATDTMPDVQSVSLGCWVGVGTRNEAASVNGVAHLVEHMLFKGTRRRS 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I EEIE VGG +NAYT+ E T+Y+A VL E  PLAL+I+ DM+ +S+ +  ++ RER
Sbjct: 63  AFRISEEIENVGGQLNAYTTREQTAYYAKVLHEDAPLALDILSDMIQHSTLDAEELVRER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVL+EIG S D   D +   F    +  Q IGRP+LG  E + +   E ++ +++ +Y 
Sbjct: 123 TVVLQEIGQSADTPDDIIFDHFQATAYPGQAIGRPVLGSAEIVGALPREALVDYIAGHYG 182

Query: 181 ADRMYVVCVGAVDHEFCVS-QVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           A  M +   G ++HE  V   ++++ ++ S A  K     A Y GG++ + RDL + H++
Sbjct: 183 APGMVLSAAGRIEHERMVDLAMKAFGDLPSAAPPKPEQ--ARYAGGDFREDRDLEQMHLV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF+G      DFY  ++L+++LG GMSSRLFQEVREKRGL YSI      + D G+  +
Sbjct: 241 LGFDGVGVHDPDFYAHSVLSTLLGGGMSSRLFQEVREKRGLVYSIYTFTGGYHDGGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T ++ +  L   + + +  +  ++ + E+ +  A++ A  + + E S  R  ++ +Q
Sbjct: 301 YAGTGEDEVAELVPVVCDEIAKVGVDVTEEEVARARAQLKAGTLMALESSMSRCEQLGQQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++     +  E+I+  I  +  + +V  A ++ +S PT+A LGP
Sbjct: 361 MLIYDRPVPVEEIVAKIDGVDRDAVVKAASRLRASRPTVAALGP 404


>gi|85705122|ref|ZP_01036222.1| peptidase, M16 family protein [Roseovarius sp. 217]
 gi|85670444|gb|EAQ25305.1| peptidase, M16 family protein [Roseovarius sp. 217]
          Length = 420

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/413 (36%), Positives = 235/413 (56%), Gaps = 6/413 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++++   +G  +++E MP + SA + V + AG+R+E   ++G+AHFLEHM FKGT +R
Sbjct: 1   MSVQLTTLPNGFRIVSEYMPGLQSAAIGVWVLAGARHEEASQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+  VLKE VPLAL+++ D+L N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYVRVLKEDVPLALDVVADILRNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + D  +GR ILG  E +  F    +  FV + Y
Sbjct: 121 RGVILQEIGQAADTPDDIIFDWLQEKAYPDHPLGRTILGAEERVRGFDRPDLERFVDQYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV--YVGGEYIQKRDLAEEH 237
              +M +   GAVDHE  V   E  F     +   ++++P V  + GGE    +DL + H
Sbjct: 181 RPGQMVLSAAGAVDHEALVRMAEGMFGDMIPS---DAIEPPVARFAGGETRHVKDLEQAH 237

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
             L F    Y   D Y   I AS LG  MSSRLFQE+RE+RGLCYSI A    +SD G++
Sbjct: 238 FALAFESPDYAHPDIYTAQIYASALGGSMSSRLFQEIRERRGLCYSIYAQAGAYSDTGMM 297

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T+ E +  L    V+ ++   +++   E+++  A++ A L+   E    RA  ++
Sbjct: 298 TIYAGTSAEQLGDLAGITVDEMKRAADDMSVAEVERARAQMKAGLLMGLESPSNRAERLA 357

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           + +   G +    ++++ I A+T  D+  +A+   +  P+   L  P++  PT
Sbjct: 358 RMLQIWGRVPDLPEVVERIDAVTLADVKRLAESTVARAPSALALYGPVEQAPT 410


>gi|163745865|ref|ZP_02153224.1| peptidase, M16 family, putative [Oceanibulbus indolifex HEL-45]
 gi|161380610|gb|EDQ05020.1| peptidase, M16 family, putative [Oceanibulbus indolifex HEL-45]
          Length = 420

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 152/415 (36%), Positives = 239/415 (57%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+L  +   +G  ++TE M  + S+ + V + AG+R+E  +++G+AHFLEHM FKGT  R
Sbjct: 1   MSLNQTTLPNGFRIVTEHMEGLASSAIGVWVNAGARHETPQQNGIAHFLEHMAFKGTATR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           ++ +I E IE VGG INAYTS E T+Y+A VL+  V L L++I D+L N   +PS++E E
Sbjct: 61  SSLQIAEAIEDVGGYINAYTSREVTAYYARVLENDVALGLDVIADILRNPVLDPSEVEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ IGR ILG  E +S+F+ + +  F++ +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEQAYPDQPIGRTILGPSERVSAFSRDDLKLFIADHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   ES F      K+ + +  A + GGE+ Q + L + H  
Sbjct: 181 GPEQMILSAAGAVDHDKIVKLAESLFGDMPSKKLYQ-VDGARFGGGEFRQVKKLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y+S D Y+  I AS LG GMSSRLFQE+RE RGLCY+I A    ++D G+  I
Sbjct: 240 LGFESPGYRSDDIYIAQIYASALGGGMSSRLFQEIRENRGLCYTIFAQAGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L +  ++ ++    ++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLPELANITIDEMKRAATDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +     +   E+ +  I A+T  D+   A+++ +  P    L  P+D  PT  EL
Sbjct: 360 IQIWDRVPPLEETVAQIDAVTTGDVRDFAERMATQAPAALALYGPVDGAPTLDEL 414


>gi|254477226|ref|ZP_05090612.1| Zn-dependent peptidase family protein [Ruegeria sp. R11]
 gi|214031469|gb|EEB72304.1| Zn-dependent peptidase family protein [Ruegeria sp. R11]
          Length = 420

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 153/408 (37%), Positives = 234/408 (57%), Gaps = 3/408 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++  + ++G  V+TE MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKQHQLANGFRVVTETMPGLQSAAIGLWVTAGGRHERIEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A EI E IE VGG INAYTS E T+Y+A VLK+ VPLA++++ D++ N  F+  +IE E
Sbjct: 61  SALEIAEAIEDVGGYINAYTSREVTAYYARVLKDDVPLAMDVVADIVLNPIFDQREIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ IGR ILG  E + +F    +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEESYHDQPIGRTILGPAERVRAFGRADLEGFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V   E          + E + PA + GGE   ++ L + H+ 
Sbjct: 181 GPGQMILAASGAVDHDAIVKLAEDLIGHMRPKPLFE-VAPARFTGGEARHEKALEQAHIA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+  D Y   I +S LG GMSSRLFQEVREKRGLCY+I A    ++D G L +
Sbjct: 240 LAFEGPGYRDDDIYTAQIYSSALGGGMSSRLFQEVREKRGLCYTIFAQTGAYADTGALTL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    ++ ++   +++   E+D+  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGAQLDQLAQITIDEMKRAADDMSDAEVDRARAQMKAGMLMGLESPTNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMD 406
           V     +   E+ +  I A+T  D+  +A+ +    P  LA+ GP  D
Sbjct: 360 VQIWDKVPPLEETVARIDAVTTADVRAMAQAMAHEAPMALALYGPVGD 407


>gi|110679417|ref|YP_682424.1| M16 family peptidase putative [Roseobacter denitrificans OCh 114]
 gi|109455533|gb|ABG31738.1| peptidase, M16 family, putative [Roseobacter denitrificans OCh 114]
          Length = 420

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 155/415 (37%), Positives = 235/415 (56%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M L   +  +G  ++TE MP + SA + V + AG+R+E  +++G+AHFLEHM FKGTT+R
Sbjct: 1   MTLNQHRLPNGFRIVTEHMPGLASASIGVWVTAGARHETPQQNGIAHFLEHMAFKGTTQR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N +   ++IE E
Sbjct: 61  TALQIAESIEDVGGYINAYTSREVTAYYARVLQNDVPLALDVIADILLNPTLEEAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E  + +  +GR ILG  E +S F+   +  F++++Y
Sbjct: 121 RGVILQEIGQSLDTPDDVIFDWLQEEAYPNHPMGRTILGPSERVSQFSRNDLQQFIAQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   E  F     AK    +  A ++GGE  Q + L + H  
Sbjct: 181 GPEQMILSAAGAVDHDEIVRLAEQLFGSMQ-AKPMFDVDAAQFLGGERRQSKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I AS LG GMSSRLFQE+RE RGLCYSI A    ++D G+  I
Sbjct: 240 LAFESPGYRDDCIYTAQIYASALGGGMSSRLFQEIRENRGLCYSIFAQAGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++  ++++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLGQLAEITIDEIKRAVDDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V     +   ++ +  I A+T  D+   A++I  S P    L  P+D  PT + L
Sbjct: 360 VQIWDRVPPLDETVAMIDAVTTGDVREFAQRIAQSAPAALALYGPVDGAPTLAAL 414


>gi|149915662|ref|ZP_01904188.1| peptidase, M16 family, putative [Roseobacter sp. AzwK-3b]
 gi|149810554|gb|EDM70397.1| peptidase, M16 family, putative [Roseobacter sp. AzwK-3b]
          Length = 420

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 230/415 (55%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++   +G  ++TE MP + SA + + + AG+R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVNLTTLDNGFRIVTEAMPGLQSAAIGIWVNAGARHERAEQNGIAHFLEHMAFKGTRTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A  I E IE VGG INAYTS E T+Y+A VLK+ VPLAL+++ D+L N  F   +IE E
Sbjct: 61  SALAIAEAIEDVGGYINAYTSREVTAYYARVLKDDVPLALDVVADILRNPLFEGREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + D  +GR ILG  E + +F+   +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEKAYPDHPLGRTILGPEERVGAFSRADLTRFVDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V   E  F   +  K   +   A + GGE  + + L + H  
Sbjct: 181 GPGQMVLAAAGAVDHDAIVRDAEKLFGDMT-PKAPYTPDAARFAGGESRRVKTLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y   D +   I AS LG  MSSRLFQE+RE+RGLCY+I A    +SD G+L I
Sbjct: 240 LAFEAPDYAHPDIFTAQIYASALGGSMSSRLFQEIREQRGLCYTIFAQAGAYSDTGMLTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    V+ ++   E+    EI++  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAAEMANLADITVDEMKRAAEDFTSEEIERARAQMKAGLLMGLESPSNRAERLARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +   G +    ++++ I A+T +D+  +A+   S  P    L  P++  P+   L
Sbjct: 360 LQIWGRVPDLPEVVERIDAVTLQDVRRLAQTTISDAPVAMALYGPVEAAPSLEAL 414


>gi|254437767|ref|ZP_05051261.1| peptidase, M16 (pitrilysin) family [Octadecabacter antarcticus 307]
 gi|198253213|gb|EDY77527.1| peptidase, M16 (pitrilysin) family [Octadecabacter antarcticus 307]
          Length = 421

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 150/419 (35%), Positives = 233/419 (55%), Gaps = 1/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++    S+G  ++TE MP + SA + + + AG R+E   ++G+AHFLEHM FKGT +R
Sbjct: 1   MTVQQHTLSNGFRIVTEQMPGLKSASIGIWVMAGGRHETPAQNGIAHFLEHMAFKGTQRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N  F+PS+IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREMTAYYARVLENDVPLALDVIADILLNPVFDPSEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ IGR ILG  E +SSFT   +  F+   Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEEAYPDQAIGRTILGPSERVSSFTKADLSDFIGERY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAV+ +  ++  E  F          + + A +VGGE   K+DL + H  
Sbjct: 181 GPDQMILSAAGAVNPDELLALAEKLFGHLPRRSEPRAAEVAAFVGGERRVKKDLEQAHFT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+    Y   I A  +G GMSSRLFQE+RE RGLCY+I A    ++D G++ +
Sbjct: 241 LAFEGPNYRDPGIYAAQIHAITMGGGMSSRLFQELRENRGLCYTIFAQAGAYADTGMMTV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L +  ++ ++   +++   E+ +  A++ A ++   E    RA  +++ 
Sbjct: 301 YAGTSAEQLGELATLTIDELKRAADDMSAEEVARARAQMKAGMLMGLESPSSRAERLARM 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           V    ++   E  I+ I ++T  D+      + +   ++  L  P+D  P    L   L
Sbjct: 361 VAIWDTVPTIEDTIERIDSVTTGDVRAFGGSLITDAGSVMALYGPIDDAPALEALRQRL 419


>gi|162147873|ref|YP_001602334.1| M16 family peptidase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542492|ref|YP_002274721.1| processing peptidase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786450|emb|CAP56032.1| Peptidase, family M16 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530169|gb|ACI50106.1| processing peptidase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 421

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/403 (36%), Positives = 242/403 (60%), Gaps = 2/403 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            + +++  SG+TV+TE M  +++      + AG+ NE  EE+G++HFLEHM FKGT  RT
Sbjct: 4   QINVTRLPSGLTVVTERMERVETVSFGAYVAAGTCNEHAEENGVSHFLEHMAFKGTDSRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I EEIE VGG INAYT+ EHT+Y+  +LKE + L  +IIGD+L++SSF P ++ERER
Sbjct: 64  AAGIAEEIENVGGHINAYTAREHTAYYVKLLKEDLALGADIIGDILTHSSFAPDEVERER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +   F E  + +Q +GRP LG    I   + E ++ ++  +YT
Sbjct: 124 GVILQEIGQANDTPDDIIFDHFQETAFPEQPMGRPTLGTEPLIQDMSRETLMRYMRTHYT 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
                +   G + H   V+  E +F              + Y+GGE+ ++++L + H++L
Sbjct: 184 TANTVIAAAGNLHHADVVALAERHFRDLPALDSSTGFD-SRYLGGEFRKEKELDQAHVVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF    Y   D+Y   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F D G+  I 
Sbjct: 243 GFPSVGYGDPDYYPVLLLSTLLGGGMSSRLFQEIREKRGLVYSVYSFNAPFRDGGLFGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T ++    L    +E ++ +  ++ Q E+++  A++ + L+ S E +  R  ++++Q+
Sbjct: 303 AGTGEDQADELIPVTLEELRKVQGHVGQDELNRARAQLKSSLLMSLESTGSRCEQLARQL 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              G ++ + + ++ I+A+T  D+  VA ++F   PTLA LGP
Sbjct: 363 QVFGRLIPTAETVERINAVTIADVRRVATRLFRGKPTLASLGP 405


>gi|75674429|ref|YP_316850.1| peptidase M16 [Nitrobacter winogradskyi Nb-255]
 gi|74419299|gb|ABA03498.1| peptidase M16 [Nitrobacter winogradskyi Nb-255]
          Length = 429

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 144/404 (35%), Positives = 234/404 (57%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K SSG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MSVNVTKLSSGLTVVTDDMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++ I EEIE VGGD+NA T +E T+Y+A V+K  VPLAL+++ D+LSN  F+  ++E E
Sbjct: 61  SSRAIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLSDILSNPIFDAKELECE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG ++D   D +  + +E+ + DQ IGR +LG PET+  F  + +  ++  +Y
Sbjct: 121 KGVIEQEIGAAQDTPDDVVFEQLNELCYPDQPIGRSLLGTPETLERFNSDMLHGYLKTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GA++H   V++VE  F     A   +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAIEHGMVVAEVERRFAGFDAAPPPQPAAATFGHGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  S+LG GMSSRLFQEVREKRGLCYSI   H  ++D G+  +
Sbjct: 241 LALEGVPQTDGSLFSLQVFTSVLGGGMSSRLFQEVREKRGLCYSIYTFHAPYADTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVIVDVISEAVETLTEAEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G      ++   I A++ E     A+ + + S P +  LG
Sbjct: 361 MLVYGRPQSVGELTARIDAVSVESTRDAARGLLARSRPAVVALG 404


>gi|126461255|ref|YP_001042369.1| processing peptidase [Rhodobacter sphaeroides ATCC 17029]
 gi|332560262|ref|ZP_08414584.1| processing peptidase [Rhodobacter sphaeroides WS8N]
 gi|126102919|gb|ABN75597.1| processing peptidase [Rhodobacter sphaeroides ATCC 17029]
 gi|332277974|gb|EGJ23289.1| processing peptidase [Rhodobacter sphaeroides WS8N]
          Length = 419

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 149/404 (36%), Positives = 230/404 (56%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP + SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGIAHFLEHMAFKGTNTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA  I EEIE VGG INAYTS E T+Y+A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  TALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +S+F    +  FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEERVSTFGRADLTRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH+  V+Q ++ F        +  M+PA ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHDRIVAQAQALFGHLKPVG-QRPMQPADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F    Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +   G +   ++ ++ I A+T   +   A+++  +   LA+ GP
Sbjct: 360 LAIWGRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALALYGP 403


>gi|294678611|ref|YP_003579226.1| M16 family peptidase [Rhodobacter capsulatus SB 1003]
 gi|294477431|gb|ADE86819.1| peptidase, M16 family [Rhodobacter capsulatus SB 1003]
          Length = 419

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 155/407 (38%), Positives = 233/407 (57%), Gaps = 11/407 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + ++   +G+ ++TE MP + SA V V + AG R+ER E++G+AHFLEHM FKGT  RTA
Sbjct: 2   IELTTLPNGLRIVTERMPGLASASVGVWVLAGGRHERLEQNGIAHFLEHMAFKGTKTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E IE VGG INAYTS E T+Y+A VLK  V LAL++I D++ NS F+P +IE ER+
Sbjct: 62  LQIAEAIEDVGGYINAYTSREATAYYARVLKADVGLALDVISDIVLNSVFDPREIEVERH 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +     E  + DQ +GR ILG  E I  F  E    FV+ +Y  
Sbjct: 122 VILQEIGQALDTPDDIIFDWLQEAAYPDQAMGRTILGPSENIERFGREDFERFVAEHYGP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV----YVGGEYIQKRDLAEEH 237
           D+M +   GAVDH   V Q E  F       ++    PAV    + G E  + +DL + H
Sbjct: 182 DQMILSAAGAVDHAAIVKQAERLFG-----HLRPIGAPAVQLARWSGNERRELKDLEQVH 236

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
             L F G  Y+  D Y   + A+ LG GMSSRLFQ++RE+RGLCYSI A    + D G++
Sbjct: 237 FALAFEGPGYRDADLYTAQVYATALGGGMSSRLFQKIREERGLCYSIFAQAGAYDDTGMI 296

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T+ E +  L    ++ ++   E++ + E+ +  A++ A ++   E    RA  ++
Sbjct: 297 TIYAGTSGEEVADLCGLTIDELKRAAEDMTEAEVARARAQMKAGMLMGLESPSSRAERMA 356

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
           + +   G +   +++   I  +T E +   A ++ +   T LA+ GP
Sbjct: 357 RNLAIWGRVPGLDEVSTLIDGVTVEAVRSYAGRMIAQDRTALALYGP 403


>gi|163794855|ref|ZP_02188824.1| processing peptidase [alpha proteobacterium BAL199]
 gi|159179674|gb|EDP64201.1| processing peptidase [alpha proteobacterium BAL199]
          Length = 418

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/404 (34%), Positives = 244/404 (60%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R++K  SG+TV+T+ MP ++SA V + +  G+R+E   E+G+AH +EHM+FKGT +R
Sbjct: 1   MGIRVTKLDSGLTVVTDAMPSVESASVGLWVGVGTRHENPAENGLAHMIEHMVFKGTRRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A  I  EIE VGG +NAYTS E T+Y+A VL + +P+A+++I D++ +S F+P ++ RE
Sbjct: 61  DAAAIAREIEDVGGHMNAYTSREQTAYYAKVLADDMPVAVDLIADIMQDSLFDPDELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+++EIG   D   D +   F E  + +Q +GRP+LG+ E + S   + ++ ++  NY
Sbjct: 121 RSVIIQEIGQVADTPDDIIYDHFQEAAYPNQGLGRPVLGRTEIVQSLGRDALVGYLDTNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
                 +   G VDH+  V+     F+      +  + K A YVGGE   +R+L + H++
Sbjct: 181 GPGISILSAAGKVDHDAFVALAAERFDHLPGRAVATTDK-ANYVGGEVRVERELEQLHVI 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G A+   DF+   + +++ G GMSSRLFQEVREKRGL YS+ +   ++ D+G++ +
Sbjct: 240 LGFRGVAFDDPDFHAMQVFSTLYGGGMSSRLFQEVREKRGLAYSVYSFTSSYLDDGMVGV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T  + I  +   +VE + ++ + +E+ E+ +   ++ A L+ S+E +  R  +++  
Sbjct: 300 YAGTGPDEIDEVMPLVVEQLHAVADKLEEGELARARTQLKASLLMSRESTGTRCEQLANY 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++  G      + +  + A+    I  V  ++ +S PTLA +GP
Sbjct: 360 MLVYGRPPVVAETVAKVDAVDEAAIRRVVARLLASPPTLAAIGP 403


>gi|83594564|ref|YP_428316.1| processing peptidase [Rhodospirillum rubrum ATCC 11170]
 gi|83577478|gb|ABC24029.1| processing peptidase [Rhodospirillum rubrum ATCC 11170]
          Length = 421

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 249/403 (61%), Gaps = 2/403 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R+++   G+TV T+ +P ++S  +   +  G+R+E    +G++H LEHM FKGT KR+
Sbjct: 4   SVRVTRLPGGLTVATDFVPSVESLTLGAWVATGTRHEAPAVNGVSHLLEHMAFKGTRKRS 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I EEIE VGG +NAYTS E+T+Y+A VL+E   +AL+I+GD+L +S+F+P+++ RER
Sbjct: 64  ARQIAEEIEAVGGHLNAYTSRENTAYYARVLREDEDVALDILGDILQHSTFDPTELGRER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VV++EI  + D   D +   F E  + DQ +GRP+LG  + +   T E +  ++  +Y 
Sbjct: 124 EVVVQEIYQAIDTPDDIIFDHFQETAFPDQALGRPVLGTEKVVRGLTREIVDGYMRAHYA 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +R  V   G +DH+  V++V  +F+      I  + +P  Y GG + ++RDL + H++L
Sbjct: 184 PERTVVAAAGRIDHDAFVAKVTEHFSALPGRGIP-AEEPGRYAGGVFREERDLEQVHIVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G  +   D+Y  ++L+++ G GMSSRLFQE+RE RGL YSI +   ++ D G+  I 
Sbjct: 243 GFEGICHGDDDYYAASVLSTLHGGGMSSRLFQEIRENRGLAYSIYSFSSSYQDTGLYAIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+++    L   + +    L +++ + E+ +  A++ A ++ + E +  R  ++++Q+
Sbjct: 303 AGTSEKEAAELIPVLCDETARLADSLTEVEVARARAQLKASILMALESTSSRCEQMARQI 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              G  +  ++++  +  +T + +   A++IF+  PTLA +GP
Sbjct: 363 QVYGRPIGIDEVVAKLDGVTIDQVAACARRIFTRPPTLAAIGP 405


>gi|163742195|ref|ZP_02149583.1| peptidase, M16 family protein [Phaeobacter gallaeciensis 2.10]
 gi|161384525|gb|EDQ08906.1| peptidase, M16 family protein [Phaeobacter gallaeciensis 2.10]
          Length = 402

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 154/396 (38%), Positives = 225/396 (56%), Gaps = 3/396 (0%)

Query: 19  MP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINA 77
           MP + SA + V + AG RNER E++G+AHFLEHM FKGT +R+A EI E IE VGG INA
Sbjct: 1   MPGLQSAAIGVWVTAGGRNERIEQNGIAHFLEHMAFKGTKRRSALEIAEAIEDVGGYINA 60

Query: 78  YTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDF 137
           YTS E T+Y+A VL+E VPLAL+++ D++ N  F+P +IE ER V+L+EIG + D   D 
Sbjct: 61  YTSREVTAYYARVLQEDVPLALDVVADIVLNPVFDPREIEIERGVILQEIGQALDTPDDV 120

Query: 138 LDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFC 197
           +     E  + DQ IGR ILG  E + +F  E +  FV  +Y   +M +   GAVDH+  
Sbjct: 121 IFDWLQEESYHDQPIGRTILGPAERVRAFDREDLERFVGEHYGPGQMILAASGAVDHDAI 180

Query: 198 VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNI 257
           V   E  F   S  K       A + GGE  Q++ L + H+ L F G  Y+    Y   I
Sbjct: 181 VQLAEELFGGMS-PKTLVMPAAATFTGGEARQEKALEQAHIALAFEGPGYRDDAIYTAQI 239

Query: 258 LASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVE 317
            +S LG GMSSRLFQEVREKRGLCY+I A    ++D G L + + T+ + +  L    ++
Sbjct: 240 YSSALGGGMSSRLFQEVREKRGLCYTIFAQTGAYADTGTLTLYAGTSGDQLDELAGITID 299

Query: 318 VVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTIS 377
            ++    ++   E+D+  A++ A ++   E    RA  +++ V     +   E  +  I 
Sbjct: 300 EMKRAASDMSDAEVDRARAQMKAGMLMGLESPTNRAERLARLVQIWDEVPPLEDTVARID 359

Query: 378 AITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTTS 412
           A+T  D+  +A+ +   ++  LA+ GP  D  P  +
Sbjct: 360 AVTTADVRAMAEDMAHRASMALALYGPVGDAAPLAA 395


>gi|83943957|ref|ZP_00956414.1| peptidase, M16 family protein [Sulfitobacter sp. EE-36]
 gi|83845204|gb|EAP83084.1| peptidase, M16 family protein [Sulfitobacter sp. EE-36]
          Length = 420

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 158/415 (38%), Positives = 237/415 (57%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+L+  + S+G  ++TE MP + SA + V + AG+R+E   ++G+AHFLEHM FKGT KR
Sbjct: 1   MSLQQHRLSNGFRIVTEHMPGLASASIGVWVSAGARHETATQNGIAHFLEHMAFKGTAKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+ +I E IE VGG INAYTS E T+Y+  VL+  V L L++I D+L N   +  +IE E
Sbjct: 61  TSLQIAEAIEDVGGYINAYTSREVTAYYVRVLENDVSLGLDVIADILRNPVLDNGEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + +Q IGR ILG  E +S+F+ E +  F+S++Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEKAYPNQPIGRTILGPSERVSNFSREDLSGFISQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAVDH+  V   E  F       + + +  A + GGE  Q + L + H  
Sbjct: 181 GPDQMILAAAGAVDHDEIVRLAEQLFGDMPPKPLFD-VDAAKFSGGEVRQLKPLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y++ D Y+  I AS LG GMSSRLFQEVRE RGLCY+I A    ++D G++ I
Sbjct: 240 LGFEAPGYRADDIYVAQIYASALGGGMSSRLFQEVRENRGLCYTIFAQAGAYADTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++    ++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEQLPELAGITIDEMKRAASDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +     +   E+ I  I A+T  D+   A+ I +S P    L  P+D  PT  EL
Sbjct: 360 IQIWDRVPPLEETIAQIDAVTTGDVRDFAQNIAASAPAALALYGPVDGAPTLEEL 414


>gi|84685595|ref|ZP_01013492.1| peptidase, M16 family protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666261|gb|EAQ12734.1| peptidase, M16 family protein [Rhodobacterales bacterium HTCC2654]
          Length = 420

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 153/420 (36%), Positives = 232/420 (55%), Gaps = 4/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +      +G  V+TE MP I+S  + V I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTINYDTLPNGFRVVTEHMPGIESVSLGVWITAGGRHERVEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T  +I EEIE VGG +NAYT  E T+Y+A VL+E   LA++++ D+L N  F+P +IE E
Sbjct: 61  TPLQIAEEIEDVGGYLNAYTGREVTAYYARVLREDTALAIDVVSDILLNPVFDPHEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E+ +  Q IGRPILG  E + +F    +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEVAYPGQAIGRPILGPAERVQAFAQGDLAGFVDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             DRM     GAVDH+  +   E  F           ++PA +VGGE  + + L + H  
Sbjct: 181 GPDRMIFAAAGAVDHDEIMRLCEQAFGGLQRPS-STLIQPAGFVGGERSEIKKLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G  Y+    Y   + A+ LG GMSSRLFQE REKRGLCY+I +    +SD G++ I
Sbjct: 240 LALEGPGYRDDAIYTAQVYANALGGGMSSRLFQEAREKRGLCYTIFSQAGAWSDTGLITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   I  L    ++ ++    ++ + E+ +  A++ A ++   E +  RA  +++Q
Sbjct: 300 YAGTSAGEIKGLAELTIDELRRATSDMTEAEVARARAQMRAGMLMGLESASSRAERLARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHAL 418
           V     ++  E+ ++ + A+T E +   A ++       LAI G P    P+ ++L   L
Sbjct: 360 VAIWNRVVPVEETVERLDAVTLEGVTDFATQVAGDPRAALAIYG-PGKTAPSLAQLTERL 418


>gi|163738388|ref|ZP_02145803.1| peptidase, M16 family protein [Phaeobacter gallaeciensis BS107]
 gi|161388309|gb|EDQ12663.1| peptidase, M16 family protein [Phaeobacter gallaeciensis BS107]
          Length = 402

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 153/396 (38%), Positives = 225/396 (56%), Gaps = 3/396 (0%)

Query: 19  MP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINA 77
           MP + SA + V + AG RNER E++G+AHFLEHM FKGT +R+A EI E IE VGG INA
Sbjct: 1   MPGLQSAAIGVWVTAGGRNERIEQNGIAHFLEHMAFKGTKRRSALEIAEAIEDVGGYINA 60

Query: 78  YTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDF 137
           YTS E T+Y+A VL+E VPLAL+++ D++ N  F+P +IE ER V+L+EIG + D   D 
Sbjct: 61  YTSREVTAYYARVLQEDVPLALDVVADIVLNPVFDPREIEIERGVILQEIGQALDTPDDV 120

Query: 138 LDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFC 197
           +     E  + DQ IGR ILG  E + +F  E +  FV  +Y   +M +   GAVDH+  
Sbjct: 121 IFDWLQEESYHDQPIGRTILGPAERVRAFDREDLERFVGEHYGPGQMILAASGAVDHDTI 180

Query: 198 VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNI 257
           V   E  F   +  K       A + GGE  Q++ L + H+ L F G  Y+    Y   I
Sbjct: 181 VQLAEELFGGMA-PKTLVMPAAATFTGGEARQEKALEQAHIALAFEGPGYRDDAIYTAQI 239

Query: 258 LASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVE 317
            +S LG GMSSRLFQEVREKRGLCY+I A    ++D G L + + T+ + +  L    ++
Sbjct: 240 YSSALGGGMSSRLFQEVREKRGLCYTIFAQTGAYADTGTLTLYAGTSGDQLDELAGITID 299

Query: 318 VVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTIS 377
            ++    ++   E+D+  A++ A ++   E    RA  +++ V     +   E  +  I 
Sbjct: 300 EMKRAASDMSDAEVDRARAQMKAGMLMGLESPTNRAERLARLVQIWDEVPPLEDTVARID 359

Query: 378 AITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTTS 412
           A+T  D+  +A+ +   ++  LA+ GP  D  P  +
Sbjct: 360 AVTTADVRAMAEDMAHRASMALALYGPVGDAAPLAA 395


>gi|114770417|ref|ZP_01447955.1| peptidase, M16 family protein [alpha proteobacterium HTCC2255]
 gi|114549254|gb|EAU52137.1| peptidase, M16 family protein [alpha proteobacterium HTCC2255]
          Length = 421

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 244/418 (58%), Gaps = 11/418 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+RI+   +G  +++E M  + SA + V + AG RNE  +++G+AHFLEHM FKGT KR 
Sbjct: 4   NVRITTLDNGFRIVSERMSGLKSASLGVWVNAGCRNESFKQNGIAHFLEHMAFKGTKKRN 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI E IE VGG INAYTS E T+Y+  VL+  VPLAL++I D++ NS F+P ++E ER
Sbjct: 64  ALEIAEAIEDVGGYINAYTSREMTAYYVRVLENDVPLALDVISDIVLNSVFDPKELEIER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG S D   D +     +  + +Q +GR ILG  E + SF  + + +FV+ +Y 
Sbjct: 124 GVILQEIGQSLDTPDDIIFDWLQDTAYPNQAMGRAILGSTENVRSFNRKDLQNFVNEHYG 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            ++M +   GAVDH+  V + +  F       +K + K    P+ ++GGE    ++L + 
Sbjct: 184 PEQMVLSAAGAVDHDALVKEAKILF-----GGLKRTSKFLNEPSNFIGGEVRVIKNLEQA 238

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H  L F   +Y   + Y   I AS LG GMSSRLFQE+REKRGLCYSI A    F+D+G+
Sbjct: 239 HFALSFESASYLDDNIYTAQIYASALGGGMSSRLFQEIREKRGLCYSIYASAGAFADSGM 298

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
           + I S T+ ++I  L +  ++ ++    +I   E+ +  A++ A ++   E +  R   +
Sbjct: 299 MTIYSGTSSDDISGLANITIDEIKRSAADITDEEVARSRAQMKAGMLMGLEGASSRCERL 358

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           ++ ++    +   ++II  I A++   +   A+ +  S+   A+ G P++  P  ++L
Sbjct: 359 ARTILIFNRVPDLDEIISKIDAVSASHVKNFAQSLCESSIAYALYG-PVEGAPDVNDL 415


>gi|221638238|ref|YP_002524500.1| Processing peptidase [Rhodobacter sphaeroides KD131]
 gi|221159019|gb|ACL99998.1| Processing peptidase [Rhodobacter sphaeroides KD131]
          Length = 419

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 149/404 (36%), Positives = 229/404 (56%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP + SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA  I EEIE VGG INAYTS E T+Y+A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  TALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +SSF    +  FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEERVSSFGRADLTRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH+  V+Q ++ F        +  M+PA ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHDRIVAQAQALFGHLKPVG-QRPMQPADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F    Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +     +   ++ ++ I A+T   +   A+++  +   LA+ GP
Sbjct: 360 LAIWDRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALALYGP 403


>gi|77462378|ref|YP_351882.1| M16 family peptidase [Rhodobacter sphaeroides 2.4.1]
 gi|77386796|gb|ABA77981.1| peptidase, M16 family [Rhodobacter sphaeroides 2.4.1]
          Length = 419

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/404 (36%), Positives = 229/404 (56%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP + SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A  I EEIE VGG INAYTS E T+Y+A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  SALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +S+F    +  FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEERVSTFGRADLTRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH   V+Q ++ F        +  M+PA ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHGRIVAQAQALFGHLKPVG-QRPMQPADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F    Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +   G +   ++ ++ I A+T   +   A+++  +   LA+ GP
Sbjct: 360 LAIWGRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALALYGP 403


>gi|89055639|ref|YP_511090.1| processing peptidase [Jannaschia sp. CCS1]
 gi|88865188|gb|ABD56065.1| processing peptidase [Jannaschia sp. CCS1]
          Length = 419

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/404 (36%), Positives = 230/404 (56%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G+ ++TE MP ++SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVELHTLENGLRIVTEYMPGLESAALGIWVSAGGRHERLEQNGIAHFLEHMAFKGTQRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I EEIE VGG INAYTS E T+Y+A VLK  V LAL++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEEIEDVGGYINAYTSREVTAYYARVLKNDVALALDLIGDIVLNPIFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +        + +Q +GR ILG  E + SF       FV+ NY
Sbjct: 121 RGVILQEIGQAADTPDDIIFDWLQAAAYPEQPLGRTILGPAERVQSFGRGDFDRFVAENY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              ++ +   GAVDH+  V   E  F     A  +   +P  + GGE+   + L + H  
Sbjct: 181 GPGQLILSAAGAVDHDEIVRLAEKAFGHLKPAP-QAVPQPGQFGGGEHRVVKGLEQAHFT 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L      Y+S D Y   I A+ LG GMSSRLFQE+REKRGLCY+I +   ++ D G+L I
Sbjct: 240 LALEAPGYRSDDIYTAQIFATALGGGMSSRLFQEIREKRGLCYTIYSQVGSYDDTGLLTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E++  L    V+ ++   + + + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEDLPDLVGLTVDELKRSADTMTEAELARARAQMKAGLLMGLESPSARAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +     I   E+ ++ I A+T   +   A  +  +   +A+ GP
Sbjct: 360 IAIWNRIPPLEESVERIDAVTLRGLGDHAAALGQAGTAMALYGP 403


>gi|163733561|ref|ZP_02141004.1| peptidase, M16 family, putative [Roseobacter litoralis Och 149]
 gi|161393349|gb|EDQ17675.1| peptidase, M16 family, putative [Roseobacter litoralis Och 149]
          Length = 420

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 154/415 (37%), Positives = 233/415 (56%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M L   +  +G  ++TE MP + SA + V + AG+R+E  +++G+AHFLEHM FKGT +R
Sbjct: 1   MTLNQHRLPNGFRIVTEHMPGLASASIGVWVTAGARHETPKQNGIAHFLEHMAFKGTKQR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N +   ++IE E
Sbjct: 61  TALQIAESIEDVGGYINAYTSREVTAYYARVLQNDVPLALDVIADILLNPTLEEAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E  + D  +GR ILG  E +S F+   +  F+ ++Y
Sbjct: 121 RGVILQEIGQSLDTPDDVIFDWLQEEAYPDHPMGRTILGPTERVSQFSRADLQHFIGQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   E  F     AK    +  A ++GGE  Q + L + H  
Sbjct: 181 GPEQMILSAAGAVDHDAIVRVAEELFGGMQ-AKPMFDVDAAQFLGGERRQTKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I AS LG GMSSRLFQE+RE RGLCYSI A    ++D G+  I
Sbjct: 240 LAFESPGYRDDRIYTAQIYASALGGGMSSRLFQEIRENRGLCYSIFAQAGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++  ++++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLGQLAEITIDEMKRAVDDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V     +   ++ +  I A+T  D+   A++I  S P    L  P++  PT + L
Sbjct: 360 VQIWDRVPPLDETVAMIDAVTTGDVREFAREIAESAPAALALYGPVEGAPTLAAL 414


>gi|254510793|ref|ZP_05122860.1| hypothetical protein RKLH11_1328 [Rhodobacteraceae bacterium KLH11]
 gi|221534504|gb|EEE37492.1| hypothetical protein RKLH11_1328 [Rhodobacteraceae bacterium KLH11]
          Length = 420

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 237/417 (56%), Gaps = 6/417 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R  +  +G  +++E MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRQDQLKNGFRIVSEHMPGLQSAAIGIWVTAGGRHERIEQNGIAHFLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VLK+ V LA+++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLKDDVALAMDVIGDIVLNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + +Q +GR ILG  E +S+F+ E +  FV+ +Y
Sbjct: 121 RGVILQEIGQAYDTPDDVIFDWLQEQSYHNQPLGRTILGPSERVSAFSREDLSGFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK--IKESMKPAVYVGGEYIQKRDLAEEH 237
             ++M +   GAVDH+  +   E  F      K  I E+ +   + GGE  Q+++L + H
Sbjct: 181 GPEQMILSAAGAVDHDALMKMAEDMFGHLQPRKGLIPETAR---FTGGEARQEKELEQAH 237

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
             L      Y+    Y   I ++ LG GMSSRLFQEVRE RGLCY+I A    ++D G  
Sbjct: 238 FALALESPGYRDDAIYTAQIYSTALGGGMSSRLFQEVRETRGLCYTIFAQTGAYADTGTT 297

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T+ + +  L +  ++ ++   E++   E+ +  A++ A ++   E    RA  ++
Sbjct: 298 TIYAGTSADQVAELAAITIDEMKRAAEDMSVEEVARARAQMKAGMLMGLESPSNRAERLA 357

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           + V   G +   E  +  I A+   D+   A+++    P    L  P+   P+ ++L
Sbjct: 358 RLVQIWGRVPSLEDTVAKIDAVGIGDVRDFAEQMAVQAPAALALYGPVSGAPSLAQL 414


>gi|154251134|ref|YP_001411958.1| peptidase M16 domain-containing protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154155084|gb|ABS62301.1| peptidase M16 domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 424

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 146/406 (35%), Positives = 241/406 (59%), Gaps = 5/406 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ +++  +G+T++T+ MP + +  V V +  G+R+E   EHG++H LEHM FKGT +R
Sbjct: 1   MSVEVTRLENGLTIVTDSMPHLQTTSVGVWVNTGARHESVREHGVSHMLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A  I EEIE VGG +NA+T+ E T+Y+A VL++ +PLA++I+ D+L NS F+P ++ERE
Sbjct: 61  SALAIAEEIETVGGHLNAHTTHEATAYYARVLRQDLPLAVDILSDILQNSVFDPEEVERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V++ EIG + D   D +     E  +  Q +GR ILG  +T+S+F+ +++  ++ + Y
Sbjct: 121 RGVIISEIGQAHDTPDDVVFDDLLEAAYPGQPLGRSILGTVDTVSAFSRDELQGYMGQRY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   G ++HE  V      F      ++    + AV+  GE  + RDL + H+ 
Sbjct: 181 LAPGMVLAAAGGLEHEQLVRLARERFGDLP-RRVTNGAERAVFSSGERRKDRDLEQVHLA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y   D+Y   + + +LG GMSSRLFQEVREKRGLCYS+ A   +F+D GV  +
Sbjct: 240 LAFEGPTYGDPDYYTAQVFSGVLGGGMSSRLFQEVREKRGLCYSVFAFSWSFADTGVFGL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + TA +++  L   +   +  + E+  + E  +  A+I A L+   E S  RA +I++Q
Sbjct: 300 YAGTAPDHVAELMPVLSGEMGRIGEDATEEETARARAQIKAGLLMGLESSSSRAEQIARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAI--LGP 403
            M  G +L  ++++  + A+    +   A ++ S  P LA+  +GP
Sbjct: 360 YMIHGRVLPIDELVAKVDAVDAAAVRRYAGRLLSG-PGLALSAIGP 404


>gi|295399862|ref|ZP_06809843.1| processing peptidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312111626|ref|YP_003989942.1| processing peptidase [Geobacillus sp. Y4.1MC1]
 gi|294978265|gb|EFG53862.1| processing peptidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311216727|gb|ADP75331.1| processing peptidase [Geobacillus sp. Y4.1MC1]
          Length = 413

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/397 (37%), Positives = 238/397 (59%), Gaps = 5/397 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + V I  GSRNE ++ +G++HFLEHM FKGTT RTAKEI E  
Sbjct: 9   NGVRIVLEQIPTVRSVAIGVWIGTGSRNETEQNNGISHFLEHMFFKGTTTRTAKEIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   ALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHASFALEMLADMFFHSTFVDEELQKERNVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET+ +FT + +  +++  YT DR+ +  
Sbjct: 129 MYEDTPDDIVHDLLSKACYANHPLGYPILGTEETLRTFTGDSLRGYMADYYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G VD  F + +VESYF   + AK K S  PA ++   +  ++++  + H+ +GFNG   
Sbjct: 189 AGNVDESF-IQKVESYFGFFT-AKRKASESPAPLFQPQKLARQKETEQAHLCIGFNGLPV 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D Y   +L +ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G+L I + T    
Sbjct: 247 GHPDIYTLIVLNNILGGSMSSRLFQEVREQRGLAYSVFSYHSSYQDSGLLAIYAGTGNSQ 306

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  +I E ++ L E+ I ++E+     ++   L+   E +  R     K  +  G  
Sbjct: 307 LDLLFETIQETIEKLKEDGITEKELKNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              ++II+ I+ +T E +  +A++IF+    LA++ P
Sbjct: 367 RTLDEIIEEINGVTVEKVNELARRIFAEDCALALISP 403


>gi|146276673|ref|YP_001166832.1| processing peptidase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554914|gb|ABP69527.1| processing peptidase [Rhodobacter sphaeroides ATCC 17025]
          Length = 419

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 145/404 (35%), Positives = 232/404 (57%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP + SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWITAGGRHERPEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I EEIE VGG INAYTS E T+++A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  TALQIAEEIEDVGGYINAYTSREMTAFYARVLEADTALALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +SSFT + +  FV   Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQSFGRTILGPEERVSSFTRDDLTRFVGEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH+  ++Q ++ F        +  M+ A ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHQKILAQAQALFGHLKPVG-RRPMQRADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F   +Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPSYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++   +++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTIDELRRATDDMSEAEVARARAQLKAGLLMGLESPSSRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +   G +   ++ ++ I ++T   +   A+++  +   LA+ GP
Sbjct: 360 LAIWGRVPGVDEAVEKIDSVTVAAVRDYAERMAQARSALALYGP 403


>gi|73667388|ref|YP_303404.1| insulinase-like:peptidase M16, C-terminal [Ehrlichia canis str.
           Jake]
 gi|72394529|gb|AAZ68806.1| Insulinase-like:Peptidase M16, C-terminal [Ehrlichia canis str.
           Jake]
          Length = 421

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 145/419 (34%), Positives = 249/419 (59%), Gaps = 5/419 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+  I++  +  T+IT+ MP ++S  + + I  GSR E     G++HFLEHM FKGT  R
Sbjct: 1   MSPSITQFRNNFTIITDTMPHVESISINIWINVGSRYENTNITGISHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I +  + +GG+ NA+T  EHT YH   LK  + +A+E++ D++ NS F   +I+RE
Sbjct: 61  TALDIAQIFDDIGGNFNAHTDREHTVYHVKTLKRDIKIAIEVLADIILNSQFPQEEIDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL+EI  + D     +  ++ E  + +QI G+ ILG PE++++ + E + +++S  Y
Sbjct: 121 KGVVLQEIYQTNDSPTSIIFDKYIEAAYPNQIFGKSILGTPESVTNLSKEDLQTYMSEYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   G + HE  +  V  +F+    ++ K +  P+VY  GEY + R+L + H++
Sbjct: 181 HAGNMLLSVAGNITHEEVIDLVSQHFSNMKKSEPK-TAAPSVYYSGEYREIRNLEQVHLV 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF   +Y+   FY   IL SILG+GMSSRLFQ++RE+ GL Y+IS+ + ++SDNG+  I
Sbjct: 240 IGFPSVSYKDDLFYTIQILDSILGNGMSSRLFQKIREQLGLVYTISSFNSSYSDNGIFSI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT K N++ L ++I   V+S+  N+E+ EI +   K+ ++++ S+E +  RA  +   
Sbjct: 300 YAATDKNNLIQLLTTIASEVKSITMNLEENEITRAKGKLISEILMSRESTTARAESLGYY 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSELIH 416
                  +  E++I  IS IT  D+      +  S    TLA +G  ++++P+  +++ 
Sbjct: 360 YSHYNRYILKEELIKKISEITLTDLQNCIHNLLGSNNKITLAAIG-QIENLPSYGDIVQ 417


>gi|218510454|ref|ZP_03508332.1| probable processing peptidase protein [Rhizobium etli Brasil 5]
          Length = 338

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 208/322 (64%), Gaps = 7/322 (2%)

Query: 94  HVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIG 153
           HVPLA++I+ D+L+ S+F   ++ERE+ V+L+EI  + D   D +  RFSE  ++DQ +G
Sbjct: 1   HVPLAVDILADILTESAFEEEELEREKQVILQEINAANDTPDDVVFDRFSEAAYRDQTLG 60

Query: 154 RPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAK 212
           RPILG P+T+ SFTP++I +++ RNYT DRM+VV  GAVDHE  +  VE  F ++ +   
Sbjct: 61  RPILGTPQTVVSFTPQQIRTYLGRNYTTDRMFVVATGAVDHEEFLRMVEDRFASLPTSPS 120

Query: 213 IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQ 272
               M+ A Y+GG   + RDL +  ++LGF G  Y +RDFY + ILA+ILG GMSSRLFQ
Sbjct: 121 APPVMEAARYIGGSVREPRDLMDAQILLGFEGKPYHARDFYCSQILANILGGGMSSRLFQ 180

Query: 273 EVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREID 332
           EVRE RGLCYS+ A H  FSD G+  I +AT  EN+  L   I++ +      I Q+EI+
Sbjct: 181 EVREFRGLCYSVYAFHWGFSDTGIFGIHAATGGENLPELVPVIIDELHKSANEIHQKEIE 240

Query: 333 KECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           +  A+I A+L+  QE    RA +I++Q+M  G  + + ++++ +  IT E +  +A ++F
Sbjct: 241 RARAQIRAQLLMGQESPAARAGQIARQMMLYGRPISNPEMMERLEGITIERLTDLAGRLF 300

Query: 393 SST-PTLAILGP-----PMDHV 408
             T PTL+ +GP     PM+ +
Sbjct: 301 YDTVPTLSAIGPLEQLAPMEDI 322


>gi|83950046|ref|ZP_00958779.1| peptidase, M16 family protein [Roseovarius nubinhibens ISM]
 gi|83837945|gb|EAP77241.1| peptidase, M16 family protein [Roseovarius nubinhibens ISM]
          Length = 402

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 217/367 (59%), Gaps = 2/367 (0%)

Query: 19  MP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINA 77
           MP + SA + + + AG+RNE +E++G+AHFLEHM FKGT  R+A +I E IE VGG INA
Sbjct: 1   MPGLQSAAIGIWVLAGARNEHREQNGIAHFLEHMAFKGTATRSALDIAEAIENVGGYINA 60

Query: 78  YTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDF 137
           YTS E T+Y+A VLK+ VPLAL+++ D+L N  F+P +IE ER V+L+EIG + D   D 
Sbjct: 61  YTSREVTAYYARVLKQDVPLALDVVADILRNPVFDPKEIEIERGVILQEIGQALDTPDDV 120

Query: 138 LDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFC 197
           +     E  + D  +GR ILG  E + SF    +  FV+  Y   +M +   GAVDH+  
Sbjct: 121 IFDWLQEQAYPDHPLGRTILGPEERVRSFNRADLERFVAEQYQPQQMILSAAGAVDHDDL 180

Query: 198 VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNI 257
           V Q E+ F   +  +  E++ PA + GGE   ++ L + H  L F    Y     + + I
Sbjct: 181 VQQAEALFADMTRGE-AEAISPAKFAGGESRHEKQLEQAHFALAFESPNYCDSRIHASQI 239

Query: 258 LASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVE 317
            A+ LG  MSSRLFQEVREKRGLCYSI A    ++D G++ I + T+ E +  L    ++
Sbjct: 240 YATALGGSMSSRLFQEVREKRGLCYSIYASAGAYADTGMMTIYAGTSAEQLAGLAEITID 299

Query: 318 VVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTIS 377
            ++   E++   EI++  A++ A L+   E    RA  +++ V   G +   +++I  I 
Sbjct: 300 ELKRAAEDMRPDEIERARAQMKAGLLMGLESPSNRAERLARMVQIWGRVPPLDEVITRID 359

Query: 378 AITCEDI 384
           A+T +D+
Sbjct: 360 AVTLDDV 366


>gi|84516615|ref|ZP_01003974.1| peptidase, M16 family [Loktanella vestfoldensis SKA53]
 gi|84509651|gb|EAQ06109.1| peptidase, M16 family [Loktanella vestfoldensis SKA53]
          Length = 422

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 152/416 (36%), Positives = 232/416 (55%), Gaps = 2/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++    S+G+ ++TE MP + S  + + + AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTIQQHTLSNGLRIVTEQMPGLKSTSIGIWVLAGGRHERIEQNGIAHFLEHMAFKGTKSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E+IE VGG INAYTS E T+Y+A VL++ V L L+II D+L N  F  ++IE E
Sbjct: 61  TALQIAEQIEDVGGYINAYTSREMTAYYARVLEDDVALGLDIIADILLNPLFEDAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ +GR ILG+   +S+F    +  FV+ +Y
Sbjct: 121 RGVILQEIGQTLDTPDDIIFDWLQEEAYPDQPLGRSILGEAARVSTFAKGDLDRFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             ++M +   GAVDH+  V Q E+ F ++  V +    ++PA ++GGE    + L + H 
Sbjct: 181 GPNQMILAAAGAVDHDAIVRQAEALFGHLPRVERAAGLLQPAKFIGGERRATKALEQVHF 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G  Y+    Y   I A+ LG GMSSRLFQE+RE RGLCY+I A    + D G+  
Sbjct: 241 ALALEGPTYRDPAIYTAQIYATALGGGMSSRLFQEIRENRGLCYTIFAQAGAYEDTGMTT 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I + T+ E I  L    ++ ++   +++   E+ +  A++ A ++   E    RA  +++
Sbjct: 301 IYAGTSAEQIAELAHLTIDEMKRAADDMSDAEVARARAQMKAGMLMGLESPSNRAERLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
            +     I   E+ I  I  +T  D+   A ++     T   L  P D  PT   L
Sbjct: 361 LLSIWDRIPGIEETIAHIDDVTTGDVKTFAAQMAGQVGTALALYGPADQAPTLDAL 416


>gi|260428266|ref|ZP_05782245.1| processing peptidase subunit beta [Citreicella sp. SE45]
 gi|260422758|gb|EEX16009.1| processing peptidase subunit beta [Citreicella sp. SE45]
          Length = 420

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 146/385 (37%), Positives = 224/385 (58%), Gaps = 2/385 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  +   +G+ +++E M  + SA + + + AG RNER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVEQTTLKNGLRIVSERMDGLQSASLGIWVTAGGRNERVEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL+   PLA+++IGD+L N  F+  +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLENDTPLAMDVIGDILMNPVFDTREIETE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +++Q +GR ILG+   + +F  E + +FV+ +Y
Sbjct: 121 RHVILQEIGQALDTPDDVIFDWLQERAYQNQPLGRTILGEAANVKAFGREDLETFVTEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH   V Q E+ F   S  K   + + A + GGE   ++ L + H  
Sbjct: 181 GPEQMILSAAGAVDHGALVKQAEALFGGLSSRK-SNAPEGARFTGGETRHEKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y    FY   I A  LG GMSSRLFQE+REKRGLCY+I A    ++D G+  I
Sbjct: 240 LAFEGPGYSDPAFYAAQIYAIALGGGMSSRLFQEIREKRGLCYTIFAQTGAYADTGLTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++   E++   E+ +  A++ A L+   E S  RA  +++ 
Sbjct: 300 YAGTSGEELGELAGITIDEMKRAAEDMSPEEVARARAQMKAGLLMGLESSSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDI 384
           V   G +   E+ +  I  +T  D+
Sbjct: 360 VQIWGEVPAIEETVARIDNVTTGDV 384


>gi|149200830|ref|ZP_01877805.1| peptidase, M16 family protein [Roseovarius sp. TM1035]
 gi|149145163|gb|EDM33189.1| peptidase, M16 family protein [Roseovarius sp. TM1035]
          Length = 402

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/395 (37%), Positives = 221/395 (55%), Gaps = 6/395 (1%)

Query: 19  MP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINA 77
           MP + SA + V + AG+R+E   ++G+AHFLEHM FKGT +R+A +I E IE VGG INA
Sbjct: 1   MPGLQSAAIGVWVLAGARHEEASQNGIAHFLEHMAFKGTKRRSALQIAEAIEDVGGYINA 60

Query: 78  YTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDF 137
           YTS E T+Y+  VLKE VPLAL+++ D+L N  F+P +IE ER V+L+EIG + D   D 
Sbjct: 61  YTSREVTAYYVRVLKEDVPLALDVVSDILRNPVFDPREIEVERGVILQEIGQAADTPDDI 120

Query: 138 LDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFC 197
           +     E  + D  +GR ILG  E +  F    +  FV + Y   +M +   GAVDHE  
Sbjct: 121 IFDWLQEKAYPDHPLGRTILGAEERVRGFDRPDLERFVDQYYRPGQMVLSAAGAVDHEAL 180

Query: 198 VSQVESYFNVCSVAKIKESMKPAV--YVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLT 255
           V   E  F     +    +++P V  + GGE    +DL + H  L F    Y   D Y  
Sbjct: 181 VRMAEGVFGDMIPS---HAIEPPVARFAGGETRHVKDLEQAHFALAFESPDYAHPDIYTA 237

Query: 256 NILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSI 315
            I AS LG  MSSRLFQE+RE+RGLCYSI A    +SD G++ I + T+ E +  L    
Sbjct: 238 QIYASALGGSMSSRLFQEIRERRGLCYSIYAQAGAYSDTGMMTIYAGTSGEQLGDLAGIT 297

Query: 316 VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDT 375
           ++ ++   E++   E+++  A++ A L+   E    RA  +++ +   G +    ++++ 
Sbjct: 298 IDEMKRAAEDMSAAEVERARAQMKAGLLMGLESPSNRAERLARMLQIWGRVPTLPEVVER 357

Query: 376 ISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           I A+T  D+  +A+   +  P    L  P++  PT
Sbjct: 358 IDAVTLADVRRLAESTVAQAPAALALYGPVEQAPT 392


>gi|68171230|ref|ZP_00544634.1| Insulinase-like:Peptidase M16, C-terminal [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88657608|ref|YP_507056.1| M16 family peptidase [Ehrlichia chaffeensis str. Arkansas]
 gi|67999350|gb|EAM85995.1| Insulinase-like:Peptidase M16, C-terminal [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88599065|gb|ABD44534.1| peptidase, M16 family [Ehrlichia chaffeensis str. Arkansas]
          Length = 421

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 143/417 (34%), Positives = 247/417 (59%), Gaps = 5/417 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ +I++ S+  T+IT+ MP ++S  + + +  GSR E     G++HFLEHM FKGT  R
Sbjct: 1   MSPKITQLSNNFTIITDTMPYVESVSINIWVNVGSRYENINITGISHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I +  + +GG+ NA+T  EHT YH   LK  + +A+E++ D++ NS F   +I +E
Sbjct: 61  TALDIAQIFDDIGGNFNAHTDREHTVYHVKTLKRDIKIAIEVLADIILNSQFPEEEIYKE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL+EI  + D     +  ++ E  + +QI G+ ILG PE+++S +   +  ++S  Y
Sbjct: 121 KGVVLQEIYQTNDSPTSIIFDKYIEAAYPNQIFGKSILGTPESVNSLSKADLHIYMSEYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   G + HE  +  V  YF+    ++ ++   P++Y  GEY + R+L + H++
Sbjct: 181 HAGNMLLSVAGNISHEEVIDLVSQYFSHMKKSQ-RKIADPSIYRSGEYREIRNLEQVHLV 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF   +Y+   FY   IL SILG+GMSSRLFQ++RE+ GL Y+IS+ + ++SDNG+  I
Sbjct: 240 IGFPSVSYKDDLFYTIQILDSILGNGMSSRLFQKIREQLGLVYTISSFNSSYSDNGIFSI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT K N+  L S+I   V++++ N+++ EI +   K+ ++++ S+E +  RA  +   
Sbjct: 300 YAATDKSNLSQLLSTIASEVKNIITNLQENEITRAKGKLTSEILMSRESTTARAESLGYY 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSEL 414
                  +  E++I  IS IT  DI      +  S    TLA +G  ++++P+  ++
Sbjct: 360 YSHYNRYISKEELIKKISTITVTDIQNCINNLLGSNNKITLAAIG-QIENLPSYDDI 415


>gi|260893499|ref|YP_003239596.1| peptidase M16 domain protein [Ammonifex degensii KC4]
 gi|260865640|gb|ACX52746.1| peptidase M16 domain protein [Ammonifex degensii KC4]
          Length = 418

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 140/403 (34%), Positives = 233/403 (57%), Gaps = 4/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++++   +G+T++TE +P + S  + + + AGSR+E   ++G++HF+EH LFKGT  R+A
Sbjct: 2   VKVTDLGNGVTILTEEIPHVRSVALGIWVAAGSRDEEANQNGISHFIEHALFKGTKNRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE+E VGG INA+T+ E+T Y+A VL E+  LA +++ D++ ++ F+P D+ERE+N
Sbjct: 62  RQIAEELESVGGQINAFTAKEYTCYYARVLDEYFELAADVLTDLVFHARFDPQDLEREKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED   + +   FS  +WKD  +GRP++G  ET+ + T E+I  +  R+Y  
Sbjct: 122 VILEEIRMYEDTPDELVHDLFSATLWKDHPLGRPVIGTEETVKNLTSEEIFRYYERHYLR 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM V   G V HE  V  +   F            +P  + G  +   R   + H+ LG
Sbjct: 182 GRMVVAVAGNVTHERAVDLLAPRFAAVKEESRSPGDQPRPWFGSNFFL-RSTEQVHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G A    D Y   +L ++LG GMSSRLFQ+VRE+ GL YS+ ++H  + D G+  I +
Sbjct: 241 TPGLAMGDDDIYTFQVLNTLLGGGMSSRLFQKVREEGGLVYSVYSYHSAYRDTGLFCIYA 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             A EN+     +IVE ++ +   ++   E+++   ++    + S E    R   + K  
Sbjct: 301 GLAAENVPRALQAIVEELKKVCRSDLSPEEVERAKNQLKGSFLLSLESVTTRMSRLGKSW 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           ++ G +L  E++ + I+A+T E +  +A++ F  S   L  LG
Sbjct: 361 LYLGRVLSPEEVAERITAVTLEQVQALARRFFHPSGLVLTTLG 403


>gi|58617499|ref|YP_196698.1| putative protease [Ehrlichia ruminantium str. Gardel]
 gi|58417111|emb|CAI28224.1| Hypothetical zinc protease [Ehrlichia ruminantium str. Gardel]
          Length = 421

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 144/401 (35%), Positives = 243/401 (60%), Gaps = 4/401 (0%)

Query: 5   ISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           I++ S+  T+IT+ MP ++S  + + +  GSR+E     G++HFLEHM FKGT  RTA +
Sbjct: 5   ITQLSNSFTIITDTMPYVESVSINIWVNVGSRHENTNIAGISHFLEHMAFKGTKTRTALD 64

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I +  + +GG+ NA+T  EHT YH  +LK  + +A+E++ D++ NS F   +I+RE+ VV
Sbjct: 65  IAQIFDNIGGNFNAHTDREHTVYHVKILKRDIKIAIEVLADIILNSQFPQEEIDREKGVV 124

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E  + +Q+ G+ ILG PE++S+ + E + +++  +Y A  
Sbjct: 125 LQEIYQTNDSPTSIIFDKYIEAAYPNQVFGKSILGTPESVSNLSKENLHTYMQEHYHAGN 184

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   G + H   +     YF+    +  +E+ K +VY+ GEY ++RDL + H+++GF 
Sbjct: 185 MLLSVAGNITHNEVIDLATQYFSQIKKSTPQETNK-SVYISGEYREERDLEQVHIVIGFP 243

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
             +Y+   FY+  IL SILG+GMSSRLFQ++RE+ GL YSIS+ + ++SDNG+  I +AT
Sbjct: 244 SSSYKDDQFYVIQILDSILGNGMSSRLFQKIREQLGLVYSISSFNSSYSDNGIFSIYTAT 303

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            K N+  L  +I   VQS+  N+E+ E+ +   K+ ++++ S+E +  RA  +       
Sbjct: 304 DKNNLPQLLDAIAAEVQSIYINLEENEVIRAKDKLTSEILMSRESTTARAESLGYYYSHY 363

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILG 402
              +  E+++  IS IT EDI+    ++  S    TLA +G
Sbjct: 364 NRYITKEELLKKISEITMEDILNCISRLLRSNNKITLAAIG 404


>gi|239826665|ref|YP_002949289.1| processing peptidase [Geobacillus sp. WCH70]
 gi|239806958|gb|ACS24023.1| processing peptidase [Geobacillus sp. WCH70]
          Length = 413

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 146/395 (36%), Positives = 236/395 (59%), Gaps = 5/395 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGT  RTA+EI E  
Sbjct: 10  NGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQNNGISHFLEHMFFKGTKTRTAREIAEAF 69

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   ALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 70  DSIGGQVNAFTSKEYTCYYAKVLDEHASFALEMLADMFFHSTFVDEELQKERNVVLEEIR 129

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET+ +FT + +  +++  YT DR+ +  
Sbjct: 130 MYEDTPDDIVHDLLSKACYANHPLGYPILGTEETLRTFTGDSLRGYMADYYTPDRVVISI 189

Query: 189 VGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G VD  F + QVESYF +  +  K  ES  P ++   + ++++D  + H+ +GFNG   
Sbjct: 190 AGNVDESF-IQQVESYFGSFTAKQKASESQAP-LFQPQKLVRQKDTEQAHLCIGFNGLPV 247

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G+L I + T    
Sbjct: 248 GHPDIYTLIILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSSYQDSGLLAIYAGTGNNQ 307

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  +I E + +L E+ I ++E+     ++   L+   E +  R     K  +  G  
Sbjct: 308 LDLLFETIQETIDALKEDGITEKELKNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRH 367

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
              ++II+ I+++T E +  +A+ IF+    LA++
Sbjct: 368 RSLDEIIEEINSVTVEKVNELARSIFNEDYALALI 402


>gi|254488946|ref|ZP_05102151.1| protease [Roseobacter sp. GAI101]
 gi|214045815|gb|EEB86453.1| protease [Roseobacter sp. GAI101]
          Length = 420

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 154/415 (37%), Positives = 238/415 (57%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+L+  + S+G  ++TE MP + SA + V + AG+R+E  +++G+AHFLEHM FKGT KR
Sbjct: 1   MSLQQHRLSNGFRIVTEHMPGLASASIGVWVTAGARHETPQQNGIAHFLEHMAFKGTAKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+ +I E IE VGG INAYTS E T+Y+  VL+  V L L++I D+L N   + ++IE E
Sbjct: 61  TSLQIAEAIEDVGGYINAYTSREVTAYYVRVLENDVSLGLDVIADILRNPVLDNNEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + +Q +GR ILG  E +S F+ E +  F+ ++Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEEAYPNQPLGRTILGPSEAVSRFSREDLSGFIDQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAVDH+  V   E  F      K    +  A + GGE  Q + L + H  
Sbjct: 181 GPDQMILAAAGAVDHDEIVRLAEQLFGDMP-KKPMFDVDAAKFTGGELRQVKTLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y++ D Y+  I AS LG GMSSRLFQEVRE RGLCY+I A    ++D G++ I
Sbjct: 240 LGFESPGYRADDIYVAQIYASALGGGMSSRLFQEVRENRGLCYTIFAQAGAYADTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++    ++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEQLPELAGITIDEMKRAASDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +     +   E+ I  I A+T  D+   A+ + ++ P    L  P+++ PT +EL
Sbjct: 360 IQIWDRVPPLEETIAQIDAVTTGDVRDFAQTMAATAPAALALYGPVENAPTLAEL 414


>gi|57239467|ref|YP_180603.1| putative protease [Ehrlichia ruminantium str. Welgevonden]
 gi|58579445|ref|YP_197657.1| putative protease [Ehrlichia ruminantium str. Welgevonden]
 gi|57161546|emb|CAH58473.1| putative zinc protease [Ehrlichia ruminantium str. Welgevonden]
 gi|58418071|emb|CAI27275.1| Hypothetical zinc protease [Ehrlichia ruminantium str. Welgevonden]
          Length = 421

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 143/401 (35%), Positives = 242/401 (60%), Gaps = 4/401 (0%)

Query: 5   ISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           I++ S+  T+IT+ MP ++S  + + +  GSR+E     G++HFLEHM FKGT  RTA +
Sbjct: 5   ITQLSNSFTIITDTMPYVESVSINIWVNVGSRHENTNIAGISHFLEHMAFKGTKTRTALD 64

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I +  + +GG+ NA+T  EHT YH  +LK  + +A+E++ D++ NS F   +I+RE+ VV
Sbjct: 65  IAQIFDNIGGNFNAHTDREHTVYHVKILKRDIKIAIEVLADIILNSQFPQEEIDREKGVV 124

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E  + +Q+ G+ ILG PE++S+ + E + +++  +Y A  
Sbjct: 125 LQEIYQTNDSPTSIIFDKYIEAAYPNQVFGKSILGTPESVSNLSKENLHTYMQEHYHAGN 184

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   G + H   +     YF+    +  +E+ K +VY+ GEY ++RDL + H+++GF 
Sbjct: 185 MLLSVAGNITHNEVIDLATQYFSQIKKSTPQETNK-SVYISGEYREERDLEQVHIVIGFP 243

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
             +Y+   FY+  IL SILG+GMSSRLFQ++RE+ GL YSIS+ + ++SDNG+  I +AT
Sbjct: 244 SSSYKDDQFYVIQILDSILGNGMSSRLFQKIREQLGLVYSISSFNSSYSDNGIFSIYTAT 303

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            K N+  L  +I   VQ +  N+E+ E+ +   K+ ++++ S+E +  RA  +       
Sbjct: 304 DKNNLPQLLDAIAAEVQGIYINLEENEVIRAKDKLTSEILMSRESTTARAESLGYYYSHY 363

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILG 402
              +  E+++  IS IT EDI+    ++  S    TLA +G
Sbjct: 364 NRYITKEELLKKISEITMEDILNCISRLLRSNNKITLAAIG 404


>gi|261419472|ref|YP_003253154.1| peptidase M16 domain protein [Geobacillus sp. Y412MC61]
 gi|261375929|gb|ACX78672.1| peptidase M16 domain protein [Geobacillus sp. Y412MC61]
          Length = 413

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/396 (35%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGTT RTA++I E  
Sbjct: 9   NGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQTNGISHFLEHMFFKGTTTRTARDIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERNVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     +  +    +G PILG  ET+ +FT + +  +++  YT DR+ +  
Sbjct: 129 MYEDTPDDIVHDLLGKACYAGHPLGYPILGTEETLRTFTGDTLRQYMADYYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F + +VE YF   +      S     +V  +  +K+D  + H+ +GFNG    
Sbjct: 189 AGNVDERF-IDEVERYFGSFAAESKPPSSGTPAFVPQKIARKKDTEQAHVCIGFNGLPIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I + T    +
Sbjct: 248 HPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYAGTGSSQL 307

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I + ++ L E+ + ++E+     ++   L+   E +  R     K  +  G   
Sbjct: 308 DVLFETIQQTIRQLKEDGVTEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ I ++T E +  +A+ +F+    LA++ P
Sbjct: 368 SLDEIIEEIESVTVEKVNELARTVFTDDYALALISP 403


>gi|99082169|ref|YP_614323.1| peptidase [Ruegeria sp. TM1040]
 gi|99038449|gb|ABF65061.1| peptidase [Ruegeria sp. TM1040]
          Length = 420

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 152/415 (36%), Positives = 235/415 (56%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++     +G  ++TE MP + SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKQDTLPNGFRIVTEYMPGLQSAALGIWVSAGGRHERLEQNGVAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A +LK+ V LAL++IGD++ NS F+  +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARILKDDVDLALDVIGDIVLNSVFDEREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  +++Q IGR ILG  E + SF  E +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEESYREQAIGRSILGPAERVRSFNKEDLTRFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V      F      K ++ ++ A + GGE    + L + H+ 
Sbjct: 181 GPGQMILSAAGAVDHDRLVKAATEMFGHLE-PKQQDVIECARFTGGEARHDKALEQAHVA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F   +Y++ D Y   I A+ LG GMSSRLFQEVREKRGLCY+I A    + D G++ I
Sbjct: 240 LAFESPSYRADDIYAAQIYAAALGGGMSSRLFQEVREKRGLCYTIFAQAGAYEDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    V+ ++   +++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGAQVSDLLGITVDELKRSADDMSDAEVERARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V     +   E  +  I A+T  D+  +A +I    P    L  P+   P   E+
Sbjct: 360 VQIWDRVPSLEDTVAKIDAVTTADVRAMAARISREAPAALALYGPVAEAPRLEEI 414


>gi|8708914|gb|AAF78805.1| mitochondrial processing peptidase-like protein Mpp [Bradyrhizobium
           japonicum]
          Length = 404

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/398 (35%), Positives = 232/398 (58%), Gaps = 3/398 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNE-RQEEHGMAHFLEHMLFKGTTK 58
           M++ ISK +SG+TV+T+ MP +++A + V    G  +E +  EHG++H LEHM FKGTTK
Sbjct: 1   MSVEISKLASGLTVVTDKMPHLETAALGVWAGVGGPHEGKPNEHGISHLLEHMAFKGTTK 60

Query: 59  RTAKE-IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
           R+++  IVEEIE VGGD+NA TS E TSY+A VLK  VPLAL+++ D+L+N +F P ++E
Sbjct: 61  RSSRRRIVEEIEAVGGDLNAGTSTETTSYYARVLKADVPLALDVLADILANPAFEPDELE 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           RE+NV+++EI  ++D   D +    +E+ + DQ +GR +LG  +++ +F  + +  ++S 
Sbjct: 121 REKNVIVQEIRAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTAKSLRAFNRDMLRGYLST 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           +Y    M V   GAVDH   V++ E  F         +        GG  +  R+L + H
Sbjct: 181 HYRGPDMVVAAAGAVDHSQVVAEAEKRFASFEGTPGPKPQAAQFGKGGAKVVHRELEQAH 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + L   G        +   +  +ILG GMS +LFQEVREKRGLCYSI + H  ++D G  
Sbjct: 241 LALALEGVPQNDLSLFSLQVFTNILGGGMSYQLFQEVREKRGLCYSIYSFHAPYTDTGFF 300

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            + + T   +   +   +V+V+   +E + + EI +  A++ A L+ + E    RA +++
Sbjct: 301 GLYTGTDPADAPEMMEVVVDVMNDSVETLTEAEIARAKAQMKAGLLMALESCSSRAEQLA 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST 395
           + V+  G     ++++  I A++ E     A+ + S T
Sbjct: 361 RHVLAYGRPQTVQELVARIDAVSVESTRDAARALLSRT 398


>gi|297530554|ref|YP_003671829.1| peptidase M16 domain protein [Geobacillus sp. C56-T3]
 gi|319766288|ref|YP_004131789.1| peptidase M16 domain protein [Geobacillus sp. Y412MC52]
 gi|297253806|gb|ADI27252.1| peptidase M16 domain protein [Geobacillus sp. C56-T3]
 gi|317111154|gb|ADU93646.1| peptidase M16 domain protein [Geobacillus sp. Y412MC52]
          Length = 415

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/396 (35%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGTT RTA++I E  
Sbjct: 11  NGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQTNGISHFLEHMFFKGTTTRTARDIAEAF 70

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 71  DSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERNVVLEEIK 130

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     +  +    +G PILG  ET+ +FT + +  +++  YT DR+ +  
Sbjct: 131 MYEDTPDDIVHDLLGKACYAGHPLGYPILGTEETLRTFTGDTLRQYMADYYTPDRVVISV 190

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F + +VE YF   +      S     +V  +  +K+D  + H+ +GFNG    
Sbjct: 191 AGNVDERF-IDEVERYFGSFAAESKPPSSGTPAFVPQKIARKKDTEQAHVCIGFNGLPIG 249

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I + T    +
Sbjct: 250 HPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYAGTGSSQL 309

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I + ++ L E+ + ++E+     ++   L+   E +  R     K  +  G   
Sbjct: 310 DVLFETIQQTIRQLKEDGVTEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRHR 369

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ I ++T E +  +A+ +F+    LA++ P
Sbjct: 370 SLDEIIEEIESVTVEKVNELARTVFTDDYALALISP 405


>gi|254462339|ref|ZP_05075755.1| Zn-dependent peptidase family protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206678928|gb|EDZ43415.1| Zn-dependent peptidase family protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 420

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/416 (36%), Positives = 232/416 (55%), Gaps = 2/416 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++    ++G  ++TE MP + SA + + + AG RNER E++G+AHFLEHM FKGT  R
Sbjct: 1   MSVQTHSLANGFRIVTEKMPGLRSASIGIWVTAGGRNERIEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           ++ +I EEIE VGG INAYTS E T+Y+A VL   VPLAL++I D+L N  F+  +IE E
Sbjct: 61  SSLQIAEEIEDVGGYINAYTSREVTAYYARVLGGDVPLALDVISDILLNPVFDEDEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     +  + DQ IGR ILG  E + SF+ E +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQDEAYPDQPIGRTILGPEERVRSFSREDLRRFVHEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   G VDH+  V   E  F     +++      A++ GG   + + L + H  
Sbjct: 181 GPSQMILSAAGDVDHDAIVRAAEELFGGLE-SRVASVPTKALFQGGVRREIKSLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G +Y     Y   I +  LG GMSSRLFQEVREKRGLCY+I A    +SD G++ I
Sbjct: 240 LAFEGPSYCDNAIYTAQIYSVALGGGMSSRLFQEVREKRGLCYTIFAQTGAYSDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L S  ++ +    +++ + E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGEQLPELASITMQELARAADDMNETEVARARAQMKAGMLMGLESPSSRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELI 415
           +     I   E+ +  I A+T + +   A  +    P    L  P++  P  ++L+
Sbjct: 360 MQIWNRIPPLEETVAQIDAVTMQGVRDFAASLADEAPAALALYGPVERAPDLADLL 415


>gi|138894791|ref|YP_001125244.1| processing peptidase-like protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|134266304|gb|ABO66499.1| processing peptidase-like protein [Geobacillus thermodenitrificans
           NG80-2]
          Length = 415

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 145/396 (36%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + V I  GSRNE ++ +G++HFLEHM FKGTT RTA++I E  
Sbjct: 11  NGVRIVLEQIPTVRSVAIGVWIGTGSRNETEQNNGISHFLEHMFFKGTTTRTARDIAEAF 70

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 71  DSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERNVVLEEIK 130

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     +  + +  +G PILG  ET+ +FT + +  +++  YT DR+ V  
Sbjct: 131 MYEDTPDDIVHDLLGKACYANHPLGYPILGTEETLRTFTGDTLRQYMADYYTPDRVVVSV 190

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F + ++E YF   + A    S     +V  +  +K+D  + H+ +GFNG    
Sbjct: 191 AGNVDERF-IGEIERYFGSFTAANKPASPGKPSFVPQKLARKKDTEQAHVCIGFNGLPIG 249

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I + T    +
Sbjct: 250 HPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYAGTGSGQL 309

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I   +  L E+ I ++E+     ++   L+   E +  R     K  +  G   
Sbjct: 310 DILFETIQRTLCHLKEDGITEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRHR 369

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ I ++T E +  +A+ +F+    LA++ P
Sbjct: 370 SLDEIIEEIESVTVEKVNELARTVFAEDYALALISP 405


>gi|56419806|ref|YP_147124.1| processing protease [Geobacillus kaustophilus HTA426]
 gi|56379648|dbj|BAD75556.1| processing protease [Geobacillus kaustophilus HTA426]
          Length = 426

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/396 (35%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGTT RTA++I E  
Sbjct: 22  NGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQTNGISHFLEHMFFKGTTTRTARDIAEAF 81

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 82  DSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERNVVLEEIK 141

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     +  +    +G PILG  ET+ +FT + +  +++  YT DR+ +  
Sbjct: 142 MYEDTPDDIVHDLLGKACYAGHPLGYPILGTEETLRTFTGDTLRQYMADYYTPDRVVISV 201

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F + +VE YF   +      S     +V  +  +K+D  + H+ +GFNG    
Sbjct: 202 AGNVDERF-IDEVERYFGSFAAESKPPSSGTPAFVPQKIARKKDTEQAHVCIGFNGLPIG 260

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I + T    +
Sbjct: 261 HPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYAGTGSSQL 320

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I   ++ L E+ + ++E+     ++   L+   E +  R     K  +  G   
Sbjct: 321 DVLFETIQHTIRQLKEDGVTEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRHR 380

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ I ++T E +  +A+ +F+    LA++ P
Sbjct: 381 SLDEIIEEIESVTVEKVNELARTVFTDDYALALISP 416


>gi|196247585|ref|ZP_03146287.1| peptidase M16 domain protein [Geobacillus sp. G11MC16]
 gi|196212369|gb|EDY07126.1| peptidase M16 domain protein [Geobacillus sp. G11MC16]
          Length = 413

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 145/396 (36%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + V I  GSRNE ++ +G++HFLEHM FKGTT RTA++I E  
Sbjct: 9   NGVRIVLEQIPTVRSVAIGVWIGTGSRNETEQNNGISHFLEHMFFKGTTTRTARDIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERNVVLEEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERNVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     +  + +  +G PILG  ET+ +FT + +  +++  YT DR+ V  
Sbjct: 129 MYEDTPDDIVHDLLGKACYANHPLGYPILGTEETLRTFTGDTLRQYMADYYTPDRVVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F + ++E YF   + A    S     +V  +  +K+D  + H+ +GFNG    
Sbjct: 189 AGNVDERF-IGEIERYFGSFTAANKPASPGKPSFVPQKLARKKDTEQAHVCIGFNGLPIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I + T    +
Sbjct: 248 HPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYAGTGSGQL 307

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I   +  L E+ I ++E+     ++   L+   E +  R     K  +  G   
Sbjct: 308 DILFETIQRTLCHLKEDGITEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNELLLGRHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ I ++T E +  +A+ +F+    LA++ P
Sbjct: 368 SLDEIIEEIESVTVEKVNELARTVFAEDYALALISP 403


>gi|15604090|ref|NP_220605.1| protease [Rickettsia prowazekii str. Madrid E]
 gi|6686079|sp|O05945|Y219_RICPR RecName: Full=Uncharacterized zinc protease RP219
 gi|2073473|emb|CAA72467.1| hypothetical processing peptidase [Rickettsia prowazekii]
 gi|3860781|emb|CAA14682.1| MITOCHONDRIAL PROTEASE (mpp) [Rickettsia prowazekii]
 gi|292571815|gb|ADE29730.1| protease [Rickettsia prowazekii Rp22]
          Length = 412

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/404 (36%), Positives = 233/404 (57%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP + S  + +  + G+R E +EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVHSVAINLIAKVGARYENEEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I EE + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AQQIAEEFDSIGGYFNAYTGHENTVYYARVLSENCHKALNILADIIQNSIFADEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            ++++EI    D+  D +   F   V+K Q +G+ ILG  +T+ +FT E  ++F+ ++Y 
Sbjct: 124 QIIMQEIAHHHDNPDDLIYETFYNTVYKGQPLGKSILGTTKTLVTFTKEHFLNFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G ++H   V   E  F       +K S  PA Y+GG+    ++L +  ++L
Sbjct: 184 AENLYLSIAGNIEHNKIVMIAEELFASLKQG-VKSSFIPAKYIGGKGFIHKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF   +Y      Y T +L+ I G GMSSRLFQ +REK GL Y + +++  + D+GV  I
Sbjct: 243 GFECTSYINLGQLYQTYLLSIIFGGGMSSRLFQSIREKLGLAYVVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA   +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHNKLELLYREIKNEIIKITETVSTEEIIRAKMQLRSNLQMAQEQNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+II+ I+ I  +DI+  A KIFS T TLAI+GP
Sbjct: 363 YSVFGKYILPEEIIEIITNIRADDIINTANKIFSGTTTLAIIGP 406


>gi|83954530|ref|ZP_00963241.1| peptidase, M16 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83840814|gb|EAP79985.1| peptidase, M16 family protein [Sulfitobacter sp. NAS-14.1]
          Length = 402

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/397 (38%), Positives = 225/397 (56%), Gaps = 2/397 (0%)

Query: 19  MP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINA 77
           MP + SA + V + AG+R+E   ++G+AHFLEHM FKGT KRT+ +I E IE VGG INA
Sbjct: 1   MPGLASASIGVWVSAGARHETATQNGIAHFLEHMAFKGTAKRTSLQIAEAIEDVGGYINA 60

Query: 78  YTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDF 137
           YTS E T+Y+  VL+  V L L++I D+L N   +  +IE ER V+L+EIG + D   D 
Sbjct: 61  YTSREVTAYYVRVLENDVSLGLDVIADILRNPVLDNGEIEVERGVILQEIGQALDTPDDV 120

Query: 138 LDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFC 197
           +     E  + +Q IGR ILG  E +S+F+ + +  F+S++Y  D+M +   GAVDH+  
Sbjct: 121 IFDWLQEKAYPNQPIGRTILGPSERVSNFSRDDLSGFISQHYGPDQMILAAAGAVDHDEI 180

Query: 198 VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNI 257
           V   E  F       + + +  A + GGE  Q + L + H  LGF    Y++ D Y+  I
Sbjct: 181 VRLAEQLFGDMPPKPLFD-VDAAKFSGGEVRQLKPLEQAHFALGFEAPGYRADDIYVAQI 239

Query: 258 LASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVE 317
            AS LG GMSSRLFQEVRE RGLCY+I A    ++D G++ I + T+ E +  L    ++
Sbjct: 240 YASALGGGMSSRLFQEVRENRGLCYTIFAQAGAYADTGMMTIYAGTSGEQLPELAGITID 299

Query: 318 VVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTIS 377
            ++    ++   E+ +  A++ A L+   E    RA  +++ +     +   E+ I  I 
Sbjct: 300 EMKRAASDMSPAEVARARAQMKAGLLMGLESPSNRAERLARLIQIWDRVPPLEETIAQID 359

Query: 378 AITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           A+T  D+   A+ I +S P    L  P+D  PT  EL
Sbjct: 360 AVTTGDVRDFAQNIAASAPAALALYGPVDGAPTLEEL 396


>gi|51473417|ref|YP_067174.1| protease [Rickettsia typhi str. Wilmington]
 gi|81390218|sp|Q68XF0|Y210_RICTY RecName: Full=Uncharacterized zinc protease RT0210
 gi|51459729|gb|AAU03692.1| probable mitochondrial protease [Rickettsia typhi str. Wilmington]
          Length = 412

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 145/404 (35%), Positives = 234/404 (57%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  ISK  +G+T++T  MP + S  + +  + G+R E +EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNISKLKNGLTILTYNMPYVHSVAINLIAKVGARYENEEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I EE + +GG  NAYT  E+T Y+  VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AQQIAEEFDSIGGYFNAYTGYENTVYYVRVLSENCHKALNILADIIQNSIFADEEISKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            ++++EI    D+  D +   F   V+KDQ +G+ ILG  +T+  FT E  ++F+ ++Y 
Sbjct: 124 QIIMQEIAHHHDNPDDLIYETFYNTVYKDQPLGKSILGTAKTLVKFTQEHFLNFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G ++H   V   E  F       +  S  PA Y+GG+    ++L +  ++L
Sbjct: 184 AENLYLSIAGNIEHNKIVIIAEELFASLKQG-VTSSFIPAKYIGGKGFIHKELEQTSLVL 242

Query: 241 GFNGCAYQSRD-FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF   +Y + +  Y T +L+ I G G+SSRLFQ +REK GL Y + +++  + D+GV  I
Sbjct: 243 GFECTSYINLEKLYQTYLLSIIFGGGVSSRLFQSIREKLGLAYVVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA E +  L S I   +  + E +   E+ +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHEKLELLYSEIKNEIIKITETVSTEELMRAKIQLRSNLQMAQEQNSYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+II+ I+ I  +DI+  A KIFS T  LAI+GP
Sbjct: 363 YSVFGKYILPEEIIEIITNIKADDIINTANKIFSGTTALAIIGP 406


>gi|114764938|ref|ZP_01444111.1| peptidase, M16 family protein [Pelagibaca bermudensis HTCC2601]
 gi|114542650|gb|EAU45674.1| peptidase, M16 family protein [Roseovarius sp. HTCC2601]
          Length = 420

 Score =  263 bits (672), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 148/410 (36%), Positives = 232/410 (56%), Gaps = 2/410 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++   +G+ +++E M  + SA + V + AG RNER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVELTTLKNGLRIVSERMDGLQSASIGVWVTAGGRNERIEQNGVAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL+    LAL++I D+L N  F+  +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLENDTKLALDVIADILRNPVFDEREIETE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  ++ Q +GR ILG+   +  F    + +FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDVIFDWLQERAYQKQPLGRTILGEEANVRGFGKGDLETFVDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             +++ +   G+VDHE  VSQ E+ F      K     + A + GGE  +++ L + H  
Sbjct: 181 GPEQLIISAAGSVDHEALVSQAEALFGDMGSRKAA-GPETARFTGGEIRREKQLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+   FY + I +  LG GMSSRLFQE+REKRGLCY+I A    + D G++ +
Sbjct: 240 LAFEGPGYRDPGFYTSQIYSIALGGGMSSRLFQEIREKRGLCYTIFAQSGAYEDTGLMTV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L    ++ ++   E++   EI +  A++ A L+   E S  RA  +++ 
Sbjct: 300 YAGTSGDELADLAHLTIDEMKRAAEDMSPEEIARARAQMKAGLLMGLESSSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           V   G +   E  +  I  +T  D+   A+++ +S P    L  P+   P
Sbjct: 360 VQIWGKVPPIEDTVAKIDNVTTGDVRLFAEQMAASAPAALALYGPVGKAP 409


>gi|78043889|ref|YP_359993.1| M16 family peptidase [Carboxydothermus hydrogenoformans Z-2901]
 gi|77996004|gb|ABB14903.1| peptidase, M16 family [Carboxydothermus hydrogenoformans Z-2901]
          Length = 409

 Score =  259 bits (662), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 138/395 (34%), Positives = 235/395 (59%), Gaps = 10/395 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + ++   + ITV+ E +P I SA + +  + GSR+ER++E G++HF+EHM+FKGT  RTA
Sbjct: 2   IHVTTLPNKITVLVEEIPYIRSAAIGLWFKVGSRHERRDESGISHFIEHMMFKGTVNRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI E +++VGG +NA+T+ E+T Y+A VL EH  LALEI+ DM+ NS F   DIE+E+N
Sbjct: 62  KEIAESLDQVGGQLNAFTTKEYTCYYARVLDEHTLLALEILHDMVFNSKFAEEDIEKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEI M ED   + +    +E++W +  +GRPILG+ + I S T EK++++  R YT 
Sbjct: 122 VVIEEIRMYEDAPDELIHDLLTEVMWNNHPLGRPILGEIQDIESLTREKVVNYYKRYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G V+++  + ++   F      +  + +    +    + +++D  + H+ LG
Sbjct: 182 DNLIIAVAGRVNYQQLLDKIMELFGSIQGEQKGDKITIPEFNLHSFSRRKDSEQVHLCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G A      Y  NIL++ILG G+SSRLFQE+RE+ GL YS+ ++   + D G+  I +
Sbjct: 242 TKGYAINDDRIYGLNILSTILGGGISSRLFQELRERHGLVYSVYSYTTAYQDAGLFGIYA 301

Query: 302 ATAKENIMALTSSIVEVVQSLLE-----NIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
                 +    +  +E++Q  L+     +I   E+++   +I   L+ S E    R   +
Sbjct: 302 GLGPNKV----NEALELIQKQLKELKTGDISAEEVERARQQIKGNLLLSLESVTTRMSRL 357

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI 391
           +K  ++ G I+  E+I++ +  ++ EDI  +A++I
Sbjct: 358 AKSFLYHGKIISPEEIVEKVFNVSLEDIKAMAEEI 392


>gi|84501696|ref|ZP_00999868.1| peptidase, M16 family protein [Oceanicola batsensis HTCC2597]
 gi|84390317|gb|EAQ02876.1| peptidase, M16 family protein [Oceanicola batsensis HTCC2597]
          Length = 420

 Score =  259 bits (661), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 235/417 (56%), Gaps = 6/417 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   +    +G  ++TE MP + SA + + + AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTPELHTLPNGFRIVTERMPGLKSASIGIWVAAGGRDERPEQNGLAHFLEHMAFKGTATR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +  +I E IE VGG +NAYTS E T+Y+A VL   VPLALE++ D+L NS+ +  +IE E
Sbjct: 61  SPVQIAEAIEDVGGYMNAYTSREVTAYYARVLGADVPLALEVLADILRNSTLDEDEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L EIG + D   D +     E  + +Q +GR ILG  E I +F  + +  FV  NY
Sbjct: 121 RGVILSEIGQALDTPDDIIFDWLQEKAYPEQPLGRTILGPEERIRAFQRDDLARFVRENY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-KPAVYVGGEYIQKRDLAEEHM 238
              +M +   G VDH   V+  E  F    +  + +++   A +VGGE    + L + H+
Sbjct: 181 GPGQMILSAAGDVDHAAVVAAAERLFG--DMTPVDQTLANGATFVGGESRVVKTLEQAHI 238

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            LGF    Y+  D Y+  + A+ +G GM+SRLFQE+RE+RGLCY+I A    ++D G+  
Sbjct: 239 ALGFESPDYRHPDAYVAQVYAAAMGGGMASRLFQEIRERRGLCYTIFAQAGAYTDTGMTT 298

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + + T+ +    L    ++ ++   ++  + E  +  A++ A L+   E    RA  +++
Sbjct: 299 VYAGTSDDKAGDLARITIDEMKRAADDFSEEETARARAQMKAGLLMGLEGPSSRAERMAR 358

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSEL 414
            V   G +   E +++ I A+T +D+   A ++ +  P  LA+ G P+D VP  + L
Sbjct: 359 MVQIWGHVPPLETVVERIEAVTRDDLRAYAGRMATEAPMALAVYG-PVDRVPDHAGL 414


>gi|312114492|ref|YP_004012088.1| peptidase M16 domain protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219621|gb|ADP70989.1| peptidase M16 domain protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 426

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 148/390 (37%), Positives = 224/390 (57%), Gaps = 3/390 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  S+ ++G+ ++T+ MP +++A V V + AG+R+E   EHG+AHFLEHM FKGT  R
Sbjct: 1   MTVETSQLANGMRIVTDRMPGLETATVGVFVTAGARSETDNEHGVAHFLEHMAFKGTPTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +  EI EEIE  GG +NA TS E T+Y+A VLK  V L L +IGD+L N SF+  +++RE
Sbjct: 61  SPIEIAEEIEGAGGALNAVTSSEATNYYARVLKSDVELGLNLIGDLLLNPSFSDEEMDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EI  ++D   D +     +  + +Q +GR ILG   TIS  +   +  F + NY
Sbjct: 121 REVILQEIAATQDSPDDIVFDLALDEAYPNQSLGRSILGTERTISRHSAADLRRFRNENY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +A RM +   GAVDH+      ES F      +    +K A + GG     +   + H++
Sbjct: 181 SASRMILSAAGAVDHDAIHKLAESLFTGLP-EEAPRPIKRAKFEGGHATVDKRFEQCHVI 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
             F G      D +   I A I G GM+SRLFQEVREKRGLCY I A    +SD+G++ +
Sbjct: 240 FAFEGFPNGHEDSFAGRIFAGIAGGGMASRLFQEVREKRGLCYDIHAFDWGYSDSGIIGL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +AT+ + +  L++  + +   L EN    RE+ +  A+I A L  S E    RA +I+ 
Sbjct: 300 HAATSAQQLKELSALSLGIFADLAENGPTDRELARAKAQIKAGLFMSLESCESRAGQIAW 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVA 388
            +M  G  + +E++I+ + +IT E +  V 
Sbjct: 360 DLMVFGRTISNEELIEKVDSITREHVQAVG 389


>gi|212639513|ref|YP_002316033.1| Zn-dependent peptidase [Anoxybacillus flavithermus WK1]
 gi|212560993|gb|ACJ34048.1| Zn-dependent peptidase [Anoxybacillus flavithermus WK1]
          Length = 413

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 137/396 (34%), Positives = 231/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGT  RTA++I E  
Sbjct: 9   NGVRVVLEHIPTVRSVAIGIWIGTGSRNENEQNNGISHFLEHMFFKGTKTRTARDIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL  H   AL+I+ DM  +S+F   ++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDTHASFALDILADMFFHSTFVDEELQKEKNVVFEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  +T+++FT + +  ++   YT DR+ +  
Sbjct: 129 MYEDTPDDLVHDLLSKASYGNHPLGYPILGTEQTLATFTGDTLRQYMYETYTPDRVVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F + QVE+YF   +  K  +      +   +  +K++  + H+ +GFNG    
Sbjct: 189 AGNVDESF-IQQVEAYFGSFTRQKGNDVYVAPSFYPNKIARKKETEQAHVCIGFNGLPIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   IL +ILG  MSSRLFQEVRE+RGL YSI ++H  + D G++ I   T  + +
Sbjct: 248 HEDVYSLIILNNILGGSMSSRLFQEVREQRGLAYSIFSYHSAYRDGGMVTIYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I + ++ L ++ I ++E++    ++   L+ S E +  R     K  +  G   
Sbjct: 308 DLLFDTIQQTIEQLKQDGITEKELENSKEQMKGNLMLSLESTNSRMSRNGKNELLLGRHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++I  +T E +  +A+ IF+   ++A++ P
Sbjct: 368 SLDEIIESIDRVTKESVDRMAQTIFTDDFSVALISP 403


>gi|157692354|ref|YP_001486816.1| M16B subfamily peptidase [Bacillus pumilus SAFR-032]
 gi|194014929|ref|ZP_03053546.1| peptidase, M16 family [Bacillus pumilus ATCC 7061]
 gi|157681112|gb|ABV62256.1| M16B subfamily peptidase [Bacillus pumilus SAFR-032]
 gi|194013955|gb|EDW23520.1| peptidase, M16 family [Bacillus pumilus ATCC 7061]
          Length = 409

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 234/400 (58%), Gaps = 3/400 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT  R+A++I E  
Sbjct: 9   NGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTKTRSARDIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL  H   AL+++ DM  +S+F+  ++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDSHAGYALDVLSDMFFHSAFDEEELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+ ++ D  +G PILG  ET+S+F  + + +++   YT DR+ +  
Sbjct: 129 MYEDTPDDIVHDLLSKAIYGDHSLGFPILGTEETLSTFNGDSLRAYMDEFYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD  F +S+VE  F        K+ ++   +   +  +K++  + H+ +GFNG    
Sbjct: 189 AGNVDDTF-ISEVEKLFGSYETKGKKQPVEAPQFHYDKLTRKKETEQAHLCMGFNGLPAG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
            +  Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H +F+DNG+L I   T  + +
Sbjct: 248 DKGIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVFSYHSSFADNGMLTIYGGTGAKQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I++ +  L  E I Q+E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 NLLSETILQTLDVLKREGITQKELENSKEQMKGNLMLSLESTNSKMSRNGKNELLLGKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
             ++IID I+ +T + +  ++K+IF+    L+++ P  D 
Sbjct: 368 TLDEIIDEINKVTLDGVNNLSKRIFTEDYALSLISPTGDQ 407


>gi|58697219|ref|ZP_00372620.1| mitochondrial processing peptidase-like protein [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225630488|ref|YP_002727279.1| peptidase, M16 family [Wolbachia sp. wRi]
 gi|58536454|gb|EAL59862.1| mitochondrial processing peptidase-like protein [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592469|gb|ACN95488.1| peptidase, M16 family [Wolbachia sp. wRi]
          Length = 424

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/418 (33%), Positives = 242/418 (57%), Gaps = 10/418 (2%)

Query: 1   MNL-RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ R++K  +G+ +ITE V  IDS  + + +  GSR E  +++G++HFLEHM FKGT  
Sbjct: 1   MNVPRVTKLDNGLRIITEQVRDIDSVALSIRVGVGSRAESAKQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E T+Y+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGVFNASTGRESTTYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIVFDKYFEAAYKDQPFGRSILGTQDTVKSFTRGDLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + M     G V+HE  V+  + +F+     K+K+S     + GGEY++ R L + H+
Sbjct: 181 YFGENMLFAVAGNVEHEEVVALTKDFFSKIHSKKLKKSQNATSHTGGEYLEHRKLDQVHL 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + +++D G+  
Sbjct: 241 LIGLPSVSRHDDKYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTDTGMFS 300

Query: 299 IASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  SI   ++ L  +++ + E+++   ++ ++++ S+E    RA  + 
Sbjct: 301 IFAGTDSSNLDKLLKSITTELKKLSTDDLREEEVNRVKERVKSQILMSRESVSSRAETLG 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILG-----PPMDHV 408
                    +   ++I+ ISA+T  ++   A+++ S     TLA +G     P  D V
Sbjct: 361 HYYGNYNRYISKNELIEKISAVTTANVKKAAEELLSQHEKATLAAIGEIKSLPSYDKV 418


>gi|258591358|emb|CBE67657.1| putative enzyme [NC10 bacterium 'Dutch sediment']
          Length = 417

 Score =  256 bits (655), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 138/401 (34%), Positives = 230/401 (57%), Gaps = 11/401 (2%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V++E MP + SA + V +R GSR+E  E  G++HF+EHMLFKGT +R+A+EI   +
Sbjct: 13  NGVVVLSEQMPAVKSATIGVWVRVGSRDEAGEVAGVSHFIEHMLFKGTQRRSAQEIARTV 72

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG ++A+TS E T ++A VL EH+PLA++I+ D   +S+ +  DIERE+ VVL+EI 
Sbjct: 73  DAVGGTLDAFTSRETTCFYAKVLGEHLPLAVDILADTFLHSNLDTKDIEREQEVVLQEIK 132

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +   F+E +W D  + RPILG+ ET+ +FT + +   + R Y  DR  V  
Sbjct: 133 MVEDTPDDLVHDLFAEAIWSDHPVARPILGRKETVRAFTQDDVRRHMDRFYRPDRTVVAA 192

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G ++H   V  V   FN      +   + P        +++RD A+ H+ LG +G  + 
Sbjct: 193 AGDLEHGRLVELVTQAFNGFEGRSVHADVPPPSCTAAVRVEERDTAQLHLCLGMDGLPHA 252

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
            +D Y   +L ++LG  MSSRLFQEVREKRGL YSI ++  ++ D G+L I + T  E+ 
Sbjct: 253 HKDRYALYLLNAMLGGSMSSRLFQEVREKRGLVYSIYSYQASYRDCGLLVIYAGTNPES- 311

Query: 309 MALTSSIVEVVQSLLENIEQREID-----KECAKIHAKLIKSQERSYLRALEISKQVMFC 363
              +  +VE++++   ++  + +D     +   ++   L+   E +  R   ++K  ++ 
Sbjct: 312 ---SGQVVELIRAECASLRNQPVDPSDLQRAKDQLKGNLLLGLEGTSSRMTRMAKTEIYF 368

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
                 ++II  I +++ +    +A++I    T  +  +GP
Sbjct: 369 EGTYGLDEIIAGIDSVSVDQFESLARRILRDETFAITTIGP 409


>gi|254796564|ref|YP_003081400.1| processing proteinase [Neorickettsia risticii str. Illinois]
 gi|254589801|gb|ACT69163.1| processing proteinase [Neorickettsia risticii str. Illinois]
          Length = 407

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/384 (36%), Positives = 227/384 (59%), Gaps = 4/384 (1%)

Query: 23  SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLE 82
           S  +KV +RAGS  E QE  G+AHFLEHM+FKGT+ R+A++I E+ +++GG  NA TS  
Sbjct: 9   SVSIKVWVRAGSECEAQENSGLAHFLEHMIFKGTSTRSAEQIAEDFDRLGGYCNACTSRG 68

Query: 83  HTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARF 142
           +T Y+  +L+EH+   +EI+ D+++NS F   ++ERE+ VVLEEI  +ED   D +  RF
Sbjct: 69  YTVYYVKLLEEHLDKGMEILSDVINNSIFPKEELEREKLVVLEEISQTEDAPDDIIFDRF 128

Query: 143 SEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVE 202
            E ++ +Q  GRPILG  E ++ FT + I SF+S++Y ++ M ++  G VD E  +S  E
Sbjct: 129 FESIYPNQAYGRPILGSRENVNRFTRDDIASFISQHYYSENMMLIASGKVDSERFISLAE 188

Query: 203 SYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQS--RDFYLTNILA 259
            YF  + SV        PA YV  EY ++R L + H++LG    +Y       Y   +LA
Sbjct: 189 KYFGGIKSVGGRSVDRLPARYVPAEYREERKLEQTHIILGLPCVSYSDSISQIYSAKVLA 248

Query: 260 SILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVV 319
            +LG  MSSRLFQEVREKRGL YSISA H     + ++ + S+T  + +  L + ++  +
Sbjct: 249 ILLGGSMSSRLFQEVREKRGLAYSISAFHAPSETSAIMGVYSSTDPKRLKELVAVVLGEL 308

Query: 320 QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
             L   +   E+++   +I + ++   E +  RA  I + + + G  +   ++I+ I A+
Sbjct: 309 SRLQNTLTTEEVERAKQQIKSSILMGLESNESRASHIGRSIHYFGRYIDGAELIEVIDAV 368

Query: 380 TCEDIVGVAKKIFSSTP-TLAILG 402
             +D+  +A+ +      +LA++G
Sbjct: 369 EVDDVASIAEFMLQGKRLSLALIG 392


>gi|154497058|ref|ZP_02035754.1| hypothetical protein BACCAP_01351 [Bacteroides capillosus ATCC
           29799]
 gi|150273457|gb|EDN00585.1| hypothetical protein BACCAP_01351 [Bacteroides capillosus ATCC
           29799]
          Length = 416

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/396 (34%), Positives = 229/396 (57%), Gaps = 5/396 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE +P + SA + + +  GSR E+  E+G AHF+EHMLFKGT +RTA ++  E+
Sbjct: 10  NGVRILTEHVPAVRSAALGIYVGTGSRQEKAAENGAAHFIEHMLFKGTARRTAADLAGEM 69

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG INAYT+ E T ++A VL  H+P A +I+ DM  +S F+ +D+E ER VVLEEIG
Sbjct: 70  DAVGGQINAYTTKESTCFYARVLDTHLPQATDILCDMFFSSKFDENDVETERGVVLEEIG 129

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED+  D    R +  V+    + RPILG+  T+   T   +  +++ +Y A  + V  
Sbjct: 130 MYEDNPEDLCAERLAAGVYHGSALARPILGRKATLEKMTGAWLKEYMTSHYLASDIVVSL 189

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G+   +  V  +++ F+      + +  K AVY     ++K+ + + H+ L F G  Y 
Sbjct: 190 AGSFGQK-DVDDLKARFSAMPAGGLGKP-KAAVYTPCITVKKKAIEQNHLTLAFPGLPYH 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               +   +L+SILG GMSSRL+Q+VRE+RGLCYSI ++    +D G+  + +A  +E  
Sbjct: 248 DSRRFALQLLSSILGSGMSSRLWQQVREQRGLCYSIYSYGSGHADTGLYAVYTALGRETE 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
            A   +IV+ V+   +  + Q E+D+   +  A ++   E +  R   + +  +  G +L
Sbjct: 308 EAAIRTIVDAVKEFRDGGVTQEELDRAREQSKANVLMGLESTQARMSHLGRSELMMGEVL 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
             ++II    A+T ED+  +A++IF  S  +L+ +G
Sbjct: 368 VPDRIIAAYDAVTAEDVRALAEEIFDFSRASLSAVG 403


>gi|190571000|ref|YP_001975358.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019520|ref|ZP_03335326.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357272|emb|CAQ54699.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994942|gb|EEB55584.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 424

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 244/418 (58%), Gaps = 11/418 (2%)

Query: 1   MNL-RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ +++K  +G+ +ITE V  +DS  + + +  GSR E   ++G++HFLEHM FKGT  
Sbjct: 1   MNIPQVTKLDNGLRIITERVHEVDSVALNIRVGVGSRAESASQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E TSY+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGAFNACTGRESTSYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIIFDKYFEAAYKDQPFGRSILGTQDTVKSFTRANLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + +     G V+HE  V  ++ + +     ++K+S + A Y GGEY++ R L + H+
Sbjct: 181 YFGENIIFAVAGNVEHEEVVQLIKDFLSKIHSKELKKS-ENASYTGGEYLEHRKLDQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YSI + + +++D G+L 
Sbjct: 240 LIGLPSVSRDDNKYHTFKVLDSILGSGMSSRLFQEVREKQGLAYSIYSFNSSYADTGMLS 299

Query: 299 IASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  SI   ++ L  +++++ E+++   ++ ++++ S+E    RA  + 
Sbjct: 300 IFAGTDSSNLDKLLKSITTELKKLSTDDLKEEEVNRVKERVKSQILMSRESVSSRAETLG 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILG-----PPMDHV 408
                    +   ++I+ ISA+T  DI   A+++ S     TLA +G     P  D V
Sbjct: 360 HYYGNYNKYISKNELIEKISAVTIYDIKKAAEELLSQHERITLAAIGEIKSLPSYDKV 417


>gi|83589907|ref|YP_429916.1| peptidase M16-like [Moorella thermoacetica ATCC 39073]
 gi|83572821|gb|ABC19373.1| Peptidase M16-like protein [Moorella thermoacetica ATCC 39073]
          Length = 421

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 133/403 (33%), Positives = 228/403 (56%), Gaps = 6/403 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI +++E +P ++S  + V +R GSRNE ++  G++HFLEH+LFKGTT+RTA++I EE+
Sbjct: 9   NGIRIVSEEIPFVNSVALGVWVRTGSRNEDEDNQGVSHFLEHLLFKGTTRRTARQIAEEL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T+ E+T +++ VL EH+ LA++++ DM  NS   P DIE+E+ V+LEEI 
Sbjct: 69  EAVGGVINAFTTKEYTCFYSRVLAEHLDLAIDVLSDMFFNSLLAPEDIEKEKRVILEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   F+  +W    +GR ILG  ET+++   + I  +    Y    + +  
Sbjct: 129 MYEDSPDELIHDLFARTIWPGHPLGRAILGTYETVAALNRDLIYRYYQEQYNCANIVLAA 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G  +    + ++E+ F             P V      +Q +D  +  + LG  G A  
Sbjct: 189 AGKFNTSELIVKLEASFGRQRRPGKAAQFHPPVNRAATSMQVKDTEQVQICLGVPGLAQD 248

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y    L +ILG G+SSRLFQ +RE+R L YS+ ++H  F D+G+  + + T+ +N 
Sbjct: 249 DPAIYAVQALNNILGGGLSSRLFQLIREERALAYSVYSYHAGFGDSGLFTVYAGTSPDNY 308

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   ++E + SL  N + + E+ +   +I   L+  QE    R   + K  +  G ++
Sbjct: 309 RQVVQLVLEELASLKNNGVTEEELKRTKDQIRGNLLLGQESVSQRMSRLGKTEVSFGRVI 368

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP---PMD 406
            +E++I+ ++ +T +D+  +A+++F     +L  LGP   P+D
Sbjct: 369 TAEEVIERLNQVTRDDVQALAQRLFRPEYLSLTALGPEVEPLD 411


>gi|88607993|ref|YP_506070.1| M16 family peptidase [Neorickettsia sennetsu str. Miyayama]
 gi|88600162|gb|ABD45630.1| peptidase, M16 family [Neorickettsia sennetsu str. Miyayama]
          Length = 423

 Score =  253 bits (645), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 225/384 (58%), Gaps = 4/384 (1%)

Query: 23  SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLE 82
           S  +KV +RAGS  E QE  G+AHFLEHM+FKGT+ R A +I E+ +++GG  NA TS  
Sbjct: 25  SVSIKVWVRAGSECETQENGGLAHFLEHMIFKGTSTRNAAQIAEDFDRLGGYFNACTSRG 84

Query: 83  HTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARF 142
           +T Y+  +L+EH+   +EI+ D+++NS F   ++ERE+ VVLEEI  +ED   D +  RF
Sbjct: 85  YTVYYVRLLEEHLDKGMEILSDVINNSIFPEEELEREKLVVLEEISQTEDAPDDIIFDRF 144

Query: 143 SEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVE 202
            E ++ +Q  GRPILG  E +  FT   I SF+S++Y ++ M ++  G VD E  +S  E
Sbjct: 145 FESIYPNQAYGRPILGSRENVKRFTRNDIASFISQHYYSENMMLIASGKVDAERFISLAE 204

Query: 203 SYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQS--RDFYLTNILA 259
            YF  + S+++   +  PA YV  EY ++R L + H++LG    +Y       Y   +LA
Sbjct: 205 KYFGGIKSISRRAANRLPAKYVPVEYREERKLEQTHIILGLPCVSYSDGISQVYSAKVLA 264

Query: 260 SILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVV 319
            + G GMSSRLFQEVREKRGL YSISA H     + ++ + S+T  + +  L + ++  +
Sbjct: 265 ILFGGGMSSRLFQEVREKRGLAYSISAFHAPSETSAIMGVYSSTDPKRLKELVAVVLGEL 324

Query: 320 QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
             L   +   E++    +I + ++ S E +  RA  I + + + G  +   ++I+ I A+
Sbjct: 325 AKLRNTLTIEEVESAKQQIKSSILMSLESNESRASHIGRSIHYFGRYIDGAELIEVIDAV 384

Query: 380 TCEDIVGVAKKIFSSTP-TLAILG 402
             +D+  + + +      +LA++G
Sbjct: 385 EVDDVASITEFMLRGKRLSLALIG 408


>gi|294084681|ref|YP_003551439.1| peptidase M16 domain-containing protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664254|gb|ADE39355.1| peptidase M16 domain protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 421

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 138/417 (33%), Positives = 234/417 (56%), Gaps = 4/417 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +++  ++G+ V T  MP   +  + + ++ G+R+ER  E G+AH LEHM FKGT+ R A 
Sbjct: 5   KLTTLANGLGVATRTMPHAQTISIGIWVQVGARDERDNEQGIAHMLEHMAFKGTSSRDAL 64

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I  E+E VGG +NA+TS E T+Y+  +L EH+ L ++I+ D+L+ S+    +IERER V
Sbjct: 65  AIATEVEDVGGFMNAHTSREETAYYVRILPEHLDLGIDILADILTCSTLPEDEIERERGV 124

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +++EIG S D   D +   F+E       +GRPILG  +++S+FT   +  F+ R+Y A 
Sbjct: 125 IIQEIGQSADTPDDMVFDLFAESTHGGHTLGRPILGTVDSVSAFTQGDLAGFMKRHYGAG 184

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           +M V   G +DH+  V ++         A+     +PA +  G  I  R+L + H++ G 
Sbjct: 185 QMLVCAAGKIDHDDLVGRITDAIGTIKTAEHATRNRPA-WQAGRSILTRELEQAHVIFGL 243

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              +  + D +    L+++ G GMSSRLFQ+VREKRGLCYSI +    +SD GV  + + 
Sbjct: 244 PAPSATASDRFSLMALSTLYGGGMSSRLFQQVREKRGLCYSIFSFPTLYSDCGVFGVYAG 303

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T+ + +  +       + ++   +   E+ +  A+I A L+ S+E        +++Q+  
Sbjct: 304 TSADKVDEMLRVSAGELAAIAAKVTDEEVARAKAQIRANLLMSRESVAACGDALARQITL 363

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHVPTTSELIHAL 418
            G       ++D I AIT + +  VA  + ++  P +A++G P D++ + S+L  AL
Sbjct: 364 FGEPQDDGDLLDAIDAITSDAVSKVAADLIAAGDPAVALVG-PTDNIMSNSQLSAAL 419


>gi|311068194|ref|YP_003973117.1| MlpA protein [Bacillus atrophaeus 1942]
 gi|310868711|gb|ADP32186.1| MlpA [Bacillus atrophaeus 1942]
          Length = 410

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 136/404 (33%), Positives = 232/404 (57%), Gaps = 4/404 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ R+A++I E  
Sbjct: 9   NGVRVVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTRSARDIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +SSF+ +++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSSFDENELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET+ SF  + +  ++   YT +R+ +  
Sbjct: 129 MYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLDSFNGDSLRKYMDDFYTPNRVVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V   F +  VE +F           MK   +   +  +K++  + H+ LGFNG    
Sbjct: 189 AGNVTDSF-IKDVEKWFGTYEAKGAASGMKQPEFHYEKLTRKKETEQAHLCLGFNGLEVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I   T  + +
Sbjct: 248 HPDIYNLIVLNNVLGGSMSSRLFQDVREDKGLAYSVFSYHSSYEDSGMLTIYGGTGAKQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E + +L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 QLLSETIQETLGTLKRDGITPKELENSKEQMKGNLMLSLESTNSKMSRNGKNELLLGKHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
             ++II+ ++ +  E + G+A++IF+    LA++ P  D +PT+
Sbjct: 368 TLDEIINELNEVNLESVNGLARRIFTDDYALALISPSGD-MPTS 410


>gi|228992533|ref|ZP_04152460.1| Uncharacterized zinc protease ymxG [Bacillus pseudomycoides DSM
           12442]
 gi|228767167|gb|EEM15803.1| Uncharacterized zinc protease ymxG [Bacillus pseudomycoides DSM
           12442]
          Length = 431

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/396 (32%), Positives = 228/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVFEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYEDTPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F V  VE YF        +E +   ++   +  +K++  + H+ LGF G    
Sbjct: 208 AGNIDETF-VQTVEQYFGNYEGTTNREQVHSPIFHFNKVTRKKETEQAHLCLGFQGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYDTMQETLETLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T  D+  + + IF++  + A++ P
Sbjct: 387 SLDEIIESVNKVTKTDVDQLIRSIFTNEFSTALISP 422


>gi|222825031|dbj|BAH22189.1| peptidase, M16 family [Wolbachia endosymbiont of Cadra cautella]
          Length = 424

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 140/423 (33%), Positives = 250/423 (59%), Gaps = 7/423 (1%)

Query: 1   MNL-RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ +++K  +G+ +ITE V  +DS  + + +  GSR E   ++G++HFLEHM FKGT  
Sbjct: 1   MNIPQVTKLDNGLRIITERVHEVDSVALNIRVGVGSRAESASQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E TSY+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGAFNACTGRESTSYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIIFDKYFEAAYKDQPFGRSILGTQDTVKSFTRANLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + +     G V+HE  V  ++ + +     ++K+S + A Y GGEY++ R L + H+
Sbjct: 181 YFGENIIFAVAGNVEHEEVVQLIKDFLSKIHSKELKKS-ENASYTGGEYLEHRKLDQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L +ILG GMSSRLFQEVREK+GL YSI + + +++D G+L 
Sbjct: 240 LIGLPSVSRDDNRYHTFKVLDAILGSGMSSRLFQEVREKQGLAYSIYSFNSSYADTGMLS 299

Query: 299 IASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  +I   ++ L  +++++ E+++   ++ ++++ S+E    RA  + 
Sbjct: 300 IFAGTDSSNLDKLLKAITTELKKLSTDDLKEEEVNRVKERVKSQILMSRESVSSRAETLG 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSELI 415
                    +   ++I+ ISA+T  DI   A+++ S     TLA +G  ++ +P+  +++
Sbjct: 360 HYYGNYNKYISKNELIEKISAVTIYDIKKAAEELLSQHERITLAAIG-EINSLPSYDKVV 418

Query: 416 HAL 418
             L
Sbjct: 419 SML 421


>gi|228998581|ref|ZP_04158168.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock3-17]
 gi|229006080|ref|ZP_04163768.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock1-4]
 gi|228755156|gb|EEM04513.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock1-4]
 gi|228761049|gb|EEM10008.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock3-17]
          Length = 431

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/396 (32%), Positives = 228/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVFEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYEDTPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F V  VE YF        +E +   ++   +  +K++  + H+ LGF G    
Sbjct: 208 AGNIDETF-VQTVEQYFGNYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGFQGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYDTMQETLETLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T  D+  + + IF++  + A++ P
Sbjct: 387 SLDEIIESVNKVTKTDVDQLIRSIFTNEFSAALISP 422


>gi|326941571|gb|AEA17467.1| Zinc protease [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 413

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++ G+ + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISP 403


>gi|323701877|ref|ZP_08113547.1| peptidase M16 domain protein [Desulfotomaculum nigrificans DSM 574]
 gi|323533181|gb|EGB23050.1| peptidase M16 domain protein [Desulfotomaculum nigrificans DSM 574]
          Length = 422

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/401 (31%), Positives = 240/401 (59%), Gaps = 5/401 (1%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++T+ V  + S  + + +  GSR+E     G++H++EHM+FKGT  RTAK+I EE+
Sbjct: 10  NGVRILTQQVSHVRSVAMGIWVDVGSRDEIDANAGISHYIEHMMFKGTKHRTAKQIAEEL 69

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG +NA+T+ E+T Y+A VL EH  LA++I+ DML +S+ +  D+ERE+NV+LEEI 
Sbjct: 70  DAVGGQLNAFTTKEYTCYYAKVLDEHFDLAVDILTDMLFHSNISEQDVEREKNVILEEIK 129

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   F++ +W    +GRPI+G  ET+SS T + + S++ ++YT +R+ +  
Sbjct: 130 MYEDAPDELVHDMFAKTIWSGHALGRPIIGTSETVSSLTYKDLRSYMEQHYTPNRIVISV 189

Query: 189 VGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G + H+  V ++   F ++ +   I++ + P V+      + +D  + HM++G  G   
Sbjct: 190 AGNISHQQVVEKLSPLFASMPNKENIRQLVHP-VHTSQVNCRNKDTEQVHMVIGTPGLRL 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
                Y+  ++ ++LG G+SSRLFQE+RE+RGL Y++ ++H ++ D G+  + +  +K+N
Sbjct: 249 DDDRVYIVQVINTVLGGGLSSRLFQEIREQRGLVYTVYSYHSSYYDTGLFGVYAGLSKQN 308

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +      I + +  + +N I + E+ +   ++   L+ S E        + K  ++ G +
Sbjct: 309 VGKAMELIFKEISDIKKNGITKEELQRSKDQLKGNLLLSLESVNTHMSRLGKSELYLGRV 368

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMD 406
              E+I++ ++ +T ED + +A ++F     +++ +GP  D
Sbjct: 369 YKPEEIVEKLNKVTIEDTIQMANELFKPESFSMSAIGPWQD 409


>gi|218235633|ref|YP_002368606.1| zinc protease, insulinase family [Bacillus cereus B4264]
 gi|296504301|ref|YP_003666001.1| zinc protease [Bacillus thuringiensis BMB171]
 gi|218163590|gb|ACK63582.1| zinc protease, insulinase family [Bacillus cereus B4264]
 gi|296325353|gb|ADH08281.1| Zinc protease [Bacillus thuringiensis BMB171]
          Length = 413

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++ G+ + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISP 403


>gi|206972735|ref|ZP_03233669.1| zinc protease, insulinase family [Bacillus cereus AH1134]
 gi|206732335|gb|EDZ49523.1| zinc protease, insulinase family [Bacillus cereus AH1134]
          Length = 413

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++ G+ + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISP 403


>gi|229544444|ref|ZP_04433502.1| peptidase M16 domain protein [Bacillus coagulans 36D1]
 gi|229324929|gb|EEN90606.1| peptidase M16 domain protein [Bacillus coagulans 36D1]
          Length = 412

 Score =  249 bits (637), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 138/396 (34%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGT KR+AK+I E  
Sbjct: 9   NGLRIVLEEIPTVRSVAIGIWIGTGSRNENEKNNGISHFLEHMFFKGTEKRSAKDIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T ++A VL  H PLALEI+ DM  +S+F+  ++ERE++VV EEI 
Sbjct: 69  DAIGGQVNAFTSKEYTCFYAKVLDTHAPLALEILSDMFFHSTFSEDEMEREKSVVNEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     + ++++  +G PILG  ET++SFT + +  +V   YT DR+ V  
Sbjct: 129 MYEDTPDDIVHDLLGKAIYENHPLGYPILGTEETLASFTSDDLHQYVYDMYTPDRVVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V   F V ++E+ F      K +   + AV+   +  +K++  + H+ LGF G    
Sbjct: 189 AGNVLPSF-VKEIEALFGSYEGGKEETGGETAVFHTNDLARKKETEQAHLCLGFEGKKIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
           S D Y   +L +ILG  MSSRLFQ VRE+RGL YS+ ++H  + D+G+L I   T    +
Sbjct: 248 SDDIYELIVLNNILGGSMSSRLFQNVREQRGLAYSVYSYHTAYKDSGILTIYGGTGASQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +Q+L  + + ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DELFETVQETLQTLKAKGVTEKEVRNCKEQLKGNLMLSLESTNSRMSRNGKNELLLKKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +++++ I  +T E +   A++IFS   + +++ P
Sbjct: 368 SLDEMLEEIDRVTVEKVNACAREIFSKPYSASLISP 403


>gi|294500889|ref|YP_003564589.1| zinc protease [Bacillus megaterium QM B1551]
 gi|294350826|gb|ADE71155.1| zinc protease [Bacillus megaterium QM B1551]
          Length = 414

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 134/400 (33%), Positives = 226/400 (56%), Gaps = 5/400 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + V I  GSR+E  E +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVLENIPTVRSVAIGVWIGTGSRSEHPEINGVSHFLEHMFFKGTKTRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  NSSF+  ++ RE+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHADQALDVLADMFFNSSFDEEELAREKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     + V+ +  +G PILG  +T+ +F  + +  ++ + Y  + + +  
Sbjct: 129 MYEDTPDDIVHDLLGKAVYGNHPLGYPILGTEDTLKTFNGDSLRQYMEQMYIPENIVISV 188

Query: 189 VGAVDHEFCVSQVESYFNV-CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G +D  F + QVE+YF    S     + ++P  +      +K++  + H+ LGF G   
Sbjct: 189 AGNIDESF-IQQVENYFGTYTSSHSAHQYVQPEFHT-NHIARKKETEQAHLCLGFKGLPI 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G++ I   T    
Sbjct: 247 GGEDVYSLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYRDSGLVTIYGGTGSHQ 306

Query: 308 IMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  ++ E +  L +  I  +E+     ++   L+ S E +  R     K  +  G  
Sbjct: 307 LDVLYDTVQETLYDLKDKGITDKELSNSKEQLKGNLMLSLESTNSRMSRNGKNELMLGYH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
              ++I+D ++A+T + + G+A+ IF     L+++ P  D
Sbjct: 367 RSLDEILDLVNAVTKDSVNGLARDIFKDEFALSLISPSGD 406


>gi|229086357|ref|ZP_04218534.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-44]
 gi|228696969|gb|EEL49777.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-44]
          Length = 431

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 228/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVFEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYEDTPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F V  VE YF        +E +   ++   +  +K++  + H+ LGF G    
Sbjct: 208 AGNIDEAF-VQTVEQYFGNYEGTTNREQVHSPIFHFNKVSRKKETEQAHLCLGFKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYDTMQETLETLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T  D+  + + IF++  + +++ P
Sbjct: 387 SLDEIIESVNQVTKTDVDTLIRNIFTNEFSASLISP 422


>gi|42520580|ref|NP_966495.1| M16 family peptidase putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410319|gb|AAS14429.1| peptidase, M16 family, putative [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 423

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 138/425 (32%), Positives = 248/425 (58%), Gaps = 7/425 (1%)

Query: 1   MNL-RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ R++K  +G+ +ITE V  IDS  + + +  GSR E  +++G++HFLEHM FKGT  
Sbjct: 1   MNIPRVTKLDNGLRIITEQVRDIDSVALSIRVGVGSRAESAKQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E T+Y+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGVFNASTGRESTTYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG   T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIIFDKYFEAAYKDQPFGRSILGTQNTVKSFTRGDLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + M     G V+HE  V+  + + +     K+K+S   +   GGEY++ R L + H+
Sbjct: 181 YFGENMLFAVAGNVEHEEVVALTKDFLSKIHSKKLKKSQNASC-TGGEYLEHRKLDQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + ++++ G+  
Sbjct: 240 LIGLPSVSRHDDKYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTNTGMFS 299

Query: 299 IASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  SI   ++ L  +++++ E+++   ++ ++++ S+E    RA  + 
Sbjct: 300 IFAGTDSSNLDKLLKSITTELKKLSTDDLKEEEVNRVKERVKSQILMSRESVSSRAETLG 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILGPPMDHVPTTSELI 415
                    +   ++I+ ISA+T  ++   A+++ S     TLA +G  ++ +P+  +++
Sbjct: 360 HYYGNYNRYISKNELIEKISAVTTANVKKAAEELLSQHEKTTLAAIG-EIESLPSYDKVV 418

Query: 416 HALEG 420
             L+ 
Sbjct: 419 SMLKA 423


>gi|30021894|ref|NP_833525.1| Zinc protease [Bacillus cereus ATCC 14579]
 gi|29897450|gb|AAP10726.1| Zinc protease [Bacillus cereus ATCC 14579]
          Length = 432

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 230/396 (58%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDEIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++ G+ + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISP 422


>gi|42782893|ref|NP_980140.1| zinc protease [Bacillus cereus ATCC 10987]
 gi|42738820|gb|AAS42748.1| zinc protease, insulinase family [Bacillus cereus ATCC 10987]
          Length = 413

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I +RE+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITERELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 403


>gi|159043696|ref|YP_001532490.1| processing peptidase [Dinoroseobacter shibae DFL 12]
 gi|157911456|gb|ABV92889.1| processing peptidase [Dinoroseobacter shibae DFL 12]
          Length = 426

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 140/382 (36%), Positives = 213/382 (55%), Gaps = 2/382 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           ++++ ++G  ++TE MP + SA V + + AG R+ER E++G+AHFLEHM FKGT KR+  
Sbjct: 10  QLTELANGFRIVTEHMPGLKSAAVGIWVLAGGRHERLEQNGIAHFLEHMAFKGTEKRSTL 69

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I E IE VGG INAYTS E T+Y+A VL+  V LA++++ D+L N  F P +IE ER V
Sbjct: 70  GIAEAIEDVGGYINAYTSREVTAYYARVLEADVGLAVDVLADILRNPVFAPEEIEVERGV 129

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L+EIG + D   D +     E  + DQ +GR ILG  E +  F       FV  +YT +
Sbjct: 130 ILQEIGQALDTPDDVVFDWLQERAFADQPMGRTILGPAERVRGFARNDFFDFVGEHYTPE 189

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            M +   GAVDH+  V+  E  F   +  + +     A +  GE    + L + H  +  
Sbjct: 190 TMILSAAGAVDHDALVALAEKLFGDMA-RRDRADAAQARFTCGEARVIKPLEQVHFAMAL 248

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G  Y+    Y   + A+ LG GMSSRLFQEVREKRGLCYSI A    +++ G++ I + 
Sbjct: 249 PGPGYRDPAVYTAQVYATALGGGMSSRLFQEVREKRGLCYSIFAQSGAYAETGMMTIYAG 308

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T+ + I  L    +  +Q    ++  +E+ +  A++ A L+   E    RA  +++ V  
Sbjct: 309 TSGDQIAELCEITLREMQRAGNDMSTQEVARARAQMKAGLLMGLESPSSRAERLARLVGV 368

Query: 363 CGSILCSEKIIDTISAITCEDI 384
              +   ++ I  I A+T  D+
Sbjct: 369 WNRVPSLDETIARIDAVTTGDV 390


>gi|188588394|ref|YP_001920625.1| peptidase, M16 family [Clostridium botulinum E3 str. Alaska E43]
 gi|188498675|gb|ACD51811.1| peptidase, M16 family [Clostridium botulinum E3 str. Alaska E43]
          Length = 435

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/390 (37%), Positives = 225/390 (57%), Gaps = 11/390 (2%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ VITE +  ++S  V + I+ GSRNE +E +G++HF+EHM FKGT KR+AK+IVEEI
Sbjct: 9   NGLRVITEKIDALNSVSVGIMIQNGSRNEVEEVNGISHFIEHMFFKGTKKRSAKQIVEEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+TS E T Y+   L  H+ L+L+++ DM+ NS+F+  +IE+E+ VV+EEI 
Sbjct: 69  ENVGGQINAFTSKEATCYYIKALNTHLDLSLDVLSDMILNSNFDEEEIEKEKGVVIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MS+D   D LD   S++ +K+  +  PILG    I SFT EKI++F+S  YT     +  
Sbjct: 129 MSQDSPEDVLDDEHSKVTFKENSLSYPILGTIPKIKSFTREKILNFISEKYTPYNSVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAK--IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
            G  D +     +E+ F      K  I E  KP +Y    Y+ K ++ + H+ LG  G A
Sbjct: 189 CGKFDEKELKKMIENCFGSWKSQKKYIPEYNKPTIYCESGYVNK-EIEQLHISLGLKGLA 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK- 305
           Y+ ++ Y   +L ++LG G SS LFQ+VRE+ GLCY++ ++ + F   G + I +  +K 
Sbjct: 248 YRDKNSYPLVLLNNVLGGGASSILFQKVREELGLCYTVCSYLQPFQGVGTINIYTGLSKN 307

Query: 306 ---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
              + +  + + ++E  ++ +    Q EI KE  KI A  I   E +  R    +K  +F
Sbjct: 308 YANKALEVINNEVIEFSKTGITK-NQLEISKE--KIKATYILGLESTSSRMFANAKSYLF 364

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              +   E +I  I AI   DI  V  + F
Sbjct: 365 TNQVFTEEDVIRKIDAINKNDIQSVLDECF 394


>gi|152976171|ref|YP_001375688.1| peptidase M16 domain-containing protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024923|gb|ABS22693.1| peptidase M16 domain protein [Bacillus cytotoxicus NVH 391-98]
          Length = 412

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/396 (33%), Positives = 225/396 (56%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE  + +G++HFLEHM FKGT  R+AKEI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENAKNNGISHFLEHMFFKGTKTRSAKEIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+  VL EH   AL+++ DM  NS+F+ +++++E+ VV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYTKVLDEHAKYALDVLADMFFNSTFDEAELKKEKKVVFEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 129 MYEDTPDDIVHDILTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F V  VE YF        +E +   ++   +  +K++  + H+ LGF G    
Sbjct: 189 AGNIDETF-VQTVEQYFGNYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGFKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L +ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L I   T  + +
Sbjct: 248 HDDIYNLIVLNNILGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTIYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I E + +L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYDTIQETLDTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++I+ +T  ++  + + IF++  + A++ P
Sbjct: 368 SLDEIIESINNVTKPNVDALIRDIFTNEFSAALISP 403


>gi|187934972|ref|YP_001885478.1| peptidase, M16 family [Clostridium botulinum B str. Eklund 17B]
 gi|187723125|gb|ACD24346.1| peptidase, M16 family [Clostridium botulinum B str. Eklund 17B]
          Length = 435

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/390 (37%), Positives = 224/390 (57%), Gaps = 11/390 (2%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ VITE +  ++S  V + I+ GSRNE +E +G++HF+EHM FKGT KR+AK+IVEEI
Sbjct: 9   NGLRVITEKIDALNSVSVGIMIQNGSRNEVEEVNGISHFIEHMFFKGTKKRSAKQIVEEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+TS E T Y+   L  H+ L+L+++ DM+ NS+F+  +IE+E+ VV+EEI 
Sbjct: 69  ENVGGQINAFTSKEATCYYIKALNTHLDLSLDVLSDMILNSNFDEEEIEKEKGVVIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MS+D   D LD   S++ +K+  +  PILG    I SFT EKI++F+S  YT     +  
Sbjct: 129 MSQDSPEDVLDDEHSKVTFKENSLSYPILGTIPKIKSFTREKILNFISEKYTPYNSVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAK--IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
            G  D +     +E  F      K  I E  KP +Y    Y+ K ++ + H+ LG  G A
Sbjct: 189 CGKFDEKELKKMIEDCFGSWKSPKKYIPEYNKPTIYCESGYVNK-EIEQLHISLGLKGLA 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK- 305
           Y+ ++ Y   +L ++LG G SS LFQ+VRE+ GLCY++ ++ + F   G + I +  +K 
Sbjct: 248 YRDKNSYPLVLLNNVLGGGASSILFQKVREELGLCYTVCSYLQPFQGVGTINIYTGLSKN 307

Query: 306 ---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
              + +  + + ++E  ++ +    Q EI KE  KI A  I   E +  R    +K  +F
Sbjct: 308 YANKALEVINNEVIEFSKTGITK-NQLEISKE--KIKATYILGLESTSSRMFANAKSYLF 364

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              +   E +I  I AI   DI  V  + F
Sbjct: 365 TNEVFTEEDVIRKIDAINKNDIQSVLDECF 394


>gi|319649512|ref|ZP_08003668.1| zinc protease [Bacillus sp. 2_A_57_CT2]
 gi|317398674|gb|EFV79356.1| zinc protease [Bacillus sp. 2_A_57_CT2]
          Length = 411

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/396 (33%), Positives = 223/396 (56%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P + S  + V I  GSRNE  E +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRVVLENIPTVRSVAIGVWIGTGSRNEIPENNGISHFLEHMFFKGTKTRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL  H   ALE++ DM  NS+F   ++ +E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDTHSDFALEVLSDMFFNSTFVDEELNKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+ ++++  +G PILG   T+++F  E +  ++   YT + + +  
Sbjct: 129 MYEDTPDDIVHDLLSKAIYENHSLGYPILGTEGTLATFNGETLKQYMHETYTPENVVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G ++  F + +VE YF        + S +   +      +K+D  + H+ LGF G    
Sbjct: 189 AGNINESF-IKEVEKYFGSYEGGNRERSEQKPEFHSNHLARKKDTEQAHLCLGFEGLQVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L +ILG  MSSRLFQ+VRE++GL YS+ ++H  F D+G++ +   T  + +
Sbjct: 248 HEDIYNLIVLNNILGGSMSSRLFQDVREQKGLAYSVFSYHSAFQDSGIVTLYGGTGAKQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I E + +L  E I  +E++    ++   L+ S E +  R     K  +  G   
Sbjct: 308 DVLFDTIQETLATLKKEGITDKELNNSKEQLKGSLMLSLESTNSRMSRNGKNELLLGRHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++I++ I A++ + +  +AK IF+   ++A++ P
Sbjct: 368 SMDEIVEEIDAVSMQGVNDMAKSIFTEHYSVALISP 403


>gi|323489597|ref|ZP_08094824.1| zinc protease [Planococcus donghaensis MPA1U2]
 gi|323396728|gb|EGA89547.1| zinc protease [Planococcus donghaensis MPA1U2]
          Length = 408

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/396 (33%), Positives = 226/396 (57%), Gaps = 4/396 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +++E +P   S  + V +  GSR+E  EE+G+ HF+EHMLFKGT  RTAKEI  E 
Sbjct: 9   NGLRIVSEHIPHFHSVAMGVFVNNGSRDELPEENGITHFIEHMLFKGTESRTAKEIAREF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GGDINAYTS E+T Y+A VL  H   A+ ++ DM  +S  +P + ++ER V+LEEI 
Sbjct: 69  DRIGGDINAYTSKEYTCYYAKVLDHHAEHAVTVLADMFFHSQMDPEEFDKERQVILEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D +  +   +++ +  IG PILG  ET+++FTPEKI  +++R+YT     V  
Sbjct: 129 MTEDMPDDDVHEQLWRVMYPENSIGAPILGTAETLAAFTPEKIRDYINRHYTPANTVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +     + ++E+ F      +  +  +   +  G  ++ ++  + H+ LG+ G +  
Sbjct: 189 AGNITPAL-LEKIEALFGNFEKEENPKKYELPNFTSGYSLKNKETEQGHLCLGYPGLSLN 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L +I+G  MSSRLFQE+RE+RGL YSI ++H  +SD+G L I   T+ E +
Sbjct: 248 DPDIYNITVLNNIIGGSMSSRLFQEIREQRGLAYSIFSYHSAYSDHGTLAIYGGTSDEQM 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   I+ +++ L    I ++EI     ++   L+   E +  R     +  +  G   
Sbjct: 308 AEMQQVILSLLKELKNGGITEQEITDSKEQLKGSLMLGLESTSARMSRNGRHELLLGKHQ 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             E+++  I  ++ E ++ +  +I   TP ++I+ P
Sbjct: 368 SYEEVLTQIDQVSLEKVMELL-EILVETPAISIIRP 402


>gi|222055787|ref|YP_002538149.1| processing peptidase [Geobacter sp. FRC-32]
 gi|221565076|gb|ACM21048.1| processing peptidase [Geobacter sp. FRC-32]
          Length = 418

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/405 (36%), Positives = 230/405 (56%), Gaps = 9/405 (2%)

Query: 5   ISKTS--SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           I KT+  +G+ VI+E +P + S  + + +  GSR+ER+E +G+AHF+EH+LFKGTT RTA
Sbjct: 2   IKKTTLKNGVRVISEALPNLSSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTTNRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL   +P A++I+ D+ +NS F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGILNAFTSREYVCYYAKVLDRFLPKAVDILADIFTNSIFDPEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EI M ED+  D +   F +  WK   +G  ILG  +++S  T EKII F  R Y A
Sbjct: 122 VILQEINMVEDNPEDLVHDLFHQKFWKHHPLGMSILGDQQSVSGLTREKIIGFKDRMYRA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G VDH+  ++ +E      +    +E+    V+       +RDL + HM LG
Sbjct: 182 EDIIIAAAGNVDHQELLALLEKNLPRIATGNGRETSTEPVHKKRIETVERDLEQVHMCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        +   ++ +ILG  MSSRLFQEVREKRGL YSI ++  + +D G L I +
Sbjct: 242 IRGLPQNHPRRFDAFVMNTILGGSMSSRLFQEVREKRGLAYSIYSYMASHADTGSLVIYA 301

Query: 302 ATAK---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +       +M L  S+ E+ +   E + Q E+D    ++   +I S E S  R  +++K
Sbjct: 302 GSGPGHYREVMEL--SLGELKRLKREPVPQVELDAAREQLKGNMILSLESSDNRMSKLAK 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILG 402
             ++ G     + II     +T + I+ +A ++      TL +LG
Sbjct: 360 NEIYFGQYQPLDAIIAGFDLVTTDSIMEIAGQLLDDDYLTLVMLG 404


>gi|296132903|ref|YP_003640150.1| peptidase M16 domain protein [Thermincola sp. JR]
 gi|296031481|gb|ADG82249.1| peptidase M16 domain protein [Thermincola potens JR]
          Length = 414

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/404 (32%), Positives = 224/404 (55%), Gaps = 10/404 (2%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI V+TE +P + S  + + +  GSR+E  E  G+AHF+EHM+FKGT  R+AK+I EE+
Sbjct: 9   NGIRVVTEEIPHVRSVSIGLWVGVGSRDETDENSGIAHFIEHMMFKGTKNRSAKQIAEEL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+T+ E+T Y+A  L EH P +L ++ DM  NS ++P +I++ERNV++EEI 
Sbjct: 69  DAIGGQLNAFTAKEYTCYYAKTLDEHFPKSLNLLADMFFNSLYDPQEIDKERNVIIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   F+  +W +  +GR I+G  E +       IISF+   YT D++ +  
Sbjct: 129 MYEDAPDELIHDLFASTLWNNHPLGRSIIGTREVVEKINRADIISFLKTFYTPDQLVIAV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V H+  +  +   F+         +    V V     +K+D  + H+ +G  G    
Sbjct: 189 AGNVKHDRVMELITPLFDRMEGKSTARNYAKPVPVYQVATKKKDTEQVHLCIGVPGLPLD 248

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y   +L SILG G+SSRLFQE+RE+RGL YS+ ++H ++ D G+  I +  + +NI
Sbjct: 249 HEQIYSLYVLNSILGGGISSRLFQEIREERGLAYSVYSYHNSYKDAGLFSIYTGLSLKNI 308

Query: 309 MALTSSIVEVVQSLLENIE-----QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
                 +VE++   L+ I+     + E+ +   ++   L    E    R   I K  +  
Sbjct: 309 ----GPVVELITRELKQIKAGKVTEEEVFRAKEQLKGSLYLGLENVSNRMSRIGKSELCL 364

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           G I+  E+ ++ I+ +  +D+  +A+++F+S   +     PMDH
Sbjct: 365 GRIITPEEAVEKINRVGIKDVQLLAEQLFASDKMVLTSIGPMDH 408


>gi|52141684|ref|YP_085146.1| zinc protease [Bacillus cereus E33L]
 gi|51975153|gb|AAU16703.1| zinc protease [Bacillus cereus E33L]
          Length = 413

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 403


>gi|295706235|ref|YP_003599310.1| zinc protease [Bacillus megaterium DSM 319]
 gi|294803894|gb|ADF40960.1| zinc protease [Bacillus megaterium DSM 319]
          Length = 414

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/400 (33%), Positives = 225/400 (56%), Gaps = 5/400 (1%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +  + S  + V I  GSR+E  E +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVLENISTVRSVAIGVWIGTGSRSEHSEINGVSHFLEHMFFKGTKTRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  NSSF+  ++ RE+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHADQALDVLADMFFNSSFDEEELAREKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     + V+ +  +G PILG  +T+ +F  + +  ++ + Y  + + +  
Sbjct: 129 MYEDTPDDIVHDLLGKAVYGNHPLGYPILGTEDTLKTFNGDSLRQYMEQMYIPENIVISV 188

Query: 189 VGAVDHEFCVSQVESYFNV-CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G +D  F + QVE+YF    S     + ++P  +      +K++  + H+ LGF G   
Sbjct: 189 AGNIDESF-IQQVENYFGTYTSSHSAHQYVQPGFHT-NHIARKKETEQAHLCLGFKGLPI 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G++ I   T    
Sbjct: 247 GGEDVYSLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYRDSGLVTIYGGTGSHQ 306

Query: 308 IMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  ++ E +  L +  I  +E+     ++   L+ S E +  R     K  +  G  
Sbjct: 307 LDVLYDTVQETLYDLKDKGITDKELANSKEQLKGNLMLSLESTNSRMSRNGKNELMLGYH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
              ++I+D ++A+T + + G+A+ IF     L+++ P  D
Sbjct: 367 RSLDEILDLVNAVTKDSVNGLARDIFKDEFALSLISPSGD 406


>gi|222097250|ref|YP_002531307.1| zinc protease [Bacillus cereus Q1]
 gi|221241308|gb|ACM14018.1| zinc protease [Bacillus cereus Q1]
          Length = 413

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 403


>gi|219669685|ref|YP_002460120.1| peptidase M16 domain protein [Desulfitobacterium hafniense DCB-2]
 gi|219539945|gb|ACL21684.1| peptidase M16 domain protein [Desulfitobacterium hafniense DCB-2]
          Length = 424

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/408 (32%), Positives = 232/408 (56%), Gaps = 15/408 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +ITE +  + S  V + + AGSR+ER+   G++HF+EHM FKGT  RTA++I E +
Sbjct: 9   NGVRIITEEIDYVRSVAVGIWVGAGSRDEREGYEGISHFIEHMFFKGTKNRTARDIAESL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG +NA+T+ E+T Y+A VL E + LA++++ DM   S F+ ++IE+E+ VV+EEI 
Sbjct: 69  EAVGGQLNAFTTKEYTCYYAKVLDEDMDLAMDVLNDMFFESLFDENEIEKEKKVVIEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   FS+ VW D  +GRPILG  E++   + EKI+ F+  +Y  D + +  
Sbjct: 129 MYEDSPDELIHDLFSDHVWNDHPLGRPILGTEESVKGLSREKILDFMDHHYAPDNLVIAV 188

Query: 189 VGAVDHEFCVSQVESY---FNVCSVAKIKESMKPAVYVGGEYIQK---RDLAEEHMMLGF 242
            G + H+  + ++      F       ++E+ K      G+ +Q+   +D  + H++LG 
Sbjct: 189 AGKIKHDEVLKKLAPLYGEFKRGGRRILEETPK------GQQVQEMILKDTEQMHLILGV 242

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G   +  D Y  +IL +ILG G+SSRLFQE+RE+RG+ Y++ ++H  + D G+  I + 
Sbjct: 243 PGLGQEDEDLYPMHILNNILGGGLSSRLFQEIREQRGMAYTVFSYHSTYVDTGLFAIYAG 302

Query: 303 TAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           T   N   +   ++  +  + +N I Q E+ +  ++I   L    E +  R   + K  +
Sbjct: 303 TTPSNSQEVVECVLAEILDIKKNGISQSELQRTKSQIKGGLYLGLESASSRMSRLGKTEL 362

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHV 408
               ++  E++++ +  +T ED   V  +++     +L +LGP  + V
Sbjct: 363 TYNRVISPEEVVEKLERVTVEDTKRVINRLWKRDKISLLMLGPAGNEV 410


>gi|47569082|ref|ZP_00239771.1| peptidase, M16 family [Bacillus cereus G9241]
 gi|47554244|gb|EAL12606.1| peptidase, M16 family [Bacillus cereus G9241]
          Length = 432

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 422


>gi|49478384|ref|YP_037866.1| zinc protease [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|196042172|ref|ZP_03109455.1| zinc protease, insulinase family [Bacillus cereus NVH0597-99]
 gi|196044543|ref|ZP_03111778.1| zinc protease, insulinase family [Bacillus cereus 03BB108]
 gi|206978178|ref|ZP_03239059.1| zinc protease, insulinase family [Bacillus cereus H3081.97]
 gi|217961225|ref|YP_002339793.1| zinc protease, insulinase family [Bacillus cereus AH187]
 gi|225865784|ref|YP_002751162.1| zinc protease, insulinase family [Bacillus cereus 03BB102]
 gi|49329940|gb|AAT60586.1| zinc protease [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|196024578|gb|EDX63250.1| zinc protease, insulinase family [Bacillus cereus 03BB108]
 gi|196027024|gb|EDX65648.1| zinc protease, insulinase family [Bacillus cereus NVH0597-99]
 gi|206743595|gb|EDZ55021.1| zinc protease, insulinase family [Bacillus cereus H3081.97]
 gi|217065864|gb|ACJ80114.1| zinc protease, insulinase family [Bacillus cereus AH187]
 gi|225789364|gb|ACO29581.1| zinc protease, insulinase family [Bacillus cereus 03BB102]
 gi|324327699|gb|ADY22959.1| zinc protease [Bacillus thuringiensis serovar finitimus YBT-020]
          Length = 413

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 403


>gi|327441004|dbj|BAK17369.1| predicted Zn-dependent peptidase [Solibacillus silvestris StLB046]
          Length = 408

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 146/412 (35%), Positives = 233/412 (56%), Gaps = 19/412 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++    +G+ ++TE MP + S  V + + AGSR E +EE+G+ HF+EHMLFKGT  R A
Sbjct: 2   VQVITAKNGVRIVTEQMPHVRSLSVGIWVNAGSRYETKEENGITHFIEHMLFKGTKNRIA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE +++GG+INA+TS EHT Y+A VL  H  LA++I+ DM  NS F   DIE+ER 
Sbjct: 62  RQIAEEFDRIGGEINAFTSKEHTCYYAKVLDHHGELAIDILADMFFNSLFAQEDIEKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI MSEDD  D +  +   +++ D  +GRPILG PET+++F  E I ++++++Y  
Sbjct: 122 VVLEEIYMSEDDPADDVHEKLWGVMFPDDALGRPILGTPETLATFDEEMIRTYMAKHYGP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA--VYVGGEYIQKRDLAEEHMM 239
             + +   G ++ E  + +VE+ F     +      KP+   +  GE  + RD  + H+ 
Sbjct: 182 QNVVISIAGNIE-ESLLEKVEALFGNYEASAKSIVSKPSYPTFTPGEIEKLRDTEQAHIA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F   A +    Y    L +I+G  MSSRLFQEVRE RGL YS+ ++  ++ D G   I
Sbjct: 241 ISFPAIAVKDPKMYSFIALNNIIGGNMSSRLFQEVREDRGLAYSVFSYQSSYEDVGTFTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++ +K+N+ +L   I + +  L+      E + E AK   K        ++  LE ++ 
Sbjct: 301 YASASKQNLDSLKQQIDQTLFDLVAG-GVTETELENAKEQLK------GGFVLGLEGTED 353

Query: 360 VMFCGSI--------LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            M    +           ++++  I AI+ E I  +  +I  S P +AI+GP
Sbjct: 354 FMNRNGVNELIHQNHRSVDEVLAKIDAISMETIDELITQILLSEPAIAIIGP 405


>gi|30263809|ref|NP_846186.1| zinc protease [Bacillus anthracis str. Ames]
 gi|47529232|ref|YP_020581.1| zinc protease [Bacillus anthracis str. 'Ames Ancestor']
 gi|49186655|ref|YP_029907.1| zinc protease [Bacillus anthracis str. Sterne]
 gi|165872603|ref|ZP_02217234.1| zinc protease, insulinase family [Bacillus anthracis str. A0488]
 gi|167635817|ref|ZP_02394126.1| zinc protease, insulinase family [Bacillus anthracis str. A0442]
 gi|167639881|ref|ZP_02398150.1| zinc protease, insulinase family [Bacillus anthracis str. A0193]
 gi|170687866|ref|ZP_02879080.1| zinc protease, insulinase family [Bacillus anthracis str. A0465]
 gi|170706822|ref|ZP_02897280.1| zinc protease, insulinase family [Bacillus anthracis str. A0389]
 gi|177652122|ref|ZP_02934668.1| zinc protease, insulinase family [Bacillus anthracis str. A0174]
 gi|190568414|ref|ZP_03021321.1| zinc protease, insulinase family [Bacillus anthracis
           Tsiankovskii-I]
 gi|218904932|ref|YP_002452766.1| zinc protease, insulinase family [Bacillus cereus AH820]
 gi|227813287|ref|YP_002813296.1| zinc protease, insulinase family [Bacillus anthracis str. CDC 684]
 gi|229602115|ref|YP_002868044.1| zinc protease, insulinase family [Bacillus anthracis str. A0248]
 gi|254683488|ref|ZP_05147348.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254722009|ref|ZP_05183798.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           A1055]
 gi|254735843|ref|ZP_05193549.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254739631|ref|ZP_05197325.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Kruger B]
 gi|254755996|ref|ZP_05208027.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Vollum]
 gi|254759343|ref|ZP_05211368.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Australia 94]
 gi|301055295|ref|YP_003793506.1| peptidase M16 domain-containing protein [Bacillus anthracis CI]
 gi|30258453|gb|AAP27672.1| zinc protease, insulinase family [Bacillus anthracis str. Ames]
 gi|47504380|gb|AAT33056.1| zinc protease, insulinase family [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180582|gb|AAT55958.1| zinc protease, insulinase family [Bacillus anthracis str. Sterne]
 gi|164711635|gb|EDR17181.1| zinc protease, insulinase family [Bacillus anthracis str. A0488]
 gi|167512282|gb|EDR87659.1| zinc protease, insulinase family [Bacillus anthracis str. A0193]
 gi|167528774|gb|EDR91532.1| zinc protease, insulinase family [Bacillus anthracis str. A0442]
 gi|170128240|gb|EDS97109.1| zinc protease, insulinase family [Bacillus anthracis str. A0389]
 gi|170668182|gb|EDT18931.1| zinc protease, insulinase family [Bacillus anthracis str. A0465]
 gi|172082491|gb|EDT67556.1| zinc protease, insulinase family [Bacillus anthracis str. A0174]
 gi|190560418|gb|EDV14396.1| zinc protease, insulinase family [Bacillus anthracis
           Tsiankovskii-I]
 gi|218537897|gb|ACK90295.1| zinc protease, insulinase family [Bacillus cereus AH820]
 gi|227007879|gb|ACP17622.1| zinc protease, insulinase family [Bacillus anthracis str. CDC 684]
 gi|229266523|gb|ACQ48160.1| zinc protease, insulinase family [Bacillus anthracis str. A0248]
 gi|300377464|gb|ADK06368.1| peptidase M16 domain protein [Bacillus cereus biovar anthracis str.
           CI]
          Length = 413

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 403


>gi|228935120|ref|ZP_04097947.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228824485|gb|EEM70290.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 432

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 422


>gi|118479025|ref|YP_896176.1| zinc protease [Bacillus thuringiensis str. Al Hakam]
 gi|118418250|gb|ABK86669.1| zinc protease [Bacillus thuringiensis str. Al Hakam]
          Length = 432

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 229/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 422


>gi|300024405|ref|YP_003757016.1| processing peptidase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526226|gb|ADJ24695.1| processing peptidase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 433

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 227/405 (56%), Gaps = 5/405 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   ++  S+G+ V T  MP +++  + V +  GSR+ER ++HG++HFLEHM FKGT  R
Sbjct: 1   MTTELTTLSNGVRVATHRMPNLETVSLGVWVAVGSRHERDDQHGLSHFLEHMAFKGTKSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I E IE VGGD+NA T L+ T+Y+A VLK    +ALE+I D+L NS F P D++RE
Sbjct: 61  SARMIAETIESVGGDLNAATGLDTTAYYARVLKGDEGVALELIADILLNSKFAPEDLDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+ +EI  ++D   D +      + + +Q IGRPILG   ++  F    +  ++  +Y
Sbjct: 121 RVVIQQEIASTDDSPDDIIFDLMQSVAFPEQAIGRPILGTKASVGRFRAADLSGYLDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             + + V   GAV H+  V  VE+ F  +    +  ES+  A Y GG     +   + H+
Sbjct: 181 LPEAIVVSAAGAVHHDEIVRHVEALFGGLTQRRRGTESL--ARYRGGSTASAKPFEQSHV 238

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     FY   + + +LG GMSSRLFQEVRE RGLCYSI +      D G+L 
Sbjct: 239 LIGLPSPSCLEPAFYTAQVFSGLLGGGMSSRLFQEVREDRGLCYSIYSTVWGVKDTGMLA 298

Query: 299 IASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           + +AT  E +  L + +     SL +      E+ +  A++ A L+ + E S + A +++
Sbjct: 299 VHAATGPEMVDELAAVVAGEFASLADAGPTDAELLRAKAQLKAGLLMALESSSVNAEQMA 358

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           +Q++     +   ++ID + A+  + I   A  + S + ++A++G
Sbjct: 359 RQLLAQDRFVAMSELIDEVEAVDRDRIRDFAGSLRSESASVAVIG 403


>gi|89895252|ref|YP_518739.1| hypothetical protein DSY2506 [Desulfitobacterium hafniense Y51]
 gi|89334700|dbj|BAE84295.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 424

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 131/408 (32%), Positives = 233/408 (57%), Gaps = 15/408 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +ITE +  + S  V + + AGSR+E++   G++HF+EHM FKGT  RTA++I E +
Sbjct: 9   NGVRIITEEIDYVRSVAVGIWVGAGSRDEKEGYEGISHFIEHMFFKGTKNRTARDIAESL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG +NA+T+ E+T Y+A VL E + LA++++ DM   S F+ ++IE+E+ VV+EEI 
Sbjct: 69  EAVGGQLNAFTTKEYTCYYAKVLDEDMDLAMDVLNDMFFESLFDENEIEKEKKVVIEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   FS+ VW D  +GRPILG  E++   + EKI++F+  +Y  D + +  
Sbjct: 129 MYEDSPDELIHDLFSDHVWNDHPLGRPILGTEESVKGLSREKILTFMDHHYAPDNLVIAV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAK---IKESMKPAVYVGGEYIQK---RDLAEEHMMLGF 242
            G + H+  + ++   +          ++E+ K      G+ +Q+   +D  + H++LG 
Sbjct: 189 AGKIKHDEVLKKLAPLYGEFKRGGRRILEETPK------GQQVQEMILKDTEQMHLILGV 242

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G   +  D Y  +IL +ILG G+SSRLFQE+RE+RG+ Y++ ++H  + D G+  I + 
Sbjct: 243 PGLGQEDEDLYPMHILNNILGGGLSSRLFQEIREQRGMAYTVFSYHSTYVDTGLFAIYAG 302

Query: 303 TAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           T   N   +   ++  +  + +N I Q E+ +  ++I   L    E +  R   + K  +
Sbjct: 303 TTPSNSQEVVECVLAEILDIKKNGISQSELQRTKSQIKGGLYLGLESASSRMSRLGKTEL 362

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHV 408
               ++  E++++ +  +T ED   V  +++     +L +LGP  + V
Sbjct: 363 TYNRVISPEEVVEKLERVTVEDTKRVINRLWKRDKISLLMLGPAGNEV 410


>gi|228922559|ref|ZP_04085859.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836988|gb|EEM82329.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 399

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 222/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++ G+ + +F+   + A++ P
Sbjct: 366 TKENVDGLIRNMFTDEFSAALISP 389


>gi|65321132|ref|ZP_00394091.1| COG0612: Predicted Zn-dependent peptidases [Bacillus anthracis str.
           A2012]
          Length = 432

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 228/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L   + E +++L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYEXMQETLETLKXXGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T E++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKENVDELIRNMFTDEFSAALISP 422


>gi|218898957|ref|YP_002447368.1| zinc protease, insulinase family [Bacillus cereus G9842]
 gi|228902307|ref|ZP_04066465.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis IBL
           4222]
 gi|228940893|ref|ZP_04103452.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228973822|ref|ZP_04134398.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980411|ref|ZP_04140721.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis Bt407]
 gi|218545339|gb|ACK97733.1| zinc protease, insulinase family [Bacillus cereus G9842]
 gi|228779231|gb|EEM27488.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis Bt407]
 gi|228785847|gb|EEM33850.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818729|gb|EEM64795.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228857331|gb|EEN01833.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis IBL
           4222]
          Length = 399

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 222/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++ G+ + +F+   + A++ P
Sbjct: 366 TKENVDGLIRNMFTDEFSAALISP 389


>gi|228909629|ref|ZP_04073452.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis IBL 200]
 gi|228849918|gb|EEM94749.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis IBL 200]
          Length = 399

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYDTMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++ G+ + +F+   + A++ P
Sbjct: 366 TKENVDGLIRNMFTDEFSAALISP 389


>gi|261407928|ref|YP_003244169.1| peptidase M16 domain-containing protein [Paenibacillus sp.
           Y412MC10]
 gi|261284391|gb|ACX66362.1| peptidase M16 domain protein [Paenibacillus sp. Y412MC10]
          Length = 422

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 129/398 (32%), Positives = 224/398 (56%), Gaps = 3/398 (0%)

Query: 7   KTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           + S+G+ V+ E +P   S    + ++ GSRNE ++ +G+ HF+EHM+FKGT +  A+ I 
Sbjct: 5   QLSNGLRVVMEQIPTSRSVSFGIWVKTGSRNESEDINGITHFIEHMMFKGTERFDARAIA 64

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           EE + +GG++NA+TS E+T Y+A VL EH P+A++++ DM  NS  +P ++ +E+NV+LE
Sbjct: 65  EEFDAIGGNVNAFTSKEYTCYYAKVLDEHFPIAVDVLSDMFFNSKLDPGELAKEKNVILE 124

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M ED   D +    S  V+ D  +  PILG  E + S   + + S++ R+YT +   
Sbjct: 125 EIAMYEDTPDDLVHDLMSLSVYGDHPLAYPILGTKERLESMDSQALRSYMDRHYTIENTV 184

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
           +   G ++ E  ++ +E +F   +     E +    ++ G   +K+   + H+ + F GC
Sbjct: 185 IALAGNINDE-VIALLERHFGGFANHGTSEPLAVPAFLDGVQFRKKKTEQNHICMSFPGC 243

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
           +      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +DNG+  I + TA 
Sbjct: 244 SIGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADNGMFTIYAGTAP 303

Query: 306 ENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
           +    +     E++  L +N + + E+ K   ++   LI S E +  R   + K  +  G
Sbjct: 304 KQTKEVLQLTTEMLHDLAQNGMTEEELRKGKEQLKGSLILSLESTSSRMNRLGKNELMLG 363

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
                ++II  I  +  +D+  V  ++F +   LA++G
Sbjct: 364 RHFSLDEIIKRIEQVDMKDVNAVLDRMFGTPYALAMVG 401


>gi|228960022|ref|ZP_04121686.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228966749|ref|ZP_04127793.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|229047491|ref|ZP_04193081.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH676]
 gi|229111276|ref|ZP_04240829.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock1-15]
 gi|229129081|ref|ZP_04258054.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-Cer4]
 gi|229146376|ref|ZP_04274747.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST24]
 gi|229152005|ref|ZP_04280200.1| Uncharacterized zinc protease ymxG [Bacillus cereus m1550]
 gi|228631354|gb|EEK87988.1| Uncharacterized zinc protease ymxG [Bacillus cereus m1550]
 gi|228637009|gb|EEK93468.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST24]
 gi|228654318|gb|EEL10183.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-Cer4]
 gi|228672052|gb|EEL27343.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock1-15]
 gi|228723738|gb|EEL75093.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH676]
 gi|228792848|gb|EEM40406.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228799538|gb|EEM46491.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 399

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 222/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++ G+ + +F+   + A++ P
Sbjct: 366 TKENVDGLIRNMFTDEFSAALISP 389


>gi|228954081|ref|ZP_04116110.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229071303|ref|ZP_04204526.1| Uncharacterized zinc protease ymxG [Bacillus cereus F65185]
 gi|229081060|ref|ZP_04213570.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock4-2]
 gi|229180082|ref|ZP_04307426.1| Uncharacterized zinc protease ymxG [Bacillus cereus 172560W]
 gi|229191974|ref|ZP_04318944.1| Uncharacterized zinc protease ymxG [Bacillus cereus ATCC 10876]
 gi|228591525|gb|EEK49374.1| Uncharacterized zinc protease ymxG [Bacillus cereus ATCC 10876]
 gi|228603291|gb|EEK60768.1| Uncharacterized zinc protease ymxG [Bacillus cereus 172560W]
 gi|228702104|gb|EEL54580.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock4-2]
 gi|228711757|gb|EEL63709.1| Uncharacterized zinc protease ymxG [Bacillus cereus F65185]
 gi|228805647|gb|EEM52237.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 399

 Score =  245 bits (626), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 125/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++ G+ + +F+   + A++ P
Sbjct: 366 TKENVDGLIRNMFTDEFSAALISP 389


>gi|134299795|ref|YP_001113291.1| peptidase M16 domain-containing protein [Desulfotomaculum reducens
           MI-1]
 gi|134052495|gb|ABO50466.1| peptidase M16 domain protein [Desulfotomaculum reducens MI-1]
          Length = 422

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/400 (32%), Positives = 239/400 (59%), Gaps = 3/400 (0%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++T+ V  + S  + + +  GSR+E  E  G++H++EHM+FKGT  RT K+I EE+
Sbjct: 10  NGVRILTQQVSHVRSVAMGIWVDVGSRDESDETAGISHYIEHMMFKGTKHRTPKQIAEEL 69

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG +NA+T+ E+T Y+A VL EH  LA++++ DML +S+ +  D+ERE+NV+LEEI 
Sbjct: 70  DAVGGQLNAFTTKEYTCYYAKVLDEHFNLAVDVLTDMLFHSNISELDVEREKNVILEEIK 129

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   F++ +W    +GRPI+G  ET+SSF+ + +  F+  NY  +R+ V  
Sbjct: 130 MYEDAPDELVHDMFAKTIWAGHPLGRPIIGTTETVSSFSYQDLRLFMKENYAPNRIVVSV 189

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G + H+  ++++   F   S  +++  ++   +      + ++  + HM++G  G    
Sbjct: 190 SGNITHQQVINKLAPLFGNMSGNQVRRQLEKPTHSIEVNCRSKETEQVHMVIGAPGLRLD 249

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y+  ++ ++LG G+SSRLFQE+RE+RGL YS+ ++H ++ D G+  + +  +K+N+
Sbjct: 250 DDSLYIAQVINTVLGGGLSSRLFQEIREQRGLVYSVYSYHSSYHDTGIFGVYAGLSKQNV 309

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
                 I + ++ + +N I Q+E+ +   ++   L+ S E        + K  ++ G + 
Sbjct: 310 NNAMELIFKEIKDIKQNGISQKELQRAKDQLKGNLLLSLESVNTHMSRLGKSELYLGKVY 369

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMD 406
             E+I++ ++ +T ED V VA+++F     ++A +GP  D
Sbjct: 370 SPEEIVEKLNRVTLEDTVRVAEELFQPDKFSMAAIGPWQD 409


>gi|295836211|ref|ZP_06823144.1| M16 family peptidase [Streptomyces sp. SPB74]
 gi|197699244|gb|EDY46177.1| M16 family peptidase [Streptomyces sp. SPB74]
          Length = 471

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/414 (32%), Positives = 224/414 (54%), Gaps = 14/414 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 46  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTARRT 105

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S+ + +DI+ ER
Sbjct: 106 ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSTLDAADIDAER 165

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   E+I  F  R+Y 
Sbjct: 166 GVILEEIAMTEDDPGDVVHDLFAHTMLGDTPLGRPVLGTVDTINALGREQIARFYKRHYD 225

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI--------QKRD 232
              + V   G VDH   V QV + F+        E+       G   I        Q R 
Sbjct: 226 PTHLVVAAAGNVDHAKVVRQVRAAFDRAGALGRAEAAPLGPREGTRLIRAAGRVEVQNRR 285

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 286 TEQAHVVLGMPGIARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 345

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +  ++++ +    +E V +    +   EI +   ++    +   E +
Sbjct: 346 DCGLFGVYAGCRPSQVDDVLKICREELETVAA--HGLADEEIRRAVGQLAGSTVLGLEDT 403

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
                 I K  +  G  L  + ++  I+A+T +++  VA+ I    P+L+++GP
Sbjct: 404 GALMNRIGKSELCWGEQLSVDDMLARIAAVTPDEVRAVARDILGQRPSLSVIGP 457


>gi|296269052|ref|YP_003651684.1| peptidase M16 domain-containing protein [Thermobispora bispora DSM
           43833]
 gi|296091839|gb|ADG87791.1| peptidase M16 domain protein [Thermobispora bispora DSM 43833]
          Length = 435

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 142/414 (34%), Positives = 228/414 (55%), Gaps = 17/414 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE MP + S  V + +  GSR+E  E  G  HFLEH+LFKGT  R A
Sbjct: 15  VRRTVLPGGLRVVTETMPTVRSVAVGIWVGIGSRDEAPEHMGATHFLEHLLFKGTPTRNA 74

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   IE +GG+INA+T+ E+T Y+A VL E + +A++++ D++++S   P D+E ER 
Sbjct: 75  MEISASIEGIGGEINAFTAKEYTCYYARVLDEDLAIAIDVLADVVTSSLLAPEDVESERG 134

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   FS  ++ D  IGRPILG  E+I++ T ++I  +  R Y  
Sbjct: 135 VILEEIAMHDDDPADLVHEEFSAELFGDTPIGRPILGNEESINALTRDRIGEYYRRFYVP 194

Query: 182 DRMYVVCVGAVDHEFCVSQV-ESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-------- 232
            R  V  VG VDHE  V  V  +Y    ++    E   P   +GG  + +R         
Sbjct: 195 SRTVVSVVGNVDHERVVDLVAAAYERAGALHGPAEPAPP--RIGGPGVPQRSGVRVIARP 252

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + +++LG           +   +L + LG GMSSRLFQE+REKRGL YS  +   +++
Sbjct: 253 TEQANLVLGTTAYPRTDERRFALGVLNAALGGGMSSRLFQEIREKRGLAYSTYSFTAHYA 312

Query: 293 DNGV--LYIASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G   +Y+    +K + ++ +     E+ + L E +   EI +   ++   L+   E +
Sbjct: 313 DTGQFGIYVGCLPSKIDEVLKICRD--EMARVLTEGLTPEEIARGKGQMRGGLVLGLEDT 370

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   I+K  +    ++  ++++  I+A+T ED+  VA+ +F+   TLA++GP
Sbjct: 371 GSRMSRIAKSELVYERLMPVDEVLARIAAVTPEDVAAVAQDVFNRPLTLAVIGP 424


>gi|302522242|ref|ZP_07274584.1| protease [Streptomyces sp. SPB78]
 gi|302431137|gb|EFL02953.1| protease [Streptomyces sp. SPB78]
          Length = 470

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/414 (32%), Positives = 227/414 (54%), Gaps = 14/414 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 45  TVRRTTLPGGLRVVTETLPSVRSATFGIWAGVGSRDESPTLNGATHYLEHLLFKGTRRRT 104

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S+ + +DI+ ER
Sbjct: 105 ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSTLDAADIDAER 164

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   ++I  F  R+Y 
Sbjct: 165 GVILEEIAMTEDDPGDVVHDLFAHTMLGDTPLGRPVLGTVDTINALGRDQIARFYKRHYD 224

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI--------QKRD 232
              + V   G VDH   V QV + F+        +++  A   G   I        Q R 
Sbjct: 225 PTHLVVAAAGNVDHAKVVRQVRAAFDRAGALGRGDAVPLAPREGTRLIKAAGRVEVQNRR 284

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 285 TEQAHVVLGMPGIARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 344

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +  ++++ +    +E V +    ++  EI +   ++    +   E +
Sbjct: 345 DCGLFGVYAGCRPSQVDDVLKICRDELETVAA--HGLDDDEIRRAVGQLAGSTVLGLEDT 402

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
                 I K  +  G  L  + ++  I+A+T +++  VA+ I    P+L+++GP
Sbjct: 403 GALMNRIGKSELCWGEQLSVDDMLAKIAAVTPDEVRAVARDILGQRPSLSVIGP 456


>gi|229162741|ref|ZP_04290698.1| Uncharacterized zinc protease ymxG [Bacillus cereus R309803]
 gi|228620623|gb|EEK77492.1| Uncharacterized zinc protease ymxG [Bacillus cereus R309803]
          Length = 399

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/384 (32%), Positives = 220/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE  + +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENVKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 ILGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYDTMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++ G+ + +F+   + A++ P
Sbjct: 366 TKENVDGLIRNMFTDEFSAALISP 389


>gi|318062385|ref|ZP_07981106.1| putative protease [Streptomyces sp. SA3_actG]
 gi|318078518|ref|ZP_07985850.1| putative protease [Streptomyces sp. SA3_actF]
          Length = 470

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/414 (32%), Positives = 227/414 (54%), Gaps = 14/414 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 45  TVRRTTLPGGLRVVTETLPSVRSATFGIWAGVGSRDESPTLNGATHYLEHLLFKGTRRRT 104

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S+ + +D++ ER
Sbjct: 105 ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSTLDAADVDAER 164

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   ++I  F  R+Y 
Sbjct: 165 GVILEEIAMTEDDPGDVVHDLFAHTMLGDTPLGRPVLGTVDTINALGRDQIARFYKRHYD 224

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI--------QKRD 232
              + V   G VDH   V QV + F+        +++  A   G   I        Q R 
Sbjct: 225 PTHLVVAAAGNVDHAKVVRQVRAAFDRAGSLGRGDAVPLAPREGTRLIKAAGRVEVQNRR 284

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 285 TEQAHVVLGMPGIARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 344

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +  ++++ +    +E V +    I+  EI +   ++    +   E +
Sbjct: 345 DCGLFGVYAGCRPSQVDDVLKICRDELETVAA--HGIDDDEIRRAVGQLAGSTVLGLEDT 402

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
                 I K  +  G  L  + ++  I+A+T +++  VA+ I    P+L+++GP
Sbjct: 403 GALMNRIGKSELCWGEQLSVDDMLAKIAAVTPDEVRAVARDILGQRPSLSVIGP 456


>gi|269959140|ref|YP_003328929.1| putative peptidase [Anaplasma centrale str. Israel]
 gi|269848971|gb|ACZ49615.1| putative peptidase [Anaplasma centrale str. Israel]
          Length = 436

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 241/401 (60%), Gaps = 11/401 (2%)

Query: 5   ISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++K  +  T+++E V  ++S  + + ++ GSR+E + + G+AHFLEHM FKGT+ R+A +
Sbjct: 22  VTKLQNNFTIVSEKVDGVNSVGISLWVKTGSRHEEEGKIGLAHFLEHMAFKGTSTRSALD 81

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I    +++GG+ NAYT  EHT YH  V+K    +ALEI+ D++  S+F   +IERE+NVV
Sbjct: 82  IAMAFDQIGGNFNAYTDKEHTVYHVKVMKRDARIALEILEDIVLRSAFPEVEIEREKNVV 141

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E+ +KDQI G PILG  +++   +   ++ +++ NY  + 
Sbjct: 142 LQEIYQTNDAPGSIIFDKYMEVAYKDQIFGAPILGSEQSVLGLSRADLVQYMNVNYYGNN 201

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES----MKPAVYVGGEYIQKRDLAEEHMM 239
           + +   G + HE  V   + +      A+IK+     + P VY GG+Y++ RDL + +++
Sbjct: 202 IILSVAGNIGHEDVVLMSQGF------AQIKDQNPQPVVPPVYTGGQYVEARDLDQVNIV 255

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G +Y    +Y+  +L  ILG  MSSRLFQE+RE+RGL YSIS+ + ++SD+G+  I
Sbjct: 256 IGFPGVSYVDEGYYIMQVLDVILGSSMSSRLFQEIRERRGLVYSISSFNSSYSDSGLFSI 315

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + ++  L  +I   ++ L E +++ E+ +  +K+ ++++ S+E +  ++  +   
Sbjct: 316 HAATDEGHLQELLKTIAAEMKKLPETVKEEELLRAQSKLESEVLMSRESTVGKSEALGYC 375

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAI 400
               G  +  E++I  I A+T  D+V VA  +  +   L +
Sbjct: 376 YSHYGRYITKEEMIGRIRAVTLSDVVNVADLLLQNRKRLTV 416


>gi|229134612|ref|ZP_04263422.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST196]
 gi|228648873|gb|EEL04898.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST196]
          Length = 432

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 227/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + V I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGVWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSKQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLNALKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T +++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISP 422


>gi|163941542|ref|YP_001646426.1| peptidase M16 domain-containing protein [Bacillus
           weihenstephanensis KBAB4]
 gi|163863739|gb|ABY44798.1| peptidase M16 domain protein [Bacillus weihenstephanensis KBAB4]
          Length = 413

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 227/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 129 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTPENVVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 189 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 248 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSKQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 308 DTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T +++  + + +F+   + A++ P
Sbjct: 368 SLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISP 403


>gi|229061408|ref|ZP_04198753.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH603]
 gi|229168544|ref|ZP_04296267.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH621]
 gi|228614950|gb|EEK72052.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH621]
 gi|228717831|gb|EEL69479.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH603]
          Length = 432

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 227/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSKQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T +++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISP 422


>gi|311030079|ref|ZP_07708169.1| Zn-dependent peptidase [Bacillus sp. m3-13]
          Length = 414

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 135/398 (33%), Positives = 224/398 (56%), Gaps = 5/398 (1%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ ++ E +P + S  + V I  GSRNE    +G++HFLEHM FKGT  + A+EI E 
Sbjct: 8   SNGVRIVLENIPHVRSVAIGVWIGTGSRNEDNVNNGVSHFLEHMFFKGTETKNAREIAEA 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
            + +GG +NA+TS E+T Y+A V+ EH   AL ++ DM  +S F+  ++++E+NVV EEI
Sbjct: 68  FDSIGGQVNAFTSKEYTCYYAKVMDEHSSYALGVLADMFFHSIFDEEELKKEKNVVYEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M ED   D +    +   + +  +G PILG  ET+S+F    +  ++   YT D + + 
Sbjct: 128 KMYEDAPDDIVHDVLARASYGNHPLGYPILGTEETLSAFNGNTLRDYMKETYTPDNVVIS 187

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIK-ESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
             G +D  F V ++E+ F        K E +KP+ +  G   +K+   + H+ +G++G  
Sbjct: 188 VAGNIDESF-VKEIENLFGSYETGHSKREYVKPS-FETGRIAKKKTTEQAHLCIGYDGLQ 245

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
              +D Y   +L ++LG  MSSRLFQ+VRE+RGL YS+ ++H  F DNG+L I   T   
Sbjct: 246 IGDKDIYNLIVLNNVLGGSMSSRLFQDVREERGLAYSVYSYHSTFQDNGMLTIYGGTGSN 305

Query: 307 NIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
            +  L  +I + + +L  + I ++E+     +I   L+ S E +  R     K  +  G 
Sbjct: 306 QLDLLFETIQQTLNTLKHDGITKKELVNSKEQIKGSLMLSLESTNSRMSRNGKNELLLGR 365

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               + I++ I++IT E +  +A KIF+   ++A++ P
Sbjct: 366 HRSLDDILERINSITEESVNNLATKIFTDEYSVALISP 403


>gi|302537282|ref|ZP_07289624.1| protease [Streptomyces sp. C]
 gi|302446177|gb|EFL17993.1| protease [Streptomyces sp. C]
          Length = 459

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 225/414 (54%), Gaps = 14/414 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPALNGATHYLEHLLFKGTAQRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIREEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F++ ++ D  +GRP+LG  +TI++   ++I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDMVHDLFAQTMYGDSPLGRPVLGTVDTINALGADRIRRFWKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV + F      K  +++      G + I+         R 
Sbjct: 214 PTHLVVAAAGNVDHNKVVRQVRAAFEKAGALKQTDAVPLGPRTGTKRIRTAGRVDLVNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +   +++ +    ++ V S  E +   EI +   ++    +   E +
Sbjct: 334 DTGLFGVYAGCRPSQVHDVLRICRQELDTVAS--EGLTDEEIRRAVGQLSGSTVLGLEDT 391

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
                 I K  +  G  +  + ++  I+++T +D+  VA+ + +  P+LA++GP
Sbjct: 392 GAIMNRIGKSELCWGDQMSVDDMLARIASVTPDDVRAVAQDVLAQRPSLAVIGP 445


>gi|147677613|ref|YP_001211828.1| Zn-dependent peptidase [Pelotomaculum thermopropionicum SI]
 gi|146273710|dbj|BAF59459.1| predicted Zn-dependent peptidases [Pelotomaculum thermopropionicum
           SI]
          Length = 424

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 229/397 (57%), Gaps = 3/397 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE +P + S  V   +  GSR+E  E +G++HF+EH++FKGT KRTAK+I E +
Sbjct: 9   NGVHILTEDVPHVRSVAVGYWVDVGSRDENPEINGISHFIEHLMFKGTEKRTAKDIAEAL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG +NA+T+ E+T Y+A VL EH  LA++++ DML +S F   DIERERNV++EEI 
Sbjct: 69  DAVGGQLNAFTTKEYTCYYARVLDEHFDLAVDLLSDMLFSSKFAAHDIERERNVIIEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   F+  +W+   +GRPI+G  E I+  + + I++F + +Y   ++ V  
Sbjct: 129 MYEDAPDELVHDIFAGSLWQGHALGRPIIGTSEVIARLSRDDIVNFYNTHYKPGKIVVAV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G + HE  V ++   F     +     M           + +D  + H+ +G  G +  
Sbjct: 189 AGNIRHEEVVKKLRPIFESREGSVQSREMTSPAPSCEVTCRNKDTEQVHLCVGTPGLSLD 248

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y+  ++ ++LG G+SSRLFQE+REKRGL YS+ ++H ++ D G+  I +  ++ N+
Sbjct: 249 HEKIYVFQVINTVLGGGLSSRLFQEIREKRGLVYSVYSYHTSYHDTGLFCIYAGLSRHNV 308

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   I + V+ + +N +++ E+ +   ++   L  S E    R   + K  ++ G ++
Sbjct: 309 DEVLELIFKQVEDIQKNGVKEEELQRAKDQLKGNLYLSLENVSTRMSRLGKSQLYLGKVV 368

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
             E+I+  ++ +T +++  +A K+      +LA +GP
Sbjct: 369 PPEEIVARVNMVTADEVQELAGKMLKPEYFSLAAIGP 405


>gi|239982655|ref|ZP_04705179.1| putative protease [Streptomyces albus J1074]
 gi|291454496|ref|ZP_06593886.1| protease [Streptomyces albus J1074]
 gi|291357445|gb|EFE84347.1| protease [Streptomyces albus J1074]
          Length = 458

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 132/417 (31%), Positives = 226/417 (54%), Gaps = 14/417 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   + +  GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 33  TVRRTTLPGGLRVVTETLPSVRSATFGIWVNVGSRDETPTLNGATHYLEHLLFKGTAKRS 92

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 93  ALDISAAVDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 152

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   ++I  F  R+Y 
Sbjct: 153 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALGRDQIARFYKRHYD 212

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
             R+ V   G VDH   V QV + F+     +  ++   A   G   ++         R 
Sbjct: 213 PTRLVVAAAGNVDHARVVRQVRAAFDRAGALERTDAEPTAPRAGSRTLRANGKIEVVNRR 272

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +  ++L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 273 TEQAHVILGMPGLARTDDRRWAMSVLNAALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 332

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +  ++++ +    ++ V      +   E+ +   ++    +   E +
Sbjct: 333 DCGLFGVYAGCRPSQVDDVLRICRDELDAVAG--GGLSDDEVSRAIGQLAGSTVLGLEDT 390

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
                 I K  +  G  +  + ++  ISA+T +++  VA+ I    P+L+++GP  D
Sbjct: 391 GALMNRIGKSELCWGEQMSVDDMLAKISAVTPDEVREVARDILGQRPSLSVIGPLKD 447


>gi|297562515|ref|YP_003681489.1| peptidase M16 domain protein [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846963|gb|ADH68983.1| peptidase M16 domain protein [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 444

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 142/414 (34%), Positives = 221/414 (53%), Gaps = 17/414 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P + SA   ++   GSR+E     G AHFLEH+LFKGT +R+A
Sbjct: 28  VRRTVLPGGLRVVTEAVPGVRSAAFGISATTGSRDEDSAHAGSAHFLEHLLFKGTKERSA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   ++ VG D NAYT+ EHT Y+A VL   +PLA+++IGDM++NS  +  ++E ER 
Sbjct: 88  LEISALLDGVGADHNAYTTKEHTCYYAKVLDRDLPLAVDVIGDMVANSVLDEGEVETERG 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED+  D +D  F+   + D  +GRPILG  +TI + + ++I       Y  
Sbjct: 148 VILEEIAMYEDEPADLVDDVFAAHFFGDSPLGRPILGTTDTIEALSRDRIAEQYRDAYVP 207

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSV-------AKIKESMKPAVYVGGEYIQKRDLA 234
             + V   G++DH+  V QV + F   S        A+ +    P    GG  +Q R+  
Sbjct: 208 GELIVTAAGSLDHDRVVEQVRALFAEHSAAAGDARPARPRIGGSPVATYGGTVVQSRETE 267

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + H++LG  G       ++   +L++ LG GMSSRLFQEVREKRGL Y++ A++ +++D 
Sbjct: 268 QAHIILGSEGLCRTDPRWHALRLLSAALGGGMSSRLFQEVREKRGLAYAVHAYNADYADT 327

Query: 295 GVLYIASA----TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           G   I +      A E I      + +V  S    I + E+ +   +I   L+   E + 
Sbjct: 328 GSFQIYAGCLPDKADEVIGVCREELAKVAAS---GITEEELARAKGQIQGSLVLGSEGTN 384

Query: 351 LR-ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R    +S ++   G     E +     A+T  ++  VA  + S    LA++GP
Sbjct: 385 ARMGRLLSHELNRPGHYSIDESLA-LFDAVTGAEVAEVAADLLSRPRALAVIGP 437


>gi|15614968|ref|NP_243271.1| processing protease [Bacillus halodurans C-125]
 gi|10175025|dbj|BAB06124.1| processing protease [Bacillus halodurans C-125]
          Length = 413

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 225/394 (57%), Gaps = 3/394 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +ITE M  + S  + + +  GSR E  EE+G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIITEKMSTVRSVSIGIWVGTGSRYESAEENGISHFLEHMFFKGTNTRSAQEIAEFF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL +H   A++ + DM  +S+F   ++E+ER VV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDDHAGQAIDTLSDMFFHSTFQKEELEKERKVVFEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +D   D +    S   +    +G PILG  ET++SF    +  ++ R YT D + +  
Sbjct: 129 MVDDTPDDIVHDLLSSATYGKHSLGYPILGTVETLNSFNEGMLRHYMDRFYTGDYVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V  E      E++  V       +  KP +++    ++K++  + H+ LG+ G    
Sbjct: 189 AGNVHDELIDKIKETFSQVKPTTYNYQGEKP-MFLPNRIVRKKETEQAHLCLGYPGLPIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
            +D Y   +L ++LG  MSSRLFQ++REKRGLCYS+ ++H +F D+G+L I + T  + +
Sbjct: 248 DKDVYALVLLNNVLGGSMSSRLFQDIREKRGLCYSVFSYHSSFRDSGMLTIYAGTGHDQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  SI E   +L E  + ++E++    ++   L+ S E +  R     K  +      
Sbjct: 308 DDLVYSIQETTSALAEKGLTEKELENGKEQLKGSLMLSLESTNSRMSRNGKNELLLKKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
             +++I+ I+A+  +D+  +AK + S++P+++++
Sbjct: 368 SLDEMIEQINAVQKQDVSRLAKILLSASPSISLI 401


>gi|228928854|ref|ZP_04091886.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228830661|gb|EEM76266.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 399

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNIGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++  + + +F+   + A++ P
Sbjct: 366 TKENVDELIRNMFTDEFSAALISP 389


>gi|270346540|pdb|3HDI|A Chain A, Crystal Structure Of Bacillus Halodurans Metallo Peptidase
 gi|270346541|pdb|3HDI|B Chain B, Crystal Structure Of Bacillus Halodurans Metallo Peptidase
          Length = 421

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 225/394 (57%), Gaps = 3/394 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +ITE M  + S  + + +  GSR E  EE+G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRIITEKMSTVRSVSIGIWVGTGSRYESAEENGISHFLEHMFFKGTNTRSAQEIAEFF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL +H   A++ + DM  +S+F   ++E+ER VV EEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDDHAGQAIDTLSDMFFHSTFQKEELEKERKVVFEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +D   D +    S   +    +G PILG  ET++SF    +  ++ R YT D + +  
Sbjct: 129 MVDDTPDDIVHDLLSSATYGKHSLGYPILGTVETLNSFNEGMLRHYMDRFYTGDYVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V  E      E++  V       +  KP +++    ++K++  + H+ LG+ G    
Sbjct: 189 AGNVHDELIDKIKETFSQVKPTTYNYQGEKP-MFLPNRIVRKKETEQAHLCLGYPGLPIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
            +D Y   +L ++LG  MSSRLFQ++REKRGLCYS+ ++H +F D+G+L I + T  + +
Sbjct: 248 DKDVYALVLLNNVLGGSMSSRLFQDIREKRGLCYSVFSYHSSFRDSGMLTIYAGTGHDQL 307

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  SI E   +L E  + ++E++    ++   L+ S E +  R     K  +      
Sbjct: 308 DDLVYSIQETTSALAEKGLTEKELENGKEQLKGSLMLSLESTNSRMSRNGKNELLLKKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
             +++I+ I+A+  +D+  +AK + S++P+++++
Sbjct: 368 SLDEMIEQINAVQKQDVSRLAKILLSASPSISLI 401


>gi|229018999|ref|ZP_04175841.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1273]
 gi|229025244|ref|ZP_04181666.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1272]
 gi|228736072|gb|EEL86645.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1272]
 gi|228742327|gb|EEL92485.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1273]
          Length = 432

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 227/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDESF-LQIVEQYFGNYEGTTNREQVHIPIFHFNKVSRKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T +++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISP 422


>gi|229012988|ref|ZP_04170153.1| Uncharacterized zinc protease ymxG [Bacillus mycoides DSM 2048]
 gi|228748242|gb|EEL98102.1| Uncharacterized zinc protease ymxG [Bacillus mycoides DSM 2048]
          Length = 432

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 125/396 (31%), Positives = 227/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 28  NGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESF 87

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI 
Sbjct: 88  DSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIK 147

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +D   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V  
Sbjct: 148 MYDDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTPENVVVSI 207

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D  F +  VE YF        +E +   ++   +  +K++  + H+ LG+ G    
Sbjct: 208 AGNIDEAF-LQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMG 266

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +
Sbjct: 267 HEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSKQL 326

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  +      
Sbjct: 327 DTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHR 386

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II++++ +T +++  + + +F+   + A++ P
Sbjct: 387 SLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISP 422


>gi|228986948|ref|ZP_04147074.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229140446|ref|ZP_04269001.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST26]
 gi|229157382|ref|ZP_04285460.1| Uncharacterized zinc protease ymxG [Bacillus cereus ATCC 4342]
 gi|229197915|ref|ZP_04324631.1| Uncharacterized zinc protease ymxG [Bacillus cereus m1293]
 gi|228585633|gb|EEK43735.1| Uncharacterized zinc protease ymxG [Bacillus cereus m1293]
 gi|228626109|gb|EEK82858.1| Uncharacterized zinc protease ymxG [Bacillus cereus ATCC 4342]
 gi|228643007|gb|EEK99283.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST26]
 gi|228772726|gb|EEM21166.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 399

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++  + + +F+   + A++ P
Sbjct: 366 TKENVDELIRNMFTDEFSAALISP 389


>gi|329929289|ref|ZP_08283042.1| peptidase, M16 family [Paenibacillus sp. HGF5]
 gi|328936658|gb|EGG33101.1| peptidase, M16 family [Paenibacillus sp. HGF5]
          Length = 422

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 223/398 (56%), Gaps = 3/398 (0%)

Query: 7   KTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           + S+G+ V+ E +P   S    + ++ GSRNE ++ +G+ HF+EHM+FKGT +  A+ I 
Sbjct: 5   QLSNGLRVVMEQIPTSRSVSFGIWVKTGSRNESEDINGITHFIEHMMFKGTERFDARAIA 64

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           EE + +GG++NA+TS E+T Y+A VL EH P+A++++ DM  NS  +  ++ +E+NV+LE
Sbjct: 65  EEFDAIGGNVNAFTSKEYTCYYAKVLDEHFPIAVDVLSDMFFNSKLDAGELAKEKNVILE 124

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M ED   D +    S  V+ D  +  PILG  E + S   + + S++ R+YT +   
Sbjct: 125 EIAMYEDTPDDLVHDLMSLSVYGDHPLAYPILGTKERLESMDSQALRSYMDRHYTIENTV 184

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
           +   G ++ E  ++ +E +F   +     E +    ++ G   +K+   + H+ + F GC
Sbjct: 185 IALAGNINDE-VIALLERHFGGFANHGTSEPLAVPAFLDGVQFRKKKTEQNHICMSFPGC 243

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
           +      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +DNG+  I + TA 
Sbjct: 244 SIGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADNGMFTIYAGTAP 303

Query: 306 ENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
           +    +     E++  L +N + + E+ K   ++   LI S E +  R   + K  +  G
Sbjct: 304 KQTKEVLQLTTEMLHDLAQNGMTEEELRKGKEQLKGSLILSLESTSSRMNRLGKNELMLG 363

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
                ++II  I  +  +D+  V  ++F +   LA++G
Sbjct: 364 RHFSLDEIIKRIEQVDMKDVNAVLDRMFGTPYALAMVG 401


>gi|228916442|ref|ZP_04080009.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228947525|ref|ZP_04109815.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229092846|ref|ZP_04223980.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-42]
 gi|228690468|gb|EEL44251.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-42]
 gi|228812045|gb|EEM58376.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228843245|gb|EEM88326.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 399

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++  + + +F+   + A++ P
Sbjct: 366 TKENVDELIRNMFTDEFSAALISP 389


>gi|251778531|ref|ZP_04821451.1| peptidase, M16 family [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243082846|gb|EES48736.1| peptidase, M16 family [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 435

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 146/391 (37%), Positives = 224/391 (57%), Gaps = 13/391 (3%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ VITE +  ++S  V + I+ GSRNE +E +G++HF+EHM FKGT KR+AK+IVEEI
Sbjct: 9   NGLRVITEKIDALNSVSVGIMIQNGSRNEVKEVNGISHFIEHMFFKGTKKRSAKQIVEEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+TS E T Y+   L  H+ L+L+++ DM+ NS+F+  +IE+E+ VV+EEI 
Sbjct: 69  ENVGGQINAFTSKEATCYYIKALNTHLDLSLDVLSDMILNSNFDEEEIEKEKGVVIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MS+D   D LD   S++ +K+  +  PILG    I SFT EKI++F+S  YT     +  
Sbjct: 129 MSQDSPEDVLDDEHSKVTFKENSLSYPILGTIPKIKSFTREKILNFISEKYTPYNSVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKI--KESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
            G  D +     +E+ F      K    E  KP +Y    Y+ K ++ + H+ LG  G A
Sbjct: 189 CGKFDEKELKKMIENCFGSWKSQKKYRPEYNKPTIYCESGYVNK-EIEQLHISLGLKGLA 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI----ASA 302
           Y+ ++ Y   +L ++LG G SS LFQ+VRE+ GLCY++ ++ + F   G + I    +  
Sbjct: 248 YRDKNSYPLVLLNNVLGGGASSILFQKVREELGLCYTVCSYLQPFQGVGTINIYIGLSKN 307

Query: 303 TAKENIMALTSSIVEVVQ-SLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            A + +  + + ++E  +  + +N  Q EI KE  KI A  I   E +  R    +K  +
Sbjct: 308 YANKALEVINNEVIEFSKMGITKN--QLEISKE--KIKATYILGLESTSSRMFANAKSYL 363

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           F   +   E +I  + AI   DI  V  + F
Sbjct: 364 FTNEVFTEEDVIRKVDAINKNDIQSVLDECF 394


>gi|229186042|ref|ZP_04313212.1| Uncharacterized zinc protease ymxG [Bacillus cereus BGSC 6E1]
 gi|228597461|gb|EEK55111.1| Uncharacterized zinc protease ymxG [Bacillus cereus BGSC 6E1]
          Length = 399

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAEAFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++  + + +F+   + A++ P
Sbjct: 366 TKENVDELIRNMFTDEFSAALISP 389


>gi|229174471|ref|ZP_04302003.1| Uncharacterized zinc protease ymxG [Bacillus cereus MM3]
 gi|228609031|gb|EEK66321.1| Uncharacterized zinc protease ymxG [Bacillus cereus MM3]
          Length = 399

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 220/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++  + + +F+   + A++ P
Sbjct: 366 TKENVDELIRNMFTDEFSAALISP 389


>gi|149182490|ref|ZP_01860964.1| zinc protease [Bacillus sp. SG-1]
 gi|148849821|gb|EDL63997.1| zinc protease [Bacillus sp. SG-1]
          Length = 414

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/405 (32%), Positives = 225/405 (55%), Gaps = 4/405 (0%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ ++ E +P + S  + + I  GSR+E +E +G++HFLEHM FKGT  R+A+EI E 
Sbjct: 8   SNGLRIVLEEIPTVRSVAIGIWIGTGSRHENKENNGISHFLEHMFFKGTETRSAREIAES 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
            + +GG +NA+TS E+T Y+A VL  H   ALE + DM  NS+F+  ++++E+NVV EEI
Sbjct: 68  FDSIGGQVNAFTSKEYTCYYAKVLDNHAKYALETLADMFFNSAFDEEELKKEKNVVYEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M ED   D +    S+ V+++  +G PILG  ET+ +F  + +  ++   YT D + + 
Sbjct: 128 KMYEDTPDDIVHDVLSKAVYENHPLGYPILGTEETLDTFNGQTLREYMHNMYTPDDVVIS 187

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
             G +D  F + +VE  F      K  E      +   +  +K++  + H+ LG+ G   
Sbjct: 188 VAGNIDASF-IKEVEKLFGQYEGGKGHEQNAKPSFHHNKVSKKKETEQAHLCLGYPGLQI 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I   T  + 
Sbjct: 247 GHDDIYSLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSAYEDSGMLTIYGGTGAKQ 306

Query: 308 IMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  ++   + +L  E I  +E+     ++   L+ S E +  R     K  +     
Sbjct: 307 LNQLFDTVQSTLATLKAEGISSKELSNSKEQLKGNLMLSLESTNSRMSRNGKNELLLKKH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
              ++I+D I  +T + +  +  +IF++  ++A++ P  + +PT 
Sbjct: 367 RSLDEIVDEIDGVTIDRVNNLGNEIFNNDFSVALISPDGE-MPTN 410


>gi|256396975|ref|YP_003118539.1| processing peptidase [Catenulispora acidiphila DSM 44928]
 gi|256363201|gb|ACU76698.1| processing peptidase [Catenulispora acidiphila DSM 44928]
          Length = 439

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/411 (32%), Positives = 224/411 (54%), Gaps = 10/411 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE MP + S    +    GSR+E  EE G  H+LEH+LFKGT KR+
Sbjct: 16  TVRRTVLPGGLRVVTETMPSVRSVTFGIWTGIGSRDEHAEESGATHYLEHLLFKGTAKRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   ++ VGG++NA+T+ E+T Y+A VL   +PLA+++I D+++++   P D+  ER
Sbjct: 76  ALEISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVICDLVTSALIRPEDVASER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV+LEE+ M+ED+  D +   F+  +  D  +GRPILG  E++++ T + I  +   +YT
Sbjct: 136 NVILEEMAMTEDEPADQIHDEFAYALLGDSPLGRPILGSAESVNALTRDAIAEYYHSHYT 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE--------YIQKRD 232
            D + V   G +DH+  V+ V++ F      +  +       +GG+         +  + 
Sbjct: 196 DDHLVVSAAGNLDHDVVVALVDAAFAQARGVRDADRQPVVPRIGGDCGVAHSGLRLVSKQ 255

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A   R  Y   IL++ILG GMSSRLFQEVREKRGL YS+ +   + +
Sbjct: 256 TEQTHVVLGVPGVARNDRRRYPLGILSTILGGGMSSRLFQEVREKRGLAYSVYSFSSHHA 315

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +    EN   +     + V  + +  + + E+ +   ++    + S E +  
Sbjct: 316 DCGTFGVYAGCQPENFTEVLKICRDEVAKIADGGVTEEELRRGIGQVRGSTVLSLEDTGS 375

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           +   I K  +  G  L  E+++  + ++T ED+  VA++       +A++G
Sbjct: 376 QMTRIGKNELVYGEHLTIEELLARVESVTLEDVKAVAEEFLRQPQAIAVIG 426


>gi|56416444|ref|YP_153518.1| mitochondrial processing protease [Anaplasma marginale str. St.
           Maries]
 gi|56387676|gb|AAV86263.1| mitochondrial processing protease [Anaplasma marginale str. St.
           Maries]
          Length = 436

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 248/420 (59%), Gaps = 15/420 (3%)

Query: 5   ISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++  +  +V++E V  ++S  + + ++ GSR+E +E+ G+AHFLEHM FKGT  R+A +
Sbjct: 22  VTRLENNFSVVSEKVDGVNSVGISIWVKTGSRHEEKEKIGLAHFLEHMAFKGTDTRSALD 81

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I    + +GG+ NAYT  EHT YH  V+K  V +ALE++ D++  S+F   +IERE+NVV
Sbjct: 82  IAMAFDCIGGNFNAYTDKEHTVYHVKVMKRDVHIALEVLEDIVLRSAFPEVEIEREKNVV 141

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E+ +K QI G PILG  +++   +   ++ ++S NY  + 
Sbjct: 142 LQEIYQTNDSPGSIIFDKYMEVAYKGQIFGAPILGSEQSVLGLSRADLVQYMSANYYGNN 201

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   G + HE  V   + +  +    +  + + P VY GG+YI+ RDL + ++++GF 
Sbjct: 202 MTLSVAGDIAHEDVVRMSQGFAQIQD--RNPQPVAPPVYTGGQYIEARDLDQVNIVIGFP 259

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +Y    +Y   +L  ILG  MSSRLFQE+REKRGL YSIS+ + ++SD+G+  I +AT
Sbjct: 260 GVSYLDERYYTMQVLDVILGSSMSSRLFQEIREKRGLVYSISSFNSSYSDSGLFSIHAAT 319

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            + N+  L  +I   ++ L E +++ E+ +  +K+ ++++ S+E +  +    S+ + +C
Sbjct: 320 DEGNLQELLKTIAAEMKKLPETVKEEELLRAKSKLESEVLMSRESTVGK----SEALGYC 375

Query: 364 GS----ILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGP--PMDHVPTTSELI 415
            S     +  E++I  I A+   D++  A  +  +    T+A +G   P+  + T S ++
Sbjct: 376 YSHYNKYITKEEMISKIRAVNLGDVINSADLLLQNRGKLTVAAIGKVGPLPSLETISNML 435


>gi|148554334|ref|YP_001261916.1| processing peptidase [Sphingomonas wittichii RW1]
 gi|148499524|gb|ABQ67778.1| processing peptidase [Sphingomonas wittichii RW1]
          Length = 410

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 224/405 (55%), Gaps = 8/405 (1%)

Query: 5   ISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           + + ++G T+  + M  +++  + +++  G+R+E    +G+AH  EHM+FKG   R+A+E
Sbjct: 6   LHRLANGFTIAADPMAGVETIAIGLHVDCGARHEEARANGLAHLFEHMVFKGAGGRSARE 65

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E +E VGG +NAYTS + T++ A +L EH+ L +E+IGD++    F+  D+ RE++VV
Sbjct: 66  ISEAVENVGGYLNAYTSRDQTAFQARLLAEHLDLGIELIGDLIRKPHFDAGDLAREKDVV 125

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E+G + D   D ++  F    W  Q  GRP+LG  ETI++   + + ++  ++Y  + 
Sbjct: 126 LQELGEARDLPDDIINDHFHSTAWPGQAFGRPVLGGEETIAAIAVDDLHAWTRKHYRPEN 185

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   G +D +  V+  E+ F     A  +   + A Y GG ++++R L   H++ G+ 
Sbjct: 186 MVLAAAGKIDVDRLVALAEARFGDMEPAP-RPVAELAAYRGGTFVERRRLESAHILFGYE 244

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +Y    +Y   + +   G+G SSRLFQ +RE+RGL YS+      + D G+L +  AT
Sbjct: 245 GVSYFDPSYYPLLLFSQAAGEGSSSRLFQSIREERGLAYSVGTSVAAWRDTGMLTVYLAT 304

Query: 304 AK---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           A+   +N   L+ +++  V + L  +   E+D+  A+I A ++ + E    RA  +  Q 
Sbjct: 305 ARREAQNATDLSRALLRDVAATLTPV---ELDRAKAQIRATILMALESVQGRADRLGFQT 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPM 405
           +  G+ +    I+  I A T ++      ++     TLA +GP +
Sbjct: 362 LVHGAPIEPATIVARIDACTLDEARAAGARLLEGPETLATVGPAL 406


>gi|222474814|ref|YP_002563229.1| Mpp [Anaplasma marginale str. Florida]
 gi|222418950|gb|ACM48973.1| Mpp [Anaplasma marginale str. Florida]
          Length = 436

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 248/420 (59%), Gaps = 15/420 (3%)

Query: 5   ISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++  +  +V++E V  ++S  + + ++ GSR+E +E+ G+AHFLEHM FKGT  R+A +
Sbjct: 22  VTRLENNFSVVSEKVDGVNSVGISIWVKTGSRHEEKEKIGLAHFLEHMAFKGTDTRSALD 81

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I    + +GG+ NAYT  EHT YH  V+K  V +ALE++ D++  S+F   +IERE+NVV
Sbjct: 82  IAMAFDCIGGNFNAYTDKEHTVYHVKVMKRDVHIALEVLEDIVLRSAFPEVEIEREKNVV 141

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E+ +K QI G PILG  +++   +   ++ ++S NY  + 
Sbjct: 142 LQEIYQTNDSPGSIIFDKYMEVAYKGQIFGAPILGSEQSVLGLSRADLVQYMSANYYGNN 201

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   G + HE  V   + +  +    +  + + P VY GG+YI+ RDL + ++++GF 
Sbjct: 202 MILSVAGDIAHEDVVRMSQGFAQIQD--RNPQPVAPPVYTGGQYIEARDLDQVNIVIGFP 259

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +Y    +Y   +L  ILG  MSSRLFQE+REKRGL YSIS+ + ++SD+G+  I +AT
Sbjct: 260 GVSYLDERYYTMQVLDVILGSSMSSRLFQEIREKRGLVYSISSFNSSYSDSGLFSIHAAT 319

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            + N+  L  +I   ++ L E +++ E+ +  +K+ ++++ S+E +  +    S+ + +C
Sbjct: 320 DEGNLQELLKTIAAEMKKLPETVKEEELLRAKSKLESEVLMSRESTVGK----SEALGYC 375

Query: 364 GS----ILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGP--PMDHVPTTSELI 415
            S     +  E++I  I A+   D++  A  +  +    T+A +G   P+  + T S ++
Sbjct: 376 YSHYNKYITKEEMISKIRAVNLGDVINSADLLLQNRGKLTVAAIGKVGPLPSLETISNML 435


>gi|229123318|ref|ZP_04252522.1| Uncharacterized zinc protease ymxG [Bacillus cereus 95/8201]
 gi|228660094|gb|EEL15730.1| Uncharacterized zinc protease ymxG [Bacillus cereus 95/8201]
          Length = 399

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 221/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+++FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGIEETLNTFTGDTLRQYIKDHYTPENVVVSIAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T E++  + + +F+   + A++ P
Sbjct: 366 TKENVDELIRNMFTDEFSAALISP 389


>gi|284030887|ref|YP_003380818.1| peptidase M16 domain-containing protein [Kribbella flavida DSM
           17836]
 gi|283810180|gb|ADB32019.1| peptidase M16 domain protein [Kribbella flavida DSM 17836]
          Length = 437

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/403 (32%), Positives = 221/403 (54%), Gaps = 9/403 (2%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           SG+ V+++ +P   S    V +  GSR+E  +  G  HFLEH+LFKGT +R A EI   +
Sbjct: 25  SGLRVLSQSVPGFRSVTFGVWVGVGSRDEPVQLSGATHFLEHLLFKGTERRDALEISASL 84

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+T  E+T Y+A VL   +PLA+++I DM+++++  P D+E ER+V+ EEI 
Sbjct: 85  DAVGGEMNAFTGKEYTCYYARVLDSDLPLAVDVICDMITSATLTPEDVESERDVIDEEIA 144

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M  D++ D +   F+E +W    +GR I G PE+++  T  +++ +  R YT D + V  
Sbjct: 145 MHADETSDHIHDLFAEQLWGSSPLGRSITGTPESVAGLTRRQVVGWYRRRYTPDNIVVSV 204

Query: 189 VGAVDHEFCVSQVESYFNV------CSVAKIKE-SMKPAVYVGGEYIQKRDLAEEHMMLG 241
            G V+H   V  V   F         + A ++  S +     GG  + +RD+ + H++LG
Sbjct: 205 AGNVEHADVVRLVRKAFERHWVSAESAPAPVRRGSGRRVPTYGGVRVHRRDVEQAHLVLG 264

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI-A 300
             G        Y+  +L  I+G GMSSRLFQEVREKRGL YS+      ++D+G++ + A
Sbjct: 265 MPGLVRNDDRRYVAGVLHGIVGGGMSSRLFQEVREKRGLAYSVFTFGSAYADSGMVGVYA 324

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
               K+    L     E+       I   E+ +   ++   ++   E +  +   I+K  
Sbjct: 325 GCLPKKAPEVLDVIRGELATLAAGGITPDELLRGKGQMRGSVVMGLEDTGAKMTRIAKAE 384

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  G +   ++I+  I A+T +D+  +A ++++ TP L ++GP
Sbjct: 385 LVYGELPTVDEILGRIDAVTLDDVHALAAELYAGTPALTVMGP 427


>gi|255002784|ref|ZP_05277748.1| Mpp [Anaplasma marginale str. Puerto Rico]
 gi|255003918|ref|ZP_05278719.1| Mpp [Anaplasma marginale str. Virginia]
          Length = 421

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 248/420 (59%), Gaps = 15/420 (3%)

Query: 5   ISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++  +  +V++E V  ++S  + + ++ GSR+E +E+ G+AHFLEHM FKGT  R+A +
Sbjct: 7   VTRLENNFSVVSEKVDGVNSVGISIWVKTGSRHEEKEKIGLAHFLEHMAFKGTDTRSALD 66

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I    + +GG+ NAYT  EHT YH  V+K  V +ALE++ D++  S+F   +IERE+NVV
Sbjct: 67  IAMAFDCIGGNFNAYTDKEHTVYHVKVMKRDVHIALEVLEDIVLRSAFPEVEIEREKNVV 126

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E+ +K QI G PILG  +++   +   ++ ++S NY  + 
Sbjct: 127 LQEIYQTNDSPGSIIFDKYMEVAYKGQIFGAPILGSEQSVLGLSRADLVQYMSANYYGNN 186

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   G + HE  V   + +  +    +  + + P VY GG+YI+ RDL + ++++GF 
Sbjct: 187 MILSVAGDIAHEDVVRMSQGFAQIQD--RNPQPVAPPVYTGGQYIEARDLDQVNIVIGFP 244

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +Y    +Y   +L  ILG  MSSRLFQE+REKRGL YSIS+ + ++SD+G+  I +AT
Sbjct: 245 GVSYLDERYYTMQVLDVILGSSMSSRLFQEIREKRGLVYSISSFNSSYSDSGLFSIHAAT 304

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            + N+  L  +I   ++ L E +++ E+ +  +K+ ++++ S+E +  +    S+ + +C
Sbjct: 305 DEGNLQELLKTIAAEMKKLPETVKEEELLRAKSKLESEVLMSRESTVGK----SEALGYC 360

Query: 364 GS----ILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGP--PMDHVPTTSELI 415
            S     +  E++I  I A+   D++  A  +  +    T+A +G   P+  + T S ++
Sbjct: 361 YSHYNKYITKEEMISKIRAVNLGDVINSADLLLQNRGKLTVAAIGKVGPLPSLETISNML 420


>gi|229098274|ref|ZP_04229221.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-29]
 gi|229104367|ref|ZP_04235036.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-28]
 gi|229117292|ref|ZP_04246670.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock1-3]
 gi|228666192|gb|EEL21656.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock1-3]
 gi|228679065|gb|EEL33273.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-28]
 gi|228685172|gb|EEL39103.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-29]
          Length = 399

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 220/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYETMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T +++  + + +F+   + A++ P
Sbjct: 366 TKQNVDELIRNMFTDEFSAALISP 389


>gi|167630370|ref|YP_001680869.1| peptidase, m16 family [Heliobacterium modesticaldum Ice1]
 gi|167593110|gb|ABZ84858.1| peptidase, m16 family [Heliobacterium modesticaldum Ice1]
          Length = 421

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 139/399 (34%), Positives = 226/399 (56%), Gaps = 9/399 (2%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  + + +  GSR+E     G++HF+EHMLFKGT KRTAK++ E +
Sbjct: 9   NGVRVVMEPISHVRSVALGIWVATGSRDEEPALTGVSHFIEHMLFKGTDKRTAKDLAEVL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG +NA+TS E+T YHA VL +H  LAL+++ DM  +S F   DIERER V+LEEI 
Sbjct: 69  EAVGGQLNAFTSKEYTCYHAKVLDDHFDLALDVLADMFFHSRFEWEDIERERRVILEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +    ++ +W    +GR ILG  E+I +   E ++S     Y+ADR  +  
Sbjct: 129 MYEDSPDELVHDLLADAMWPFSPLGRSILGTVESIQAMQREGLLSHFQSEYSADRTVIAI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G++D +  + +V++YF+V   +K      +P +     ++ K D+ +  + LG  G   
Sbjct: 189 AGSIDPDKALEKVKAYFSVMDASKQTYRRSRPDLLHKSVFLHK-DVEQVQICLGTQGLPQ 247

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
           + RD Y  ++L +++G G SSRLFQE+RE RGL YS+ + H  FSD+G+  + + T+ + 
Sbjct: 248 EHRDIYAMHVLNNVIGGGTSSRLFQEIRENRGLAYSVYSFHSAFSDSGMFGLYAGTSPDF 307

Query: 308 I-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
               L  S+ E+ +   E I   E+ +   +I   L    E    R   + K  +     
Sbjct: 308 AEEVLEISLREMARIREEGICPEELRRTQEQIKGSLYLGLESVNSRMTRLGKSEICYNRF 367

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTP---TLAILG 402
           +  E++ID + A+T +D+  VA+ ++  TP    LA++G
Sbjct: 368 VSPEEVIDRVYAVTLDDVTKVARDLW--TPEQCALAVVG 404


>gi|52080278|ref|YP_079069.1| peptidase [Bacillus licheniformis ATCC 14580]
 gi|52785655|ref|YP_091484.1| MlpA [Bacillus licheniformis ATCC 14580]
 gi|52003489|gb|AAU23431.1| peptidase [Bacillus licheniformis ATCC 14580]
 gi|52348157|gb|AAU40791.1| MlpA [Bacillus licheniformis ATCC 14580]
          Length = 409

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/396 (32%), Positives = 226/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT  RTA++I E  
Sbjct: 9   NGVRIVFENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTKTRTARDIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   ALE++ DM  +SSF+  ++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHASYALEVLSDMFFHSSFDEEELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  +    +G PILG  ET++ F  + +  +++  YT DR+ +  
Sbjct: 129 MYEDTPDDIVHDLLSKASYGSHSLGYPILGTEETLAEFDGDSLRKYMNEYYTPDRVVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V   F + + E +F        +  M    +   +  +K++  + H+ LGFNG    
Sbjct: 189 AGNVPETF-IKEAEKHFGSYEAKGKRTGMTKPDFHHEKMTRKKETEQAHLCLGFNGLEAG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             + Y   +L +ILG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G++ I + T    +
Sbjct: 248 HPEIYDLIVLNNILGGSMSSRLFQDVREDKGLAYSVFSYHTSYEDSGMMTIYAGTGANQL 307

Query: 309 MALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E +++L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 QLLSETIHETLRALKSDGITPKELENSKEQMKGSLMLSLESTNSKMSRNGKNELLLGKHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ ++A++ E +  +A +IF+   + A++ P
Sbjct: 368 TLDEIIEKLNAVSLERVNNLANRIFTDDYSSALISP 403


>gi|88607349|ref|YP_504729.1| M16 family peptidase [Anaplasma phagocytophilum HZ]
 gi|88598412|gb|ABD43882.1| peptidase, M16 family [Anaplasma phagocytophilum HZ]
          Length = 423

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 133/407 (32%), Positives = 237/407 (58%), Gaps = 15/407 (3%)

Query: 5   ISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++K  + ++VITE +  ++S  + + ++ GSR+E  E+ G+AHFLEHM FKGTT R+A +
Sbjct: 7   VTKLKNNLSVITEHIGGVNSVGINLWVKVGSRHEVHEKIGLAHFLEHMAFKGTTTRSALD 66

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I +  + +GG+ NAYT  EHT YH  V+K+   LALE++ D++  SSF   ++ERE++VV
Sbjct: 67  IAKTFDAIGGNFNAYTDKEHTVYHLKVMKKDARLALEVLTDIVLRSSFPEEEMEREKDVV 126

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+EI  + D     +  ++ E  ++ QI G+ ILG   T+ +F+ E ++S + ++Y    
Sbjct: 127 LQEIYQTNDSPSSIIFDKYLEAAYEGQIFGKSILGSVHTVQNFSKEDLVSHMDKHYYGSN 186

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV-----CSVAKIKESMKPAVYVGGEYIQKRDLAEE-H 237
           M +   G + H+  +   +    +     CS  ++ +      Y GGEY+++R+  E+ +
Sbjct: 187 MVLSLAGDIVHDEVLEMAQGLEQLKDRQHCSPVQVPQ------YTGGEYLEERNHLEQVN 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +++GF G  Y    F+   +L +ILG G+SSRLFQEVREK GL YSI + + ++SD+G+ 
Sbjct: 241 IIIGFPGVPYGDERFHAMQVLDTILGSGLSSRLFQEVREKLGLVYSICSFNYSYSDSGLF 300

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            + +AT    +  L  ++   ++ L + IE  E+ +  +K+ A+++ S+E    ++  + 
Sbjct: 301 SVHAATDSTKLPILLQTVTTELKKLPDTIEDEELQRAKSKLEAEILMSRESPVAKSEALG 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF--SSTPTLAILG 402
                 G  +  +++I+ I +I   ++  VA  +   SS  TLA +G
Sbjct: 361 YYYSHYGRYIQKQELIEKIRSIDARNVQDVANFLLQSSSNITLAAIG 407


>gi|72161189|ref|YP_288846.1| mitochondrial processing peptidase [Thermobifida fusca YX]
 gi|71914921|gb|AAZ54823.1| mitochondrial processing peptidase [Thermobifida fusca YX]
          Length = 462

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/414 (33%), Positives = 219/414 (52%), Gaps = 17/414 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE M  + S    ++   GSR+E  E  G AHFLEH+LFKGT +R+A
Sbjct: 45  VRRTVLPGGLRVVTETMQGVRSVAFGISATTGSRDEDAEHAGAAHFLEHLLFKGTERRSA 104

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I   ++ VG D NAYT+ E T+Y+A VL   +PLA+++I DM++NS  +P+++E ER 
Sbjct: 105 LDISALLDGVGADYNAYTTKEQTTYYAKVLDRDLPLAIDVISDMVANSVLDPAEVETERG 164

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED+  D +D  F+   +K   +GRPILG  +TI + T E+I+      Y  
Sbjct: 165 VILEEIAMYEDEPADVVDDVFAAHFFKGSPLGRPILGTNDTIRALTRERILEQYRSAYVP 224

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF-------NVCSVAKIKESMKPAVYVGGEYIQKRDLA 234
             + V   G +DH+  V QV   F            A  +   +P     G  +  RD  
Sbjct: 225 SELIVAAAGNLDHDTVVRQVAEAFRDKLDAAGDARPAAPRIGTEPPATNPGTVLVSRDSE 284

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + H++LG  G       +Y   +L++ILG GMSSRLFQEVREKRGL Y++  +  ++SD 
Sbjct: 285 QAHLILGREGVKRTDPRWYALRVLSAILGGGMSSRLFQEVREKRGLAYAVHGYTCSYSDT 344

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLE-----NIEQREIDKECAKIHAKLIKSQERS 349
           G+  +      + I      +++V ++ LE      ++  E+ +   +I    +   E +
Sbjct: 345 GLFQVYVGCLPDKI----DEVLDVCRTELERAAAHGVDAAELARAKGQIRGSWVLGTEGT 400

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   ++   +     L   + +    A+T ED+  VA +I +    LA++GP
Sbjct: 401 NARMSRLTSHELGYRRHLSLSEDLALFDAVTSEDVSEVAAEILTRPEALAVVGP 454


>gi|229031435|ref|ZP_04187435.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1271]
 gi|228729724|gb|EEL80704.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1271]
          Length = 399

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 219/384 (57%), Gaps = 2/384 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A+EI E  + +GG +NA+TS
Sbjct: 7   VRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSAREIAESFDSIGGQVNAFTS 66

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+NVV EEI M ED   D +  
Sbjct: 67  KEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKNVVCEEIKMYEDAPDDIVHD 126

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             ++  ++   +G PILG  ET+ +FT + +  ++  +YT + + V   G +D  F +  
Sbjct: 127 MLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTPENVVVSVAGNIDEAF-LQT 185

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           VE YF        +E +   ++   +  +K++  + H+ LG+ G      D Y   +L +
Sbjct: 186 VEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLGYKGLQMGHEDIYNLIVLNN 245

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
           +LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +   T  + +  L  ++ E ++
Sbjct: 246 VLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYGGTGSQQLDTLYDTMQETLE 305

Query: 321 SLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
           +L    I ++E+     ++   L+ S E +  R     K  +        ++II++++ +
Sbjct: 306 TLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNELLLRKHRSLDEIIESVNTV 365

Query: 380 TCEDIVGVAKKIFSSTPTLAILGP 403
           T  ++  + + +F+   + A++ P
Sbjct: 366 TKANVDELIRNMFTDEFSAALISP 389


>gi|297191696|ref|ZP_06909094.1| protease [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151024|gb|EDY65356.2| protease [Streptomyces pristinaespiralis ATCC 25486]
          Length = 459

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 133/417 (31%), Positives = 230/417 (55%), Gaps = 14/417 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E     G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTTLPGGLRVVTETLPSVRSATFGIWANVGSRDETPSLGGATHYLEHLLFKGTHKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISAAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILQEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T +++  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN-VCSVAKIKESMKP------AVYVGGEY-IQKRD 232
              + V   G VDH   V QV   F+   ++++      P      A+   G+  +Q R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFDKAGALSRTDAVPTPPRDGSRALRTAGKVELQNRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGVPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +   +++ +    ++ V S  + +   EI++   ++    +   E +
Sbjct: 334 DTGLFGVYAGCRPSQVHDVLKICRDELDRVAS--DGLPDEEIERAIGQLSGSTVLGLEDT 391

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
                 I K  +  GS +  ++++  ISA+T +++  VA ++    P+L+++GP  D
Sbjct: 392 GALMNRIGKSELCWGSQMSVDEMLARISAVTPDEVRAVAGEVLGQRPSLSVIGPLKD 448


>gi|317121864|ref|YP_004101867.1| peptidase M16 domain protein [Thermaerobacter marianensis DSM
           12885]
 gi|315591844|gb|ADU51140.1| peptidase M16 domain protein [Thermaerobacter marianensis DSM
           12885]
          Length = 433

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/413 (30%), Positives = 222/413 (53%), Gaps = 2/413 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+   +G+ V++E +P + S  V V  R GSR+E  E  G+AH LEHM FKGT  R+A+
Sbjct: 20  RITALPNGLRVVSETVPGVRSVTVGVWFRTGSRDEPDEHAGIAHLLEHMAFKGTQTRSAR 79

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ E +++VGG +NAYTS E TS++  VL +H  LA+E++ DML    F+P D+E+E+ V
Sbjct: 80  ELAELVDRVGGQMNAYTSKEDTSFYIRVLDDHFGLAMEVLADMLLRPRFDPGDLEKEKRV 139

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEE+ M EDD  D +     +++W    +GRP++G+  T+ +     ++ F  ++Y   
Sbjct: 140 ILEELKMYEDDPEDVVQDMAVQILWPGHPLGRPVIGREATVGAVDRGVLVDFWRQHYEPG 199

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           R  +   G V+H+  V +V+ +F        +   +P      +  +++ + + H+ +  
Sbjct: 200 RAVIAVAGHVEHQRVVEEVQRWFGGWRRTGERVPYQPPAPQPADAWRQKAIEQVHLCVAA 259

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              AY S D Y   +LA+ILG   SSRLFQ +RE  GL YS+   H  +SD G+  I +A
Sbjct: 260 PAAAYGSDDLYPELVLANILGGASSSRLFQVIREDHGLAYSVYTFHGGYSDAGLFGIYAA 319

Query: 303 TAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           T+ E    +   I    + + ++ + + E+ +   +I A L+   E +  R   + + ++
Sbjct: 320 TSPETARQVMELIARECRKVRQDGVTRDELARTRDQIKANLLMGLESTSQRMNRLGRTLL 379

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
               ++  E+++  + A+T E ++  A+++            P + +P    L
Sbjct: 380 MLDRVVTVEEVVARVEAVTAEQVMAAAERLLDPARWAVAGAGPAESMPLRGWL 432


>gi|282866916|ref|ZP_06275948.1| peptidase M16 domain protein [Streptomyces sp. ACTE]
 gi|282558229|gb|EFB63799.1| peptidase M16 domain protein [Streptomyces sp. ACTE]
          Length = 459

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 221/417 (52%), Gaps = 14/417 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   + +  GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTVLPGGLRVVTETLPSVRSATFGIWVNVGSRDETPTLNGATHYLEHLLFKGTDKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLITPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +T+++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALDRGRIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         +++  A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFERAGALTRTDAVPTAPRAGSRALRTAGRVDVLDRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHIVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +    +   +++ +    ++ V S  E +   EI +   ++    +   E +
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLGICREELDRVAS--EGLPDEEISRAVGQLAGSTVLGLEDT 391

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
                 I K  +  G  +  + ++  I+A+T +++  VA  +    P+L+++GP  D
Sbjct: 392 GALMNRIGKSELCWGEQMSVDDMLARIAAVTPDEVRAVAADVLGHRPSLSVIGPLKD 448


>gi|23099061|ref|NP_692527.1| processing proteinase [Oceanobacillus iheyensis HTE831]
 gi|22777289|dbj|BAC13562.1| processing proteinase [Oceanobacillus iheyensis HTE831]
          Length = 406

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 220/397 (55%), Gaps = 3/397 (0%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           ++G+ ++ E +P + S  + + +  GSRNE Q+ +G++HFLEHM FKGT KR+A++I EE
Sbjct: 8   NNGLRIVHEQIPAVRSVTIGIWVLTGSRNESQQNNGISHFLEHMFFKGTDKRSAQDIAEE 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
            + +GG INA+TS E+T ++A VL  H   ALEI+ DM  NS+F+P ++ERE+ VVLEEI
Sbjct: 68  FDSIGGQINAFTSKEYTCFYAKVLDTHKEYALEILADMFFNSTFDPEEMEREKKVVLEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M ED   D +    ++  +    +G  ILG  E + SF   ++  ++   Y+ DR+ + 
Sbjct: 128 KMYEDTPDDIVHDLLAKASYGTHPLGYSILGTEEQLLSFDSAQLNDYIEHAYSPDRVVIS 187

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
             G VD  F  +   S+ +    +   E +KP  ++     + +D  + H+ LG+ G   
Sbjct: 188 VAGNVDSSFMKTIESSFGSYKGKSNSVEIIKP-TFLAESIDRHKDTEQAHLCLGYQGLEQ 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
                Y   I+ ++LG  MSSRLFQ+VREK+GL Y++ ++H  F D+G+L I   T KE 
Sbjct: 247 GHPLLYSLTIMNNVLGGSMSSRLFQDVREKQGLAYAVFSYHSTFIDSGLLTIYGGTGKEQ 306

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  L  +I   V +L++N +  +E+     ++   L+ S E +  R     +  +     
Sbjct: 307 LSVLEDTIQLTVDTLIQNGLTDKELRNSKEQLKGGLMLSLESTNSRMSRNGRNELLLKRH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              +++I  I A++ E I  V  ++F      A++ P
Sbjct: 367 RTLDEMIQEIDAVSHETIQQVINEVFKEKAARALIAP 403


>gi|296171646|ref|ZP_06852860.1| hypothetical protein HMPREF0591_6301 [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295894007|gb|EFG73770.1| hypothetical protein HMPREF0591_6301 [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 451

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/413 (34%), Positives = 224/413 (54%), Gaps = 17/413 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A
Sbjct: 28  LRRSTLPGGLRVVTEYLPSVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 88  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDSDLALAVDLVADVVLNGRCAADDVELERD 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  +++SS T  ++ SF  R YT 
Sbjct: 148 VVLEEIAMRDDDPEDALGDMFLGAMFGDHPVGRPVIGTAQSVSSMTRAQLHSFHVRRYTP 207

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAE 235
           +RM V   G VDH+  V+ V ++F    + + +  + P    G      G  +  RD  +
Sbjct: 208 ERMVVAVAGNVDHDEVVALVRAHFG-PHLVRGRRPIAPRKGAGRVTGRPGLMLGNRDAEQ 266

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ LG        R  +  ++L S LG G+SSRLFQEVRE RGL YS+ +  + F+D+G
Sbjct: 267 THVSLGVRTPGRSWRHRWALSVLHSALGGGLSSRLFQEVRELRGLAYSVYSTVDIFADSG 326

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKEC----AKIHAKLIKSQERSY 350
            L + +A   E      + +++V   +LE++ +  I + EC      +   L+   E S 
Sbjct: 327 ALSVYAACQPERF----AEVMKVTNEVLESVARDGITEAECRIAKGSLRGGLVLGLEDSS 382

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   + +  +  G     E  +  I  +T E++  VA+++       A+LGP
Sbjct: 383 SRMSRLGRNELNYGEHRSIEHTLRKIDEVTVEEVNAVARRLLGQPYGAAVLGP 435


>gi|239928582|ref|ZP_04685535.1| protease [Streptomyces ghanaensis ATCC 14672]
 gi|291436907|ref|ZP_06576297.1| protease [Streptomyces ghanaensis ATCC 14672]
 gi|291339802|gb|EFE66758.1| protease [Streptomyces ghanaensis ATCC 14672]
          Length = 441

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/420 (30%), Positives = 223/420 (53%), Gaps = 20/420 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E     G  H+LEH+LFKGT +R+
Sbjct: 16  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALGGATHYLEHLLFKGTARRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 76  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSVIREEDVDVER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  ET++S T ++I  F  ++Y 
Sbjct: 136 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVETVNSLTADRIRRFYRKHYD 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK---------R 231
              + V C G +DH   V QV + F      K     +P    GG    +         R
Sbjct: 196 PTHLVVACAGNIDHGKVVRQVRAAFEAAGALK-DPGARPIAPRGGRRALRTAGRVDLVDR 254

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
              + H++LG  G +      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F
Sbjct: 255 STEQAHVILGMPGLSRTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGF 314

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQ 346
           +D G+  + +      +      ++++ +  L+++ +      E+++   ++    +   
Sbjct: 315 ADCGLFGVYAGCRPSQV----HDVLKICRDELDHVAEHGLPDDEMERAVGQLRGSTVLGL 370

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           E +      I K  +  G  +  + ++  I+++T +D+  VA+ +    P+L+++GP  D
Sbjct: 371 EDTGALMNRIGKSELCWGEQMSVDDMLARIASVTPDDVRLVARDVLGQRPSLSVIGPLKD 430


>gi|312194992|ref|YP_004015053.1| peptidase M16 domain protein [Frankia sp. EuI1c]
 gi|311226328|gb|ADP79183.1| peptidase M16 domain protein [Frankia sp. EuI1c]
          Length = 450

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 221/405 (54%), Gaps = 15/405 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + SA + V +  GSR+E     G +HFLEH+LFKGT  R A  I   +
Sbjct: 38  GGLRVLTEQVPGVRSAAIGVWVGVGSRDEDPATAGCSHFLEHLLFKGTPSRDALTISASV 97

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGGD+NA+T+ E+T Y+A VL E +P+A++++ DM++NS    +D+E ER V+LEEI 
Sbjct: 98  EAVGGDLNAFTAKEYTCYYARVLDEDLPMAIDVVCDMVANSVITAADVEAERGVILEEIA 157

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M EDD  D +   F+E V     +GRP+LG  ++I +   + I  +    YTA  + V  
Sbjct: 158 MHEDDPGDVVHDVFAEAVLGSSSLGRPVLGTIDSIEALHRDTIAEYYRGRYTAPALVVAV 217

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRDLAEEHMM 239
            G +DH+  ++ V   F    +A   +S  P    GG Y         + +R   + +++
Sbjct: 218 AGNIDHDRTLAMVAEAF-ADRLAGPADSAGPR---GGAYGYPGKPGLLVSRRPTEQANVV 273

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG  G + +    +   +L++ LG GMSSRLFQEVREKRGL YS+ +   +F+D G+  +
Sbjct: 274 LGTAGMSRRDPRRFALGLLSTALGGGMSSRLFQEVREKRGLAYSVYSFATHFADAGLFGL 333

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  A +    +     + V+ + E  I Q E+D+   +    L+   E +  R   + K
Sbjct: 334 YAGCAPKRAREVLEICRDEVRQIAERGITQEELDRARGQTRGSLVLGLEDTGSRMSRLGK 393

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +  G +L  ++++  + A+T  D+  +A ++ +    L ++GP
Sbjct: 394 GELVHGELLSVDEVLARVDAVTLGDVQAIAGELVAQPWGLGVIGP 438


>gi|294631767|ref|ZP_06710327.1| M16 family peptidase [Streptomyces sp. e14]
 gi|292835100|gb|EFF93449.1| M16 family peptidase [Streptomyces sp. e14]
          Length = 459

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 222/415 (53%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E     G  H+LEH+LFKGT++R+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALGGATHYLEHLLFKGTSERS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIREEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDSPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY--------IQKRD 232
              + V C G +DH   V +V + F      +  E++  A   G           IQ R 
Sbjct: 214 PTHLVVACAGNIDHHKVVRRVRAAFEKAGAFRNAEAVPIAPRDGRRSLRTAGRVEIQGRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHIVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  + +N +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLRICRDELDQVADNGLPDDEIARAIGQLQGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G  +  + ++  I+A+T +++  VA+ I    P+L+++GP  D
Sbjct: 394 LMNRIGKSELCWGEQISVDDMLARIAAVTPDEVRAVARDILGQRPSLSVIGPLKD 448


>gi|120403342|ref|YP_953171.1| peptidase M16 domain-containing protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119956160|gb|ABM13165.1| peptidase M16 domain protein [Mycobacterium vanbaalenii PYR-1]
          Length = 451

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 142/413 (34%), Positives = 223/413 (53%), Gaps = 17/413 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++   G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RTA
Sbjct: 28  VRRTQLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N    P D+E ER+
Sbjct: 88  VQIAQAVDAVGGELNAFTAREHTCYYAHVLDSDLELAVDLVADVVLNGRCAPGDVEVERD 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+IS+ T  ++ SF  R YT 
Sbjct: 148 VVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVIGSVESISAMTRSQLHSFHVRRYTP 207

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP---AVYVGGE---YIQKRDLAE 235
           DRM V   G V+H+  V  V  +F    + + +  + P   A  VGG+   ++  RD  +
Sbjct: 208 DRMVVAVAGNVEHDMVVKLVREHFG-PRLERGRAPVPPRKGAGRVGGQPTLHLVSRDAEQ 266

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ LG           +  ++L S LG G+SSRLFQ++RE RGL YS+ +  + F+++G
Sbjct: 267 THLSLGVRTPGRHWDHRWALSVLNSALGGGLSSRLFQQIRETRGLAYSVYSTVDTFAESG 326

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREID-KEC----AKIHAKLIKSQERSY 350
            L I +    E        +V V   +L  + +  I   EC      +   L+   E S 
Sbjct: 327 ALSIYAGCLPERF----DEVVRVTTDVLTEVARDGITADECRIAKGSLRGGLVLGLEDSA 382

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   I +  +  G      + +  I  +T ED+  VA+++ +     A+LGP
Sbjct: 383 SRMNRIGRSELNYGKHRSIAETLARIDEVTLEDVNAVARQLLTKPFGAAVLGP 435


>gi|254382117|ref|ZP_04997479.1| protease [Streptomyces sp. Mg1]
 gi|194341024|gb|EDX21990.1| protease [Streptomyces sp. Mg1]
          Length = 459

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 225/415 (54%), Gaps = 16/415 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPTLNGATHYLEHLLFKGTEKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIREEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F++ ++ +  +GRP+LG  +TI++ T ++I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAQTMFGETPLGRPVLGTVDTINALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKR 231
              + V   G VDH   V QV + F     A  +   +P    GG           +  R
Sbjct: 214 PTHLVVAAAGNVDHNKVVRQVRAAFEKAG-ALTRTDAEPIGPRGGTKRIRTSGRVELINR 272

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
              + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F
Sbjct: 273 KTEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGF 332

Query: 292 SDNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           +D G+  + +    +   +++ +    ++ V S  + +   EI +   ++    +   E 
Sbjct: 333 ADTGLFGVYAGCRPSQVHDVLRICRDELDKVAS--DGLTDEEIRRAVGQLSGSTVLGLED 390

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +      I K  +  G  +  + ++  I+A+T +D+  VA+ + +  P+LA++GP
Sbjct: 391 TGAIMNRIGKSELCWGDQMSVDDMLARIAAVTPDDVRAVAQDVLAQRPSLAVIGP 445


>gi|329936627|ref|ZP_08286334.1| protease [Streptomyces griseoaurantiacus M045]
 gi|329303857|gb|EGG47740.1| protease [Streptomyces griseoaurantiacus M045]
          Length = 459

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 127/419 (30%), Positives = 226/419 (53%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTARRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I++VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISAAIDEVGGEMNAFTAKEYTCYYARVLDSDLPLAIDVVCDMLTGSLIREEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNALGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-------KPAVYVGGEY-IQKRD 232
              + V C G VDH   V QV + F      +   ++       + A+   G   +  R 
Sbjct: 214 PTHLVVACAGNVDHAKVVRQVRAAFERADAFRRPAALPVEPRSGRRALRAAGRVEVLGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+++ +      E+ +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDHVAEHGLSDEEVGRAIGQLRGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+ +T +D+  VA++I    P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGDQMSVDDMLARITEVTPDDVRAVAREILGRRPSLSVIGPLKD 448


>gi|169831099|ref|YP_001717081.1| peptidase M16 domain-containing protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637943|gb|ACA59449.1| peptidase M16 domain protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 420

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 219/402 (54%), Gaps = 13/402 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE +P + SA V   + AGSR+E     G+ HF+EHMLFKGT  R+AK+I E +
Sbjct: 9   NGVCILTEEIPHVRSAAVGFWVDAGSRDEADSVSGVCHFIEHMLFKGTENRSAKDIAEAL 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           ++VGG +NA+T+ E+T Y+A VL EH+ LA++++ DML +S F P D+ERERNV++EEI 
Sbjct: 69  DRVGGQLNAFTTKEYTCYYARVLDEHLELAVDVLTDMLFHSRFAPEDVERERNVIVEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +    ++ +W    +GRP++G    I + +   ++ +  R+Y   R  +  
Sbjct: 129 MYEDTPDELVHDVLAKALWNTHALGRPVIGSAGVIQNLSWGDLLDYYDRHYRHGRYVIAV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK-----RDLAEEHMMLGFN 243
            G V HE     +   F     + +     P   V     Q+     +D  + H+ +G  
Sbjct: 189 AGNVKHERVTELLSRIF-----SDLPAGGPPRAVVAPHPSQRVECREKDTEQVHLCIGSQ 243

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G        Y+  +L ++LG GMSSRLFQ+VRE+ GL Y+I ++H ++ D G+  I +  
Sbjct: 244 GLRLDDEHIYVLQVLNTLLGGGMSSRLFQKVREQLGLAYNIYSYHSSYRDTGLFGIYAGL 303

Query: 304 AKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           ++EN+  +   +++ V  L    + + E+ +   ++    + S E    R   + K  ++
Sbjct: 304 SRENVGTVLDIVLDEVNDLRNGGVSEEEMTRAKEQLKGSFLLSLESVNARMSRLGKSQLY 363

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
            G +   E+I+  ++ +  E I  V  +IF     +LA +GP
Sbjct: 364 LGRVQTPEEIVRELARVKTEQIAAVCDQIFRRDKLSLASIGP 405


>gi|258516320|ref|YP_003192542.1| peptidase M16 domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780025|gb|ACV63919.1| peptidase M16 domain protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 422

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 236/398 (59%), Gaps = 3/398 (0%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
            +G  ++TE +P + S  + + +  GSR+E +E +G++HF+EH++FKGT +RTAK+I E 
Sbjct: 8   DNGAKILTEEVPYVRSVAIGIFVDVGSRDELKENNGISHFIEHLMFKGTKRRTAKQIAET 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           ++ VGG +NA+T+ E+T Y+A V+ EH+ LA++++ DM+ NS+F  +DI+RERNV+LEEI
Sbjct: 68  LDAVGGQLNAFTTKEYTCYYAKVIDEHLGLAIDLLTDMVFNSNFAAADIDRERNVILEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M ED   + +   F   +W+D ++GRPI+G  + I + T ++I+ F  + Y    + + 
Sbjct: 128 KMYEDAPDEQVHDVFVRSLWQDHVLGRPIIGDADIIQNMTSDQIMDFYKKYYVPGNLVIS 187

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            VG + H+  V+ +       +  +  + +           +++D  + H+  G  G   
Sbjct: 188 VVGNIKHDQVVNALNGLMAGLTGERPDKVLSLPKPFQEIICREKDTEQVHLCFGTQGLKL 247

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D Y+  +L ++LG G+SSRLFQEVRE+RGL YSI ++H ++ D+G+  I +  +K N
Sbjct: 248 THDDIYIMQVLNTVLGGGISSRLFQEVREQRGLVYSIYSYHSSYHDSGIFCIYAGLSKLN 307

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  +   +V+ ++ + ++ + + E+ +   ++   L+ S E   +R   + K   + G +
Sbjct: 308 VEQVLELVVKELRDIQKSGLTEDELRRTKDQLKGNLLLSLESINVRMSRLGKSEFYLGRL 367

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
              E+I++ ++ +T EDI  +A+ I      +LA +GP
Sbjct: 368 TTPEEIVEKVNLVTNEDIQRIARDILEPKNFSLATIGP 405


>gi|21224084|ref|NP_629863.1| protease [Streptomyces coelicolor A3(2)]
 gi|256784837|ref|ZP_05523268.1| protease [Streptomyces lividans TK24]
 gi|289768730|ref|ZP_06528108.1| protease [Streptomyces lividans TK24]
 gi|6686160|sp|O86835|Y5738_STRCO RecName: Full=Uncharacterized zinc protease SCO5738
 gi|3413821|emb|CAA20289.1| putative protease [Streptomyces coelicolor A3(2)]
 gi|289698929|gb|EFD66358.1| protease [Streptomyces lividans TK24]
          Length = 459

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/419 (30%), Positives = 222/419 (52%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTRKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIQEEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNALGRPVLGTVDTVNALTADRIRRFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK--------RD 232
              + V   G VDH   V QV + F      K   +   A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHNKVVRQVRAAFEKSGALKDPAAQPLAPRAGRRTVRAAGRVELIGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVILGMPGLARTDERRWAMGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+++ +      EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDHVAEHGLTDDEIGRAVGQLQGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+++T +D+  VA+ +    P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLARIASVTPDDVRAVARDVLGRRPSLSVIGPLKD 448


>gi|226366131|ref|YP_002783914.1| M16B family peptidase [Rhodococcus opacus B4]
 gi|226244621|dbj|BAH54969.1| putative M16B family peptidase [Rhodococcus opacus B4]
          Length = 448

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 144/417 (34%), Positives = 221/417 (52%), Gaps = 23/417 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E+    G AHFLEH+LFK T  R+
Sbjct: 24  GVRRTMLPGGLRVVTEYVPGVRSASVGVWVGVGSRDEQPTVAGAAHFLEHLLFKATPSRS 83

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+TS EHT ++A VL + +PLA++++ D++       SD++ ER
Sbjct: 84  ALDIAQVMDGVGGELNAFTSKEHTCFYAHVLDDDLPLAIDLVSDVVLRGRCRSSDVDVER 143

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+I S T  ++ SF  R YT
Sbjct: 144 QVVLEEISMRDDDPEDLLGDAFLTALYGDHPVGRPVIGSVESIESMTRTQLHSFHVRRYT 203

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKR 231
             RM V   G V+HE  V  V   F       ++ + +PA   GG           +  R
Sbjct: 204 PQRMVVAVAGNVEHEHTVELVRRAF----AGHLESASEPAPRRGGTLRLRTEPALSLTNR 259

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
           D  + H+ LG           +  ++L + +G G+SSRLFQEVRE RGL YS+ +  + F
Sbjct: 260 DSEQVHLSLGVRAFGRHESHRWALSVLNAAVGGGLSSRLFQEVREIRGLAYSVYSGIDTF 319

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKECAK----IHAKLIKSQ 346
           SD G   I +    EN+  +T+ I EV    L N+    I D ECA+    +   L+   
Sbjct: 320 SDTGAFSIYAGCQPENLGEVTTVIREV----LSNVAAEGITDAECARAKGSLRGGLVLGL 375

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           E S  R   I +  +  G+     + +  I A+T +++  VA+ +       A++GP
Sbjct: 376 EDSGSRMHRIGRSELNYGNHRSITETLGKIDAVTTDEVRDVARVLLQRPFAAAVVGP 432


>gi|148263964|ref|YP_001230670.1| peptidase M16 domain-containing protein [Geobacter uraniireducens
           Rf4]
 gi|146397464|gb|ABQ26097.1| peptidase M16 domain protein [Geobacter uraniireducens Rf4]
          Length = 419

 Score =  236 bits (602), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 142/403 (35%), Positives = 229/403 (56%), Gaps = 5/403 (1%)

Query: 5   ISKT--SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           I+KT   +GI VI+E +P  +S  + + +  GSR+ER+E +G+AHF+EH+LFKGT++RTA
Sbjct: 2   INKTILDNGIRVISEALPHANSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTSRRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++I+ D+  NS F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGILNAFTSREYVCYYAKVLDKFLPKAVDILVDIFHNSLFDPEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED+  D +   F +  WK   +G  ILG  E++SS + +KI+ + +  Y A
Sbjct: 122 VVLQEISMMEDNPDDSIHDLFHQHFWKGHPLGMSILGDQESVSSLSRDKIVGYKNHMYRA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G VDH+  +  +            K + +  VY     +  ++L + HM LG
Sbjct: 182 DDIIITAAGKVDHQDLLDLIGKLLPDVPQGSGKVACQNPVYEKRIELIGKELEQVHMCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK+GL YS+ ++  +  D G L + +
Sbjct: 242 VKGLPQHHSQRYEAFIMNTILGGSMSSRLFQEVREKQGLAYSVYSYMASHVDAGSLVVYA 301

Query: 302 ATAKENIM-ALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            + +E+    L  ++ E+++   E I   E+D    ++   LI S E S  R  +++K  
Sbjct: 302 GSGQEHFTEVLEITVRELMRLKKEPISLLELDSAREQLKGNLILSLESSDNRMSKLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILG 402
           ++ G     E+I      +T E I+ ++ ++      TL +LG
Sbjct: 362 IYFGGYQPLEEITAGFDRVTSESIMQLSSELLDDNYLTLVLLG 404


>gi|254450246|ref|ZP_05063683.1| protease [Octadecabacter antarcticus 238]
 gi|198264652|gb|EDY88922.1| protease [Octadecabacter antarcticus 238]
          Length = 370

 Score =  236 bits (602), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 197/368 (53%)

Query: 51  MLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSS 110
           M FKGT +R+A +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N  
Sbjct: 1   MAFKGTKRRSALQIAEAIEDVGGYINAYTSREMTAYYARVLENDVPLALDVIADILLNPV 60

Query: 111 FNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEK 170
           F  ++IE ER V+L+EIG + D   D +     E  + DQ IGR ILG  E +SSF    
Sbjct: 61  FEQAEIEVERGVILQEIGQALDTPDDIIFDWLQEEAYPDQAIGRTILGPSERVSSFAKAD 120

Query: 171 IISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK 230
           +  F+   Y  D+M +   GAV+ +  ++  E  F          + + A +VGGE   K
Sbjct: 121 LTDFIGERYGPDQMILSAAGAVNPDELLALAEKLFGHLPRRSEPRAAEAAAFVGGERRVK 180

Query: 231 RDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHEN 290
           + L + H  L F G  Y+    Y   I A  +G GMSSRLFQE+RE RGLCY+I A    
Sbjct: 181 KGLEQAHFALAFEGPDYRDPGIYAAQIHAIAMGGGMSSRLFQELRENRGLCYTIFAQAGA 240

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           ++D G++ + + T+ E +  L +  ++ ++   +++   E+ +  A++ A ++   E   
Sbjct: 241 YADTGMMTVYAGTSAEQLGELATLTIDELKRAADDMSAEEVARARAQMKAGMLMGLESPS 300

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
            RA  +++ V   G +   E  I+ I ++T  D+      + +   ++  L  P+D  PT
Sbjct: 301 NRAERLARMVAIWGDVPTIEDTIERIDSVTTGDVRAFGGSLITDAGSVMALYGPIDDAPT 360

Query: 411 TSELIHAL 418
              L   L
Sbjct: 361 LEALRQRL 368


>gi|311898697|dbj|BAJ31105.1| putative M16 family peptidase [Kitasatospora setae KM-6054]
          Length = 460

 Score =  236 bits (601), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 138/415 (33%), Positives = 225/415 (54%), Gaps = 9/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   + +  GSR+E    +G  H+LEH+LFKGT +R 
Sbjct: 36  TVRRTVLPGGLRVVTETLPTVRSATFGIWVGVGSRDETPVLNGATHYLEHLLFKGTARRD 95

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D+E ER
Sbjct: 96  ALEISAALDAVGGEMNAFTAKENTCYYARVLDTDLPLAIDVVCDMLTGSLIRPEDVESER 155

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M+EDD  D +   F+++++ D  +GRPILG  ET+++ T ++I  F  R Y 
Sbjct: 156 GVILEEMAMAEDDPGDVVHDLFAKVLFGDGPLGRPILGTQETVTALTRDQIAGFYQRRYK 215

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSV------AKIKESMKPAVYVGGEYIQKRDLA 234
            + + V   G +DH   V  VE  F           A+ +   K     G   +  R   
Sbjct: 216 PENLVVAAAGNLDHAKVVKLVEQAFAPVLAKSKGHPAEARRGHKAVRTAGRAAVLNRPTE 275

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + H++LG  G        +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +++D 
Sbjct: 276 QAHLVLGVPGIPRHDERRWALGVLNAALGGGMSSRLFQEVREKRGLAYSVYSYSSSYADT 335

Query: 295 GVLYI-ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G+  I A    K     L     E+ + + E I + E+ +   +I    +   E +    
Sbjct: 336 GLFGIYAGCQPKRVEEVLRICRAELARVVEEGITEEELRRAIGQISGSTVLGMEDTGSLM 395

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDH 407
             I K  +  G  L  ++++  I+A+T +++  VA+ +  +  P+LA++GP  D 
Sbjct: 396 NRIGKAELSYGHHLSVDEMLGRIAAVTLDEVHAVARDVLGAHRPSLALIGPVNDR 450


>gi|226306132|ref|YP_002766092.1| M16 family peptidase [Rhodococcus erythropolis PR4]
 gi|226185249|dbj|BAH33353.1| putative M16 family peptidase [Rhodococcus erythropolis PR4]
          Length = 438

 Score =  235 bits (600), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 135/405 (33%), Positives = 220/405 (54%), Gaps = 15/405 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + SA V V +  GSR+E+    G AHFLEH+LFK T  RTA +I + +
Sbjct: 21  GGLRVVTEFIPGVRSASVGVWVGVGSRDEQPSVAGAAHFLEHLLFKSTPSRTALDIAQVM 80

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+TS EHT ++A V+ E +P+A++++ D++       +D++ ER VVLEEI 
Sbjct: 81  DGVGGELNAFTSKEHTCFYAHVIDEDLPMAVDLVADVVLRGRCRTADVDVERQVVLEEIA 140

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   ++ D  +GRPI+G  E+I S +  ++ SF  R YT  RM +  
Sbjct: 141 MRDDDPEDLLGDAFLTALFGDHPVGRPIIGSVESIESMSRNQLHSFHVRRYTPQRMVLAV 200

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRDLAEEHMM 239
            G VDH+  V+     F       ++  +KPA    G           +  RD  + H+ 
Sbjct: 201 AGNVDHKQVVTLARRAF----AGHLERGVKPAPRREGTLRLRTMPELSLTHRDSEQVHLA 256

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG           +  ++L + +G G+SSRLFQE+REKRGL YS+ +  + F+D G   +
Sbjct: 257 LGVRAFGRHEGHRWALSVLNAAVGGGLSSRLFQEIREKRGLAYSVYSGVDTFADTGAFSV 316

Query: 300 ASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +    EN+  + + I EV+ ++  + I   EI +    +   L+ + E S  R   I +
Sbjct: 317 YAGCQPENLGEVATVIREVLANVATDGITDAEIARAKGSLRGGLVLALEDSGSRMNRIGR 376

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +  G+     + + TI A+T E+++ VA+ + +     A++GP
Sbjct: 377 SELNYGNHRSVAQTLATIDAVTSEEVLEVAQVLLTRPFAAAVVGP 421


>gi|297202780|ref|ZP_06920177.1| protease [Streptomyces sviceus ATCC 29083]
 gi|197716768|gb|EDY60802.1| protease [Streptomyces sviceus ATCC 29083]
          Length = 459

 Score =  235 bits (600), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 224/419 (53%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT+KR+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPSLNGATHYLEHLLFKGTSKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D+  ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDADLPLAIDVVCDMLTGSLILEEDVNVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK--------RD 232
              + V   G VDH+  V QV + F      K  ++   A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHDKVVRQVRAAFEKAGALKSPDATPIAPRDGRRALRTAGRVELIGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+ + +      EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDQVAEHGLTDDEIGRAIGQLRGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+++T +D+  VA++I    P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLTRIASVTPDDVRAVAREILGRRPSLSVIGPLKD 448


>gi|220929128|ref|YP_002506037.1| peptidase M16 domain protein [Clostridium cellulolyticum H10]
 gi|219999456|gb|ACL76057.1| peptidase M16 domain protein [Clostridium cellulolyticum H10]
          Length = 411

 Score =  235 bits (600), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 213/390 (54%), Gaps = 7/390 (1%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ ++ E +P + S  V + +  GSRNE  E +G++HF+EHMLFKGT KR+AK+I E 
Sbjct: 8   SNGLRLVYEKIPYVRSVSVGLWVGTGSRNETSENNGISHFIEHMLFKGTAKRSAKDIAEC 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           I+ +GG INA+T  E T Y+   L  H+ +A++++ DM  NSSF   DI  E+ VV+EEI
Sbjct: 68  IDSIGGQINAFTGKECTCYYTKTLDTHLDIAMDVLSDMFFNSSFASDDISVEKRVVVEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
           GM ED   + +   FSEMVW    +G PILG  + I+ F  + I+ ++   YT     + 
Sbjct: 128 GMYEDTPEELVHDIFSEMVWDGNPLGYPILGTEKCINKFDKDMILKYMEEFYTPYNTVIS 187

Query: 188 CVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
             G  D    +  V +YF N  S      +  PA Y   + ++++D  + H+ +GF G  
Sbjct: 188 VAGNFDEGKLIELVNNYFQNWKSKETYNNNFSPAQYKVNKIVREKDTEQVHLCMGFEGIG 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
           + S   Y    L +ILG GMSSRLFQ +REKRGL YSI ++   +  +G+  + +    E
Sbjct: 248 HGSDKLYSLLSLNNILGGGMSSRLFQNIREKRGLVYSIYSYPSTYQGSGLFVVYAGMNPE 307

Query: 307 ---NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
               ++ LT + +E +  + E I + E+ K   ++    I   E +  R   I K  +  
Sbjct: 308 YFQTVIDLTKAELETI--IKEGITKDELAKTKEQLKGNYILGLESTSSRMNSIGKSELLT 365

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFS 393
           G I   E+I+  I  +  + I  + K++F+
Sbjct: 366 GKIKTPEEILQKIDRVDMDSIDEMIKRVFN 395


>gi|86742235|ref|YP_482635.1| processing peptidase [Frankia sp. CcI3]
 gi|86569097|gb|ABD12906.1| processing peptidase [Frankia sp. CcI3]
          Length = 467

 Score =  235 bits (600), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 134/409 (32%), Positives = 211/409 (51%), Gaps = 15/409 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ VITE +P + S  + V +  GSR+E     G +H+LEH+LFKGT  R A  I   +
Sbjct: 55  GGLRVITERVPGVRSVAIGVWVAVGSRDETPVTAGCSHYLEHLLFKGTPSRDALTISASV 114

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGGDINA+T  E+T Y+  VL   + +A+ +I DM++NS     D+E ER V+LEEI 
Sbjct: 115 EAVGGDINAFTGKEYTCYYVRVLDSDLAMAVNVIADMVTNSLVTADDVEAERGVILEEIA 174

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M EDD  D +   F+  +    ++GRP+LG  E+I     E I  +    Y    M V  
Sbjct: 175 MYEDDPGDLVHDVFAAAMLGSSVLGRPVLGTTESIEGLGRETIADYYRSRYVPPAMVVSI 234

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRDLAEEHMM 239
            G + H+  ++ V   F      ++  S +P    GG Y         +  R   + H++
Sbjct: 235 AGNLAHDRALALVAEAF----ADRLTVSAEPFEVRGGSYDYPPPPGIVVTDRPTEQAHLV 290

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG  G +      Y   +L++ LG GMSSRLFQE+REKRGL YS+ +   +F+D G+  +
Sbjct: 291 LGTRGLSRHDPRRYTLGVLSTALGGGMSSRLFQEIREKRGLAYSVGSFASHFADAGLFGV 350

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  A +    +     E V+ + E  I   E+D+   +    +I   E +  R   + K
Sbjct: 351 YAGCAPKRADVVLELAREQVRQIAEHGISAEELDRARGQNRGSMILGLEDTGSRMSRLGK 410

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
             +  G +L  ++II  + A+T +D+  +A+++   +  L ++GP  DH
Sbjct: 411 SELVHGEVLSVDEIIARVDAVTLDDVTAIARELLDQSWALGVIGPFDDH 459


>gi|146296970|ref|YP_001180741.1| processing peptidase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145410546|gb|ABP67550.1| processing peptidase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 422

 Score =  235 bits (600), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 234/405 (57%), Gaps = 6/405 (1%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + + K S+ I ++ E V  + +  V V I AGSR E + E+G++HF+EH+LFKGT  R++
Sbjct: 2   INLYKLSNNIRLVYEKVDTVKTVSVGVWILAGSRYEIKNENGISHFIEHILFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEIV EIE +GG INA+T+ E+T ++  VL E +  A EI+ D+L N   NP DIE+E+ 
Sbjct: 62  KEIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLEKAFEILSDLLLNPLINPEDIEKEKT 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI MS+DD  + L    ++++WK + +  PI+GK  T+      +I++F+ + Y  
Sbjct: 122 VIIEEINMSKDDPEEILYQALNDLIWKGETLSYPIVGKESTVKRIDRNRILNFMRKRYKP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           + + +   G  D  + ++  E YF        +K   + KP ++  G  I+ +   +  +
Sbjct: 182 ENVVISVAGHFDESYLINLCERYFGDWESYLESKDTNNSKP-IFKRGAVIKSKKSDQAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            + F G   +  + Y   ++++ILG GMSSRLFQ++RE+ GL YSI++    + D G+L 
Sbjct: 241 AIAFEGFGQEDENVYKLLVVSNILGGGMSSRLFQKIREELGLVYSINSFVSTYKDVGMLI 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           + + T+ +N+  +   I+  ++ L+  N+   E++    +I   +I   E +  R   + 
Sbjct: 301 VYAGTSPKNVRMVYKEILNQIKLLIRGNLTPDEVEVAKQQIKGSIIFGLENTSSRMSNLG 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           K ++    I+  ++IID I++I  + ++ + +++ +   ++A++G
Sbjct: 361 KNMLLLNRIIEMQEIIDIINSIKFDQVMDIIREVLTKEFSVAVVG 405


>gi|41408988|ref|NP_961824.1| PepR [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41397347|gb|AAS05207.1| PepR [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 440

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 226/413 (54%), Gaps = 17/413 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 17  LRRSTLPGGLRVVTEYLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRTA 76

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 77  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDADLELAVDLVADVVLNGRCAAEDVELERD 136

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +++S T  ++ SF  R YT 
Sbjct: 137 VVLEEIAMRDDDPEDALGDMFLGALFGDHPVGRPVIGTARSVASMTRTQLHSFHVRRYTP 196

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAE 235
           +RM V   G VDH+  V+ V  +F    + + ++ + P    G      G  +  RD  +
Sbjct: 197 ERMVVAVAGNVDHDEVVAMVREHFG-PHLVRGRQPIAPRKGAGRVNGRPGLLLGTRDAEQ 255

Query: 236 EHMMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            H+ LG    G  +Q R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D
Sbjct: 256 THVSLGVRTPGRGWQHR--WALSVLHTALGGGLSSRLFQEIRELRGLAYSVYSTVDIFAD 313

Query: 294 NGVLYIASATAKEN---IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           +G L + +A   E    +MA+TS ++E V    + I + E       +   L+   E S 
Sbjct: 314 SGALSVYAACQPERFAEVMAVTSGVLESVAR--DGITESECRIAKGSLRGGLVLGLEDSG 371

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   + +  +  G     E  +  I  ++ +++  +A+++ +     A+LGP
Sbjct: 372 SRMSRLGRNELNYGRHRSIEHTLAQIDRVSVDEVNAIARRLLTQHYGAAVLGP 424


>gi|320008200|gb|ADW03050.1| peptidase M16 domain protein [Streptomyces flavogriseus ATCC 33331]
          Length = 457

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 218/419 (52%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 28  TVRRTVLPGGLRVVTETLPSVRSATFGIWANVGSRDETPTLNGATHYLEHLLFKGTAKRS 87

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 88  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 147

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 148 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 207

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         +++  A   G   ++         R 
Sbjct: 208 PTHLVVAAAGNVDHATVVRQVRRAFERAGALTRTDAVPTAPRAGSRTLRAAGKVELLNRK 267

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 268 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 327

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIE-----QREIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+ +        EI +   ++    +   E
Sbjct: 328 DCGLFAVYAGCRPSQV----HDVLKICRDELDRVATHGLGDEEIGRAVGQLAGSTVLGLE 383

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+A+T +++  VA  +    P+L+++GP  D
Sbjct: 384 DTGALMNRIGKSELCWGEQMSVDDMLAKIAAVTPDEVRAVAADVLGQRPSLSVIGPLKD 442


>gi|315648087|ref|ZP_07901188.1| peptidase M16 domain protein [Paenibacillus vortex V453]
 gi|315276733|gb|EFU40076.1| peptidase M16 domain protein [Paenibacillus vortex V453]
          Length = 422

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/398 (31%), Positives = 218/398 (54%), Gaps = 3/398 (0%)

Query: 7   KTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           + S+G+ V+ E +P   S    + ++ GSRNE  E +G+ HF+EHM+FKGT +  A+ I 
Sbjct: 5   QLSNGLRVVMEQIPTSRSVSFGIWVKTGSRNESLEINGITHFIEHMMFKGTERFDARAIA 64

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           EE + +GG++NA+TS E+T Y+A VL EH P+A++++ DM  NS  +  ++ +E+NV+LE
Sbjct: 65  EEFDAIGGNVNAFTSKEYTCYYAKVLDEHFPIAVDVLSDMFFNSKLDAGELAKEKNVILE 124

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M ED   D +    S  V+ D  +  PILG  E + S   + + S++  +YT +   
Sbjct: 125 EIAMYEDTPDDLVHDLMSLSVYGDHPLAYPILGTKERLESMDSQALKSYMDTHYTIENTV 184

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
           +   G ++ E  +  +E +F   +     E +    ++ G   +K+   + H+ L F GC
Sbjct: 185 IALAGNINDE-VIELLERHFGGFTNHGTAEPLAVPAFLDGVQFRKKKTEQNHICLSFPGC 243

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
           +      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +DNG+  I + TA 
Sbjct: 244 SIGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADNGMFTIYAGTAP 303

Query: 306 ENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
           +    +     E++  +  N + + E+ K   ++   LI   E +  R   + K  +  G
Sbjct: 304 KQTKEVLQLTTEMLHDVATNGMTEEELRKGKEQLKGSLILGLESTSSRMNRLGKNELMLG 363

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
                 +II  I  ++ +D+  V  ++F +   LA++G
Sbjct: 364 HHFSLNEIIKRIEQVSMKDVDAVLDRMFGTPYALAMVG 401


>gi|285808443|gb|ADC35969.1| putative protease [uncultured bacterium 98]
          Length = 419

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/398 (32%), Positives = 225/398 (56%), Gaps = 7/398 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE MP + S  + V +  GSR+E  +  G+AHF+EHMLFKGT  R+A++I + I
Sbjct: 9   NGLRLLTEQMPHVRSVSIGVWLTRGSRHEPSQHAGIAHFVEHMLFKGTGSRSAEDIAQAI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG ++A+T+ E+ SY+  VL EH+PLA++++ D++   +F   DIERE+ VVLEEI 
Sbjct: 69  DSIGGQMDAFTAKEYASYYIKVLDEHLPLAIDVLADIVLRPAFAAEDIEREKKVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +   F+E  WKD  +GRPILG P+T+S+   E + S+ +  Y+A  + V  
Sbjct: 129 MVEDTPDDLVHELFTEHFWKDHPLGRPILGTPDTVSALNAETLRSYFTDAYSAGNLIVAA 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESM--KPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
           VG +DH      V  +F    +  I E++   P   V    I+ ++L + H+ LG  G  
Sbjct: 189 VGNIDHSHVRDLVTKHFG--HLTTIGEAIVDAPPHVVPEVVIRNKELEQSHVCLGTTGYQ 246

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
              +D Y + +L ++LG  MSSRLFQ VREKRGL Y++ +    + D G + + +  A  
Sbjct: 247 QDHKDRYASYVLNTVLGGSMSSRLFQNVREKRGLAYAVFSGLSAYRDAGNVTVYAGCANN 306

Query: 307 NIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
            +  L   +V  ++ + ++   + EI +    +   L+ + E +  R   +++Q ++   
Sbjct: 307 AVAELIDVVVGELRRIKDDPPPEEEIRRAKDHLKGSLMLNLESTSSRMSHLARQEIYFDR 366

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLA-ILG 402
               ++ ++ +  ++  D+  VA+ +F      A +LG
Sbjct: 367 QFGLDETLEGVELVSRADLERVARDLFGRDALAATVLG 404


>gi|269127529|ref|YP_003300899.1| processing peptidase [Thermomonospora curvata DSM 43183]
 gi|268312487|gb|ACY98861.1| processing peptidase [Thermomonospora curvata DSM 43183]
          Length = 441

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/414 (32%), Positives = 225/414 (54%), Gaps = 19/414 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ +ITE MP + SA   +    GSR+E   + G +H+LEH LFKGT +R+A
Sbjct: 26  VRRTVLPGGLRIITETMPTVRSAAFGIWAGVGSRDEEARDAGASHYLEHTLFKGTRRRSA 85

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   ++ VGGD+NA+T+ E+T Y+A VL   +PLA++++ DM+ +S   P D+E ER 
Sbjct: 86  LEISAALDAVGGDLNAFTAKEYTCYYARVLDSDLPLAVDVVSDMVIDSLNRPEDVEAERG 145

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   F+  ++ D  +GRPILG  ETI++ + + I  +   +Y  
Sbjct: 146 VILEEIAMRDDDPGDLVHDEFATALYGDLPLGRPILGTVETINALSRDVIDRYYREHYLV 205

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQKR--------D 232
             + V   G +DH+  V QV   F      ++    +PA   +GG  +  R        D
Sbjct: 206 PNLVVAAAGNLDHDQLVRQVAEAF----AGRLGGDEQPAPPRIGGPPVAGRPGVRVIDKD 261

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + +++LG  G        Y   +L ++LG GMSSRLFQEVREKRGL YS+ ++   ++
Sbjct: 262 TEQANVVLGGIGVCRTDERRYALGVLNAVLGGGMSSRLFQEVREKRGLAYSVYSYTSQYA 321

Query: 293 DNGV--LYIASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  +Y      K + ++A+     EV +     ++  E+++   ++   ++   E +
Sbjct: 322 DTGMFCVYAGCQPGKVDEVLAICRD--EVAKLADGGLDTEELERGKGQLRGAMVLGLEDT 379

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   + K  +    +   E+ +  I A+T +D+  VA+++     TLA++GP
Sbjct: 380 GSRMSRLGKSELVYERLQPVEESLACIEAVTVDDVREVARQVLGRLDTLAVVGP 433


>gi|197117697|ref|YP_002138124.1| zinc-dependent peptidase PqqL family protein [Geobacter
           bemidjiensis Bem]
 gi|197087057|gb|ACH38328.1| zinc-dependent peptidase, PqqL family [Geobacter bemidjiensis Bem]
          Length = 418

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/403 (34%), Positives = 229/403 (56%), Gaps = 5/403 (1%)

Query: 5   ISKT--SSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           I KT  ++GI VITE +P  S+  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R++
Sbjct: 2   IKKTILNNGIRVITERIPYASSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTERRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++++ D+  +S+F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPKAVDLLTDIFLHSTFDPEEIEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D +   F +  WK   +G  ILG  E+++  T + II++  + Y +
Sbjct: 122 VVLQEINMMEDTPDDLIHDLFHQHFWKGHPLGMSILGDAESVTGLTRDAIIAYKEQMYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + V   G + H+   + +E Y +       +    P VY     + ++DL + H+ LG
Sbjct: 182 DDVIVTAAGNLTHDKLTALLEEYLHCVPSGNGRTESAPPVYERRIELVEKDLEQIHVCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK GL YS+ ++  + +D G L + +
Sbjct: 242 LKGVQQSHPQRYDAFIMNAILGGSMSSRLFQEVREKSGLAYSVYSYIASHADAGSLVVYA 301

Query: 302 ATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             + EN   L   ++ E+ +   E +   ++D    ++   L+ S E S  R   ++K  
Sbjct: 302 GASPENQAELLEIMLREIGRFKREPVPAEQLDGAREQLKGNLLLSLESSDNRMSRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           ++ G+ L   +I++    +T E I  +A  I  +S  TL +LG
Sbjct: 362 IYFGTPLPLSEIMEGFDRVTAESIQTLAVDILDNSALTLVMLG 404


>gi|257055505|ref|YP_003133337.1| putative Zn-dependent peptidase [Saccharomonospora viridis DSM
           43017]
 gi|256585377|gb|ACU96510.1| predicted Zn-dependent peptidase [Saccharomonospora viridis DSM
           43017]
          Length = 453

 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/411 (32%), Positives = 218/411 (53%), Gaps = 24/411 (5%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ VITE +  + SA V + +  GSR+ER    G AH+LEH+LFKGT +R+A +I EEI
Sbjct: 34  GGLRVITESISGVRSATVGLWVGVGSRDERPHLAGAAHYLEHLLFKGTARRSAAQIAEEI 93

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+T+ EHT ++A VL + +PLA+++I D++  +  + +D++ ER VVLEEI 
Sbjct: 94  DAVGGEMNAFTAKEHTCFYAQVLDDDLPLAVDLITDVVFEALCSDADVDIERGVVLEEIA 153

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F E V  +  +GR ILG  ++I+  TP  + SF  R Y   RM +  
Sbjct: 154 MRDDDPEDLLHEMFVETVMPNHPLGRSILGTEQSITMMTPSALRSFYRRRYRLQRMVLAV 213

Query: 189 VGAVDHEFCVSQVESYFN------------VCSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
            G V+H   V  VES                   A+   S++P +Y       K D  + 
Sbjct: 214 AGNVEHRAVVRMVESALRGRLSGSDTPRPPRGGQARFGRSVRPVLY-------KHDTEQT 266

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+MLG           Y   +L ++LG GMSSRLFQEVRE+RGL Y + +   +++D G 
Sbjct: 267 HLMLGVRTPGRHDERRYSLAVLNTVLGGGMSSRLFQEVRERRGLAYQVYSSVTSYADAGH 326

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALE 355
             I      + +  +   +  ++  L+E+ + + E+ +   ++   L+   E +  R   
Sbjct: 327 FDIYVGCQPDRLGEVAGVVGGMLADLVEHGVTEAEVTRAKGQLRGGLVLGLEDTASRMFR 386

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF---SSTPTLAILGP 403
           + +  +  G      + ++ I A+T ED+  +A+ +         +A++GP
Sbjct: 387 LGENELHYGHYRSVSETVERIDAVTTEDVTALARALLRRPGGRSAVAVVGP 437


>gi|239944721|ref|ZP_04696658.1| putative protease [Streptomyces roseosporus NRRL 15998]
 gi|239991185|ref|ZP_04711849.1| putative protease [Streptomyces roseosporus NRRL 11379]
 gi|291448179|ref|ZP_06587569.1| protease [Streptomyces roseosporus NRRL 15998]
 gi|291351126|gb|EFE78030.1| protease [Streptomyces roseosporus NRRL 15998]
          Length = 459

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/419 (31%), Positives = 219/419 (52%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KRT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPALNGATHYLEHLLFKGTAKRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSV--------AKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F                +E  +    VG   +  R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKAGALSRTDAVPMAPREGSRTLRTVGKVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENI-----EQREIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+ +     +  EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPNQV----HDVLKICRDELDRVATHGLDDDEITRAIGQLSGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+ +T +D+  VA ++ S  P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLARIAEVTPDDVRDVAGELLSRRPSLSVIGPLKD 448


>gi|289643637|ref|ZP_06475750.1| peptidase M16 domain protein [Frankia symbiont of Datisca
           glomerata]
 gi|289506528|gb|EFD27514.1| peptidase M16 domain protein [Frankia symbiont of Datisca
           glomerata]
          Length = 437

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 137/411 (33%), Positives = 219/411 (53%), Gaps = 19/411 (4%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + S  + + +  GSR+E     G +H+LEH+LFKGT  R A  I   I
Sbjct: 25  GGLRVLTEKVPGVRSVAIGIWVGVGSRDESPLTAGCSHYLEHLLFKGTPSRDALTISAAI 84

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG++NA+T+ E+T Y+  VL   +  A+E++ DM+S+S     D+E ER V+LEEI 
Sbjct: 85  EAVGGELNAFTTKEYTCYYVRVLDNDLTDAVEVLSDMVSHSLIAADDVEAERGVILEEIA 144

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D +   FS  +  D  +GRP+LG  E+I +   + I  +    Y    M V  
Sbjct: 145 MHDDDPSDVVHDVFSAALLGDTELGRPVLGTTESIENLERDTIAEYYRSRYALSDMVVAI 204

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRDLAEEHMM 239
            G +DHE  ++ V S F      ++     PA   GG Y         + +R   + H++
Sbjct: 205 AGNIDHERTLALVASAF----ADRLGGPGAPAAARGGSYAYPDAAGVVVTRRPTEQAHVV 260

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG  G + Q    +   I++S LG GMSSRLFQEVREKRGL YS+ +   +F+D G+  +
Sbjct: 261 LGTVGMSRQDDRRFALGIMSSALGGGMSSRLFQEVREKRGLAYSVYSFASHFADAGLFGV 320

Query: 300 ASATA---KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            +  A    ++++AL    +E+V ++   I   E+ +   +    L+   E +  R   I
Sbjct: 321 YAGCAPRRADDVLALCREQLELVATV--GITDEELARAKGQSRGSLVLGLEDTGSRMSRI 378

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
            K  +  G +L  ++I+  + A+T +D+  VA ++ +    L ++GP  DH
Sbjct: 379 GKSELVHGELLSVDEILARVDAVTGDDVRAVAAELLTRPLALGVIGPFDDH 429


>gi|229490834|ref|ZP_04384669.1| peptidase, M16 family [Rhodococcus erythropolis SK121]
 gi|229322224|gb|EEN88010.1| peptidase, M16 family [Rhodococcus erythropolis SK121]
          Length = 452

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 220/405 (54%), Gaps = 15/405 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + SA V V +  GSR+E+    G AHFLEH+LFK T  RTA +I + +
Sbjct: 35  GGLRVVTEFIPGVRSASVGVWVGVGSRDEQPSVAGAAHFLEHLLFKSTPSRTALDIAQVM 94

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+TS EHT ++A V+ + +P+A++++ D++       +D++ ER VVLEEI 
Sbjct: 95  DGVGGELNAFTSKEHTCFYAHVIDDDLPMAVDLVADVVLRGRCRTADVDVERQVVLEEIA 154

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   ++ D  +GRPI+G  E+I S +  ++ SF  R YT  RM +  
Sbjct: 155 MRDDDPEDLLGDAFLTALFGDHPVGRPIIGSVESIESMSRNQLHSFHVRRYTPQRMVLAV 214

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRDLAEEHMM 239
            G VDH+  V+     F       ++  +KPA    G           +  RD  + H+ 
Sbjct: 215 AGNVDHKQVVTLARRAF----AGHLERGVKPAPRREGTLRLRTMPELSLTHRDSEQVHLA 270

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG           +  ++L + +G G+SSRLFQE+REKRGL YS+ +  + F+D G   +
Sbjct: 271 LGVRAFGRHEGHRWALSVLNAAVGGGLSSRLFQEIREKRGLAYSVYSGVDTFADTGAFSV 330

Query: 300 ASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +    EN+  + + I EV+ ++  + I   EI +    +   L+ + E S  R   I +
Sbjct: 331 YAGCQPENLGEVATVIREVLANVATDGITDAEIARAKGSLRGGLVLALEDSGSRMNRIGR 390

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +  G+     + + TI A+T E+++ VA+ + +     A++GP
Sbjct: 391 SELNYGNHRSVAQTLATIDAVTSEEVLEVAQVLLTRPFAAAVVGP 435


>gi|322382338|ref|ZP_08056245.1| specific processing protease-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153691|gb|EFX46066.1| specific processing protease-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 416

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/399 (31%), Positives = 226/399 (56%), Gaps = 11/399 (2%)

Query: 10  SGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P   S    + ++ GSRNE  + +G++HF+EHMLFKGT + +AKEI E  
Sbjct: 8   NGLRVVIEKIPTCRSVAFGIWVKTGSRNESAQNNGISHFIEHMLFKGTVRHSAKEIAEIF 67

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM  NS F+  ++E+E+NV+ EEI 
Sbjct: 68  DGIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFNSVFDKQELEKEKNVIFEEIS 127

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    +   + +  +GR ILG  ET+S+  P+ + +++ + Y  +   +  
Sbjct: 128 MYEDTPDDLVHDLVARASYGEHSLGRTILGTEETLSAMNPDDLRAYMEQFYNIENTVISI 187

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +D +  +  +E +F   + +    S     +VG    +++   + H+ +   G A +
Sbjct: 188 AGNIDDK-VIQLIEKHFGEFTNSGSPTSYTTPEFVGDLIFEEKKAEQNHICMSLPGMALE 246

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             + Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +  D G+  I + TA +  
Sbjct: 247 EDNLYPMVLLNNALGGGMSSRLFQEIREKRGLAYSVYSYHSSHMDTGLFTIYTGTAPKQ- 305

Query: 309 MALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
              T  +++V   +LEN+++      E+ K   ++   LI S E +  R   + K  +  
Sbjct: 306 ---TEEVLKVTMDILENVKEHGLTDLELKKGKEQLKGSLILSLESTNSRMNRLGKNELIF 362

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           G     +++I+ I ++  + I  +  ++F+    L+++G
Sbjct: 363 GKHYSLDEMIERIESVNIDHIRSLVGRLFARPFALSMVG 401


>gi|89101183|ref|ZP_01174014.1| zinc protease [Bacillus sp. NRRL B-14911]
 gi|89084092|gb|EAR63262.1| zinc protease [Bacillus sp. NRRL B-14911]
          Length = 396

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 213/386 (55%), Gaps = 3/386 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P + S  + V I  GSRNE    +G++HFLEHM FKGT  RTA+EI E  
Sbjct: 9   NGVRVVLENIPTVRSVAIGVWIGTGSRNEHPGNNGVSHFLEHMFFKGTKTRTAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+T Y+A VL  H   AL+++ DM  NS+F   ++ +E+NVVLEEI 
Sbjct: 69  DSIGGQVNAFTSKEYTCYYAKVLDTHSKFALDVLADMFFNSTFVDEELNKEKNVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     + +++   +G PILG  ET+ +F  + +  ++   YT + + +  
Sbjct: 129 MYEDTPDDIVHDLLGKAIYESHPLGYPILGTEETLETFKGDTLREYMHETYTPENVVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +   F + +VE  F      K + + +  V+      +K++  + H+ LG+ G    
Sbjct: 189 AGNISDSF-IQEVEKLFGSYEAGKQERNQEKPVFHSNRVSRKKETEQAHLCLGYEGLPVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
            +D Y   +L +ILG  MSSRLFQ+VRE+RGL YS+ ++H +F D G++ I   T  + +
Sbjct: 248 HKDMYSLILLNNILGGSMSSRLFQDVREQRGLAYSVFSYHSSFQDTGMVTIYGGTGAKQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L  +I E + +L  + I ++E+     ++   L+ S E +  R     K  +  G   
Sbjct: 308 DVLFETIQETLATLKRDGITEKELKNSKEQMKGSLMLSLESTNSRMSRNGKNELLLGRHR 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFS 393
             ++I++ I  ++   +  +A  IFS
Sbjct: 368 SLDEIVEQIDKVSEAGVNEMANSIFS 393


>gi|294815458|ref|ZP_06774101.1| Protease [Streptomyces clavuligerus ATCC 27064]
 gi|294328057|gb|EFG09700.1| Protease [Streptomyces clavuligerus ATCC 27064]
          Length = 441

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 227/418 (54%), Gaps = 16/418 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 16  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPSLNGATHYLEHLLFKGTERRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 76  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILQEDVDAER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T +++  F  ++Y 
Sbjct: 136 GVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVRRFYRKHYD 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-------NVCSVAKIKESMKPAVYVGG--EYIQKR 231
              + V   G VDH   V QV   F        V +V       + AV   G  E I +R
Sbjct: 196 PTHLVVAAAGNVDHATVVRQVRRAFERAGALDRVDAVPLAPRDGQRAVRTAGRVELIDRR 255

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
              + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F
Sbjct: 256 -TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGF 314

Query: 292 SDNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           +D G+  + +    +   +++ +    ++ V S    ++  EI +   ++    +   E 
Sbjct: 315 ADCGLFGVYAGCRPSQVHDVLKICRDELDRVAS--HGLDDDEIGRAIGQLSGSTVLGLED 372

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           +      I K  +  G+ +  + ++  I+A+T +++  VA ++    P+LA++GP  D
Sbjct: 373 TGALMNRIGKSELCWGAQMSVDDMLTRIAAVTPDEVREVAAEVLGRRPSLAVIGPLKD 430


>gi|118462445|ref|YP_882852.1| protease [Mycobacterium avium 104]
 gi|118163732|gb|ABK64629.1| protease [Mycobacterium avium 104]
          Length = 457

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 140/413 (33%), Positives = 225/413 (54%), Gaps = 17/413 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 34  LRRSTLPGGLRVVTEYLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRTA 93

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 94  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDADLELAVDLVADVVLNGRCAAEDVELERD 153

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +++S T  ++ SF  R YT 
Sbjct: 154 VVLEEIAMRDDDPEDALGDMFLGALFGDHPVGRPVIGTARSVASMTRTQLHSFHVRRYTP 213

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAE 235
           +RM V   G VDH+  V+ V  +F    + + ++ + P    G      G  +  RD  +
Sbjct: 214 ERMVVAVAGNVDHDEVVAMVREHFG-PHLVRGRQPIAPRKGAGRVNGRPGLLLGTRDAEQ 272

Query: 236 EHMMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            H+ LG    G  +Q R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D
Sbjct: 273 THVSLGVRTPGRGWQHR--WALSVLHTALGGGLSSRLFQEIRELRGLAYSVYSTVDIFAD 330

Query: 294 NGVLYIASATAKEN---IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           +G L + +A   E    +MA+T  ++E V    + I + E       +   L+   E S 
Sbjct: 331 SGALSVYAACQPERFAEVMAVTGGVLESVAR--DGITESECRIAKGSLRGGLVLGLEDSG 388

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   + +  +  G     E  +  I  ++ +++  +A+++ +     A+LGP
Sbjct: 389 SRMSRLGRNELNYGRHRSIEHTLAQIDRVSVDEVNAIARRLLTQRYGAAVLGP 441


>gi|253701573|ref|YP_003022762.1| peptidase M16 domain protein [Geobacter sp. M21]
 gi|251776423|gb|ACT19004.1| peptidase M16 domain protein [Geobacter sp. M21]
          Length = 418

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 230/403 (57%), Gaps = 5/403 (1%)

Query: 5   ISKT--SSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           I KT  ++GI VITE +P  S+  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R++
Sbjct: 2   IKKTILNNGIRVITERIPYASSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTERRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++++ D+  +S+F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPKAVDLLTDIFLHSTFDPEEIEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D +   F +  WK   +G  ILG  E+++  + + II++  + Y +
Sbjct: 122 VVLQEINMMEDTPDDLIHDLFHQHFWKGHPLGMSILGDAESVTGLSRDSIIAYKEQMYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + V   G + H+   + +E Y +       + +  P VY     + ++DL + H+ LG
Sbjct: 182 DDVIVTAAGNLTHDKLTALLEEYLHSVPSGNGRTASTPPVYERRIELVEKDLEQIHVCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK GL YS+ ++  + +D G L + +
Sbjct: 242 LKGVQQSHPQRYDAFIMNAILGGSMSSRLFQEVREKSGLAYSVYSYIASHADAGSLVVYA 301

Query: 302 ATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             + EN   L   ++ E+ +   E +   ++D    ++   L+ S E S  R   ++K  
Sbjct: 302 GASPENQAELVEIMLREIGRFKREPVPAEQLDGAREQLKGNLLLSLESSDNRMSRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           ++ G+ L   +I++    +T E I  +A  I  +S  TL +LG
Sbjct: 362 IYFGTPLPLSEIMEGFDRVTAESIQTLAVDILDNSALTLVMLG 404


>gi|29829064|ref|NP_823698.1| protease [Streptomyces avermitilis MA-4680]
 gi|29606170|dbj|BAC70233.1| putative protease [Streptomyces avermitilis MA-4680]
          Length = 459

 Score =  234 bits (596), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 221/419 (52%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPTLNGATHYLEHLLFKGTHKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D+  ER
Sbjct: 94  ALDISSALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILEEDVNVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  +  D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK--------RD 232
              + V C G VDH   V QV + F      K  ++   A   G   I+         R 
Sbjct: 214 PTHLVVACAGNVDHNKVVRQVRAAFEKAGALKQPDATPIAPRDGRRAIRTAGRVELLGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+++ +      EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDHVAEHGLSDDEIARAIGQLKGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+ +T +D+  VA+ I    P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLARITEVTPDDVRSVARDILGQRPSLSVIGPLKD 448


>gi|254393065|ref|ZP_05008226.1| protease [Streptomyces clavuligerus ATCC 27064]
 gi|326443809|ref|ZP_08218543.1| M16 family endopeptidase [Streptomyces clavuligerus ATCC 27064]
 gi|197706713|gb|EDY52525.1| protease [Streptomyces clavuligerus ATCC 27064]
          Length = 459

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 134/419 (31%), Positives = 227/419 (54%), Gaps = 16/419 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPSLNGATHYLEHLLFKGTERRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILQEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T +++  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVRRFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-------NVCSVAKIKESMKPAVYVGG--EYIQKR 231
              + V   G VDH   V QV   F        V +V       + AV   G  E I +R
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFERAGALDRVDAVPLAPRDGQRAVRTAGRVELIDRR 273

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
              + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F
Sbjct: 274 -TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGF 332

Query: 292 SDNGVLYIASA---TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           +D G+  + +    +   +++ +    ++ V S    ++  EI +   ++    +   E 
Sbjct: 333 ADCGLFGVYAGCRPSQVHDVLKICRDELDRVAS--HGLDDDEIGRAIGQLSGSTVLGLED 390

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           +      I K  +  G+ +  + ++  I+A+T +++  VA ++    P+LA++GP  D 
Sbjct: 391 TGALMNRIGKSELCWGAQMSVDDMLTRIAAVTPDEVREVAAEVLGRRPSLAVIGPLKDR 449


>gi|159036979|ref|YP_001536232.1| peptidase M16 domain-containing protein [Salinispora arenicola
           CNS-205]
 gi|157915814|gb|ABV97241.1| peptidase M16 domain protein [Salinispora arenicola CNS-205]
          Length = 462

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/411 (31%), Positives = 224/411 (54%), Gaps = 10/411 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +   SG+ V+TE +P + S    + +  GSR+E   + G AHFLEH+LFKGT +R A
Sbjct: 44  VRRTVLPSGLRVLTETIPAMRSVSFGIWVSVGSRDETGPQSGAAHFLEHLLFKGTHRRAA 103

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S   P D+E ER 
Sbjct: 104 LEISSAIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTPDDVEIERG 163

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +D+  D +   F+  V+ +  +GR I G  +T++  T  +I SF  R+YT 
Sbjct: 164 VILEEIAMHDDEPGDEVHDLFARAVYGEHPLGRLISGTEQTVTPMTRRQIQSFYRRHYTP 223

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC------SVAKIKESMKPAVYV--GGEYIQKRDL 233
            R+ +   G +DH   V+ V             +      +  PAV        +  ++ 
Sbjct: 224 PRIVIAAAGNLDHASVVTMVRQALRGTPLDTDPATPAPHRAATPAVRTRPATTLVTPKET 283

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + H++LG  G  +     +   +L +ILG GMSSRLFQE+RE+RGL YS+ ++    +D
Sbjct: 284 EQAHVVLGCTGIDWHDDRRFALGVLNNILGGGMSSRLFQEIREQRGLAYSVYSYASQHAD 343

Query: 294 NGVLYIASATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           +G+  I +  A   +  +   I  E+ +  ++ + + E+ +         +   E S  R
Sbjct: 344 SGLFGIYAGCAPGRVNEVLDLIRAELTRVAVDGLTEAEVARGKGMSKGSFVLGLEDSGSR 403

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              ++K  +  G +L  + ++  + A+T +D+  +A ++ S + +LA++GP
Sbjct: 404 MSRLAKGELLYGDLLPVDALLARVDAVTVDDVNTLATELLSRSLSLAVVGP 454


>gi|302865981|ref|YP_003834618.1| peptidase M16 domain-containing protein [Micromonospora aurantiaca
           ATCC 27029]
 gi|302568840|gb|ADL45042.1| peptidase M16 domain protein [Micromonospora aurantiaca ATCC 27029]
          Length = 455

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 230/418 (55%), Gaps = 22/418 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P + S    + +  GSR+E   + G AHFLEH+LFKGT KR+
Sbjct: 34  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVAVGSRDETGSQAGAAHFLEHLLFKGTNKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI  +IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S    +D+E ER
Sbjct: 94  ALEISSQIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTAADVETER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  ET++  T  +I  F  R YT
Sbjct: 154 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTEETVTPMTRRQIQGFYRRRYT 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-------NVCSVAKIKES-----MKPAVYVGGEYI 228
           A ++ +   G +DH   V  V           +  S A  + +      KPA  +    +
Sbjct: 214 APQIVIAAAGNLDHAAVVKLVRQALRGTPLDTDPASPAPHRAATPTVRTKPATTL----V 269

Query: 229 QKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHH 288
           + ++  + H++LG  G        +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++ 
Sbjct: 270 EPKETEQAHVILGCPGIDRTDDRRFALGVLNNVLGGGMSSRLFQEIREQRGLAYSVYSYA 329

Query: 289 ENFSDNGV--LYIASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKS 345
             ++D+GV  +Y   A  K + ++ LT +  E+ +   E I + E+ +         +  
Sbjct: 330 SQYADSGVFAVYAGCAPGKVDEVLDLTRA--ELARVAAEGITEAELARGKGMSKGSFVLG 387

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            E +  R   ++K  +  G+++  + ++  + A+T +D+  +A  +     +LA++GP
Sbjct: 388 LEDTGSRMSRLAKGELLYGNLMPVDDLLARVDAVTLDDVNTLAADLLGRPMSLAVVGP 445


>gi|238063393|ref|ZP_04608102.1| peptidase M16 [Micromonospora sp. ATCC 39149]
 gi|237885204|gb|EEP74032.1| peptidase M16 [Micromonospora sp. ATCC 39149]
          Length = 456

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 133/418 (31%), Positives = 232/418 (55%), Gaps = 22/418 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P + S    + +  GSR+E   + G AHFLEH+LFKGT KRT
Sbjct: 37  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVSVGSRDETGPQAGAAHFLEHLLFKGTHKRT 96

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I  EIE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D +++S   P+D+E ER
Sbjct: 97  ALDISAEIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDAVADSLLEPADVETER 156

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  ET++  T  +I SF  R+YT
Sbjct: 157 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTEETVTPMTRRQIQSFYRRHYT 216

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSV------------AKIKESMKPAVYVGGEYI 228
           A ++ V   G +DH   V  V        +            A  +  ++PA  +    +
Sbjct: 217 APQIVVAAAGNLDHAVVVRLVRQALAGTPLDTDPAAPAPHRAATPRVRVRPATTL----V 272

Query: 229 QKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHH 288
           + ++  + H++LG  G        +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++ 
Sbjct: 273 EPKETEQAHVVLGCPGIDRVDERRFALGVLNNVLGGGMSSRLFQEIRERRGLAYSVYSYA 332

Query: 289 ENFSDNGV--LYIASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKS 345
             ++D+G+  +Y   A  K + ++ LT +  E+ +   + + + E+ +         +  
Sbjct: 333 SQYADSGMFAVYAGCAPGKVDEVLELTRA--ELRRVAADGLTEAEVARGKGMSKGSFVLG 390

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            E +  R   ++K  +  G ++  ++++  + A+T  D+  +A ++ +   +LA++GP
Sbjct: 391 LEDTGSRMSRLAKGELLYGDLMPVDELLARVDAVTVADVNTLAAELLAQPMSLAVVGP 448


>gi|307331544|ref|ZP_07610656.1| peptidase M16 domain protein [Streptomyces violaceusniger Tu 4113]
 gi|306882815|gb|EFN13889.1| peptidase M16 domain protein [Streptomyces violaceusniger Tu 4113]
          Length = 459

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 128/415 (30%), Positives = 223/415 (53%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E     G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPTLGGATHYLEHLLFKGTRRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I++VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S    +D++ ER
Sbjct: 94  ALDISAAIDEVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSVIGAADVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M+EDD  D +   F+  +  D  +GRP+LG  +T+++   ++I  F  ++Y 
Sbjct: 154 GVVLEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALGRDQIARFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH+  V QV + F+        +++  A   G   I+         R 
Sbjct: 214 PTHLVVAAAGNVDHDDVVRQVHAAFDGAGALSRTDALPVAPRSGIRAIRTAGKVGLLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 274 TEQAHVVLGMPGIPRTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  + EN +   E+ +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPNQVHDVLKICRDELTQVAENGLSDEELRRAVGQLAGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G  +  + +++ I+A+T +++  VA+ +    P+L+++GP  D
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLERIAAVTPDEVREVARDVLGQRPSLSVIGPLKD 448


>gi|315502541|ref|YP_004081428.1| peptidase m16 domain protein [Micromonospora sp. L5]
 gi|315409160|gb|ADU07277.1| peptidase M16 domain protein [Micromonospora sp. L5]
          Length = 444

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 230/418 (55%), Gaps = 22/418 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P + S    + +  GSR+E   + G AHFLEH+LFKGT KR+
Sbjct: 23  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVAVGSRDETGSQAGAAHFLEHLLFKGTNKRS 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI  +IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S    +D+E ER
Sbjct: 83  ALEISSQIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTAADVETER 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  ET++  T  +I  F  R YT
Sbjct: 143 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTEETVTPMTRRQIQGFYRRRYT 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-------NVCSVAKIKES-----MKPAVYVGGEYI 228
           A ++ +   G +DH   V  V           +  S A  + +      KPA  +    +
Sbjct: 203 APQIVIAAAGNLDHAAVVKLVRQALRGTPLDTDPASPAPHRAATPTVRTKPATTL----V 258

Query: 229 QKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHH 288
           + ++  + H++LG  G        +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++ 
Sbjct: 259 EPKETEQAHVILGCPGIDRTDDRRFALGVLNNVLGGGMSSRLFQEIREQRGLAYSVYSYA 318

Query: 289 ENFSDNGV--LYIASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKS 345
             ++D+GV  +Y   A  K + ++ LT +  E+ +   E I + E+ +         +  
Sbjct: 319 SQYADSGVFAVYAGCAPGKVDEVLDLTRA--ELARVAAEGITEAELARGKGMSKGSFVLG 376

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            E +  R   ++K  +  G+++  + ++  + A+T +D+  +A  +     +LA++GP
Sbjct: 377 LEDTGSRMSRLAKGELLYGNLMPVDDLLARVDAVTLDDVNTLAADLLGRPMSLAVVGP 434


>gi|302554540|ref|ZP_07306882.1| protease [Streptomyces viridochromogenes DSM 40736]
 gi|302472158|gb|EFL35251.1| protease [Streptomyces viridochromogenes DSM 40736]
          Length = 459

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 127/419 (30%), Positives = 224/419 (53%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTNRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILEEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-------IKESMKPAVYVGGEY-IQKRD 232
              + V C G VDH   V QV + F      +          S + A+   G   +  R 
Sbjct: 214 PTHLVVACAGNVDHAKVVRQVRAAFEKAGAFRDTGAEPVAPRSGRRALRTAGRVELIDRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G +      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHIVLGMPGLSRTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+++ +      EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----DDVLKICRDELDHVAEHGLSDDEIGRAIGQLQGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I ++T +D+  VA++I    P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLSRIVSVTPDDVRSVAREILGRRPSLSVIGPLKD 448


>gi|328885434|emb|CCA58673.1| peptidase, M16 family [Streptomyces venezuelae ATCC 10712]
          Length = 459

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 220/417 (52%), Gaps = 14/417 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E     G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPTLGGATHYLEHLLFKGTRKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML++S     D++ ER
Sbjct: 94  ALDISAAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTDSLILEEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T++  T  +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDVVHELFARTMFGDTPLGRPVLGTVDTVNGLTRGQIARFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         + +  A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKAGALGRTDGVPVAPRTGVRTLRAAGRVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARNDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAK---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G+  + +        +++ +    +  V S  + +   EI +   ++    +   E +
Sbjct: 334 DCGLFGVYAGCRPGQVHDVLKICRDELHKVAS--DGLTDDEIARAVGQLSGSTVLGLEDT 391

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
                 I K  +  G+ +  + ++D I+A+T +++  VA+ +    P+L+++GP  D
Sbjct: 392 GALMNRIGKSELCWGTQMSVDDMLDRIAAVTPDEVREVARDVLEQRPSLSVIGPLKD 448


>gi|297156776|gb|ADI06488.1| putative protease [Streptomyces bingchenggensis BCW-1]
          Length = 441

 Score =  233 bits (593), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 222/419 (52%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 16  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPVLNGATHYLEHLLFKGTQRRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S  + +D+E ER
Sbjct: 76  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIDAADVEAER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M+EDD  D +   F+  +  D  +GRP+LG  +T++    ++I  F  ++Y 
Sbjct: 136 GVVLEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNGLGRDQIARFYKKHYD 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI--------QKRD 232
              + V   G VDH   V QV   F+        +++  A   G   I        Q R 
Sbjct: 196 PTHLVVAAAGNVDHAAVVRQVRKAFDKAGALSRTDAVPVAPRDGTRTIRAAGRVEVQGRK 255

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 256 TEQAHVVLGMPGIARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 315

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +           + ++++ +  L+++ Q      E+ +   ++    +   E
Sbjct: 316 DCGLFGVYAGCRPSQ----AADVLKICRDELDHVAQHGLTDEELRRAVGQLRGSTVLGLE 371

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  ++A+T +++  VA  +    P+L+++GP  D
Sbjct: 372 DTGALMNRIGKSELCWGDQMSVDDMLARMAAVTPDEVREVAHDVLGQRPSLSVIGPLKD 430


>gi|297182512|gb|ADI18674.1| predicted Zn-dependent peptidases [uncultured Acidobacteria
           bacterium HF4000_26D02]
          Length = 435

 Score =  233 bits (593), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 127/397 (31%), Positives = 214/397 (53%), Gaps = 3/397 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE MP + S      +  GSR+E     G+AHF+EHMLFKGT  R+A++I +EI
Sbjct: 25  NGLCLLTESMPDVRSVSFAAWLTRGSRHESATHSGIAHFIEHMLFKGTATRSAEDIAQEI 84

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG ++A+T+ E  SY+  VL EH+P A++++ D+L + +F+  DIERE+ VVLEEI 
Sbjct: 85  DSLGGQLDAFTAKECASYYVKVLDEHLPRAVDVLADLLLHPAFDAGDIEREKKVVLEEIK 144

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +   F++  W    +GRPILG PET++      +  +  R Y+A  + +  
Sbjct: 145 MVEDTPDDLVHELFTQRFWSGHPLGRPILGVPETVADLDRATLCEYFGRVYSAKNLVLAV 204

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VDH      V   F    +   +          G  ++ + L + H+ LG +G  +Q
Sbjct: 205 AGHVDHAAVRDLVAETFGALPLNGDQIETSAPRAKPGLALRNKPLEQCHICLGVSGYPHQ 264

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y+  +L  +LG  MSSRLFQ +REKRGL Y++S+   ++ D G + I +    + +
Sbjct: 265 HDDRYVCYVLNVVLGGSMSSRLFQNIREKRGLAYAVSSGLVSYRDGGAVTIYAGCDTDAV 324

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   +V  +Q L +  I   E+ +    +   L+   E +  R   +++Q ++ G   
Sbjct: 325 REVIDLVVAELQDLRDRPIASEELQRAKDHLRGSLVLGLESTSSRMSHMARQEIYFGRQF 384

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLA-ILGP 403
             ++ +  +  +T +D+  VA+ +F      A +LGP
Sbjct: 385 TLDETLQGVERVTSDDVQRVARDLFPPGGLAATVLGP 421


>gi|158320568|ref|YP_001513075.1| peptidase M16 domain-containing protein [Alkaliphilus oremlandii
           OhILAs]
 gi|158140767|gb|ABW19079.1| peptidase M16 domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 412

 Score =  232 bits (591), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 127/387 (32%), Positives = 221/387 (57%), Gaps = 3/387 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+TE +P + S  + V I AG++NE    +G++HF+EHMLFKGT KR+AK+I E I
Sbjct: 9   NGLRVVTEHIPYVKSISIGVWIEAGAQNESSLNNGISHFIEHMLFKGTEKRSAKDIAEVI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E T Y+  VL  H  LAL+++ DM+ +S F+P++IE+ER+V+LEEI 
Sbjct: 69  DSIGGQMNAFTSKECTCYYTKVLDSHYNLALDVLADMVFHSKFDPTEIEKERSVILEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+ ++K+  +G PILG  ET+++ T E I+ ++   Y ++   +  
Sbjct: 129 MYEDSPEDLVHDIASQTLFKNDPLGMPILGTKETLNNITREMILDYIKEYYVSNNAVLSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSV-AKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G  +    + +++  F + +   ++K+  KPA +      + +D+ + H+ + F G   
Sbjct: 189 AGNFNETTLLEEIQRQFGIWTPNNQLKKVKKPADFNFENIYKNKDIEQTHICMAFKGFEL 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
            + + Y   +L +ILG  MSSRLFQ +RE+RGL YSI ++   + + G L I +      
Sbjct: 249 DNENTYPLLVLNNILGGSMSSRLFQSIREERGLAYSIYSYPSVYKNGGNLVIYAGANPNQ 308

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  +   + E +  ++ N I   E++K   ++    I   E +  R   I K  +    I
Sbjct: 309 VEEIIRIVREEINEIVTNSISDEELNKSKEQLKGNYILGLESTSGRMTSIGKSELLLNRI 368

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFS 393
              ++I+D I ++   DI  + +K+F+
Sbjct: 369 YSPKEILDKIESVKSADIERIIQKVFN 395


>gi|15609919|ref|NP_217298.1| zinc protease PEPR [Mycobacterium tuberculosis H37Rv]
 gi|31793958|ref|NP_856451.1| zinc protease PEPR [Mycobacterium bovis AF2122/97]
 gi|121638662|ref|YP_978886.1| putative zinc protease pepR [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148662624|ref|YP_001284147.1| putative zinc protease PepR [Mycobacterium tuberculosis H37Ra]
 gi|148823970|ref|YP_001288724.1| zinc protease pepR [Mycobacterium tuberculosis F11]
 gi|167968612|ref|ZP_02550889.1| zinc protease pepR [Mycobacterium tuberculosis H37Ra]
 gi|215404752|ref|ZP_03416933.1| zinc protease pepR [Mycobacterium tuberculosis 02_1987]
 gi|215412595|ref|ZP_03421323.1| zinc protease pepR [Mycobacterium tuberculosis 94_M4241A]
 gi|215428214|ref|ZP_03426133.1| zinc protease pepR [Mycobacterium tuberculosis T92]
 gi|215431722|ref|ZP_03429641.1| zinc protease pepR [Mycobacterium tuberculosis EAS054]
 gi|215447034|ref|ZP_03433786.1| zinc protease pepR [Mycobacterium tuberculosis T85]
 gi|224991154|ref|YP_002645843.1| putative zinc protease [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253798134|ref|YP_003031135.1| zinc protease pepR [Mycobacterium tuberculosis KZN 1435]
 gi|254365433|ref|ZP_04981478.1| zinc protease pepR [Mycobacterium tuberculosis str. Haarlem]
 gi|260187799|ref|ZP_05765273.1| zinc protease pepR [Mycobacterium tuberculosis CPHL_A]
 gi|260201910|ref|ZP_05769401.1| zinc protease pepR [Mycobacterium tuberculosis T46]
 gi|260206094|ref|ZP_05773585.1| zinc protease pepR [Mycobacterium tuberculosis K85]
 gi|289444327|ref|ZP_06434071.1| zinc protease pepR [Mycobacterium tuberculosis T46]
 gi|289448440|ref|ZP_06438184.1| zinc protease pepR [Mycobacterium tuberculosis CPHL_A]
 gi|289553431|ref|ZP_06442641.1| zinc protease pepR [Mycobacterium tuberculosis KZN 605]
 gi|289575480|ref|ZP_06455707.1| zinc protease pepR [Mycobacterium tuberculosis K85]
 gi|289746585|ref|ZP_06505963.1| zinc protease pepR [Mycobacterium tuberculosis 02_1987]
 gi|289751439|ref|ZP_06510817.1| zinc protease pepR [Mycobacterium tuberculosis T92]
 gi|289754888|ref|ZP_06514266.1| zinc protease pepR [Mycobacterium tuberculosis EAS054]
 gi|289758909|ref|ZP_06518287.1| zinc protease pepR [Mycobacterium tuberculosis T85]
 gi|294994125|ref|ZP_06799816.1| zinc protease pepR [Mycobacterium tuberculosis 210]
 gi|297635393|ref|ZP_06953173.1| zinc protease pepR [Mycobacterium tuberculosis KZN 4207]
 gi|297732391|ref|ZP_06961509.1| zinc protease pepR [Mycobacterium tuberculosis KZN R506]
 gi|298526248|ref|ZP_07013657.1| zinc protease pepR [Mycobacterium tuberculosis 94_M4241A]
 gi|306804545|ref|ZP_07441213.1| zinc protease pepR [Mycobacterium tuberculosis SUMu008]
 gi|306807415|ref|ZP_07444083.1| zinc protease pepR [Mycobacterium tuberculosis SUMu007]
 gi|307085478|ref|ZP_07494591.1| zinc protease pepR [Mycobacterium tuberculosis SUMu012]
 gi|313659723|ref|ZP_07816603.1| zinc protease pepR [Mycobacterium tuberculosis KZN V2475]
 gi|61250909|sp|P0A5S8|Y2782_MYCTU RecName: Full=Uncharacterized zinc protease Rv2782c/MT2852
 gi|61250911|sp|P0A5S9|Y2805_MYCBO RecName: Full=Uncharacterized zinc protease Mb2805c
 gi|2624304|emb|CAA15577.1| PROBABLE ZINC PROTEASE PEPR [Mycobacterium tuberculosis H37Rv]
 gi|31619552|emb|CAD94990.1| PROBABLE ZINC PROTEASE PEPR [Mycobacterium bovis AF2122/97]
 gi|121494310|emb|CAL72788.1| Probable zinc protease pepR [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|134150946|gb|EBA42991.1| zinc protease pepR [Mycobacterium tuberculosis str. Haarlem]
 gi|148506776|gb|ABQ74585.1| putative zinc protease PepR [Mycobacterium tuberculosis H37Ra]
 gi|148722497|gb|ABR07122.1| zinc protease pepR [Mycobacterium tuberculosis F11]
 gi|224774269|dbj|BAH27075.1| putative zinc protease [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319637|gb|ACT24240.1| zinc protease pepR [Mycobacterium tuberculosis KZN 1435]
 gi|289417246|gb|EFD14486.1| zinc protease pepR [Mycobacterium tuberculosis T46]
 gi|289421398|gb|EFD18599.1| zinc protease pepR [Mycobacterium tuberculosis CPHL_A]
 gi|289438063|gb|EFD20556.1| zinc protease pepR [Mycobacterium tuberculosis KZN 605]
 gi|289539911|gb|EFD44489.1| zinc protease pepR [Mycobacterium tuberculosis K85]
 gi|289687113|gb|EFD54601.1| zinc protease pepR [Mycobacterium tuberculosis 02_1987]
 gi|289692026|gb|EFD59455.1| zinc protease pepR [Mycobacterium tuberculosis T92]
 gi|289695475|gb|EFD62904.1| zinc protease pepR [Mycobacterium tuberculosis EAS054]
 gi|289714473|gb|EFD78485.1| zinc protease pepR [Mycobacterium tuberculosis T85]
 gi|298496042|gb|EFI31336.1| zinc protease pepR [Mycobacterium tuberculosis 94_M4241A]
 gi|308346146|gb|EFP34997.1| zinc protease pepR [Mycobacterium tuberculosis SUMu007]
 gi|308348875|gb|EFP37726.1| zinc protease pepR [Mycobacterium tuberculosis SUMu008]
 gi|308365002|gb|EFP53853.1| zinc protease pepR [Mycobacterium tuberculosis SUMu012]
 gi|326904397|gb|EGE51330.1| zinc protease pepR [Mycobacterium tuberculosis W-148]
 gi|328457907|gb|AEB03330.1| zinc protease pepR [Mycobacterium tuberculosis KZN 4207]
          Length = 438

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 140/415 (33%), Positives = 223/415 (53%), Gaps = 23/415 (5%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A 
Sbjct: 16  RRTTLPGGLRVVTEFLPAVHSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSAV 75

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I + ++ VGG++NA+T+ EHT Y+A VL   +PLA++++ D++ N      D+E ER+V
Sbjct: 76  DIAQAMDAVGGELNAFTAKEHTCYYAHVLGSDLPLAVDLVADVVLNGRCAADDVEVERDV 135

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F   ++ D  +GRP++G  +++S  T  ++ SF  R YT +
Sbjct: 136 VLEEIAMRDDDPEDALADMFLAALFGDHPVGRPVIGSAQSVSVMTRAQLQSFHLRRYTPE 195

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRDL 233
           RM V   G VDH+  V+ V  +F     +++    +P     G           +  RD 
Sbjct: 196 RMVVAAAGNVDHDGLVALVREHFG----SRLVRGRRPVAPRKGTGRVNGSPRLTLVSRDA 251

Query: 234 AEEHMMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
            + H+ LG    G  ++ R  +  ++L + LG G+SSRLFQEVRE RGL YS+ +  + F
Sbjct: 252 EQTHVSLGIRTPGRGWEHR--WALSVLHTALGGGLSSRLFQEVRETRGLAYSVYSALDLF 309

Query: 292 SDNGVLYIASATAKE---NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           +D+G L + +A   E   ++M +T+ ++E V    + I + E       +   L+   E 
Sbjct: 310 ADSGALSVYAACLPERFADVMRVTADVLESVAR--DGITEAECGIAKGSLRGGLVLGLED 367

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           S  R   + +  +  G     E  +  I  +T E++  VA+ + S     A+LGP
Sbjct: 368 SSSRMSRLGRSELNYGKHRSIEHTLRQIEQVTVEEVNAVARHLLSRRYGAAVLGP 422


>gi|288556934|ref|YP_003428869.1| processing protease [Bacillus pseudofirmus OF4]
 gi|288548094|gb|ADC51977.1| processing protease [Bacillus pseudofirmus OF4]
          Length = 413

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/403 (32%), Positives = 227/403 (56%), Gaps = 21/403 (5%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E +P + S  + V I  GSR E   E+G++HFLEHM FKGT KR+A +I E  
Sbjct: 9   NGVRIMAEAIPTVRSVSIGVWIGTGSRYEEVHENGISHFLEHMFFKGTKKRSAADIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +K+GG +NA+TS E+T Y+A VL EH P+A++++ DM  NS F   ++++ERNVVLEEI 
Sbjct: 69  DKIGGQVNAFTSKEYTCYYAKVLDEHAPIAVDVLSDMFFNSEFEAKELQKERNVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +D   D +    S+  + +  +G PILG  +T+ +F  + + S++ R YT D + +  
Sbjct: 129 MVDDTPDDIVHDLLSKAAYGEHSLGYPILGTQDTLKTFDEKALRSYMDRYYTGDHVVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY--------VGGEYI-QKRDLAEEHMM 239
            G +  E           + S+  I + +KP  Y           E I +K++  + H+ 
Sbjct: 189 AGNITDEV----------IQSIKDIFKEVKPTTYQYEASAPRFQSELITRKKETEQAHLC 238

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L + G    ++D Y   +L ++LG  MSSRLFQE+REKRGLCYS+ ++H ++ D+G+L +
Sbjct: 239 LAYPGLEIGNKDVYSLILLNNLLGGSMSSRLFQEIREKRGLCYSVFSYHSSYQDSGMLTV 298

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + TA E +  L  ++ +    L E  + ++E+     ++   L+ S E +  R     K
Sbjct: 299 YAGTALEQLDELVVALNQTTSRLCEAGMNEKELQNGKEQLKGSLMLSLESTNSRMSRNGK 358

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
             +        + I+  I+ +T E++  +A+ + S+ P ++++
Sbjct: 359 NELMLKRHRTLDDILAEINNVTLENVNRLAQTLLSTEPAISLI 401


>gi|116626241|ref|YP_828397.1| peptidase M16 domain-containing protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229403|gb|ABJ88112.1| peptidase M16 domain protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 428

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/406 (32%), Positives = 224/406 (55%), Gaps = 6/406 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++ ++  ++G+ VITE M  + S  V + I AGSR E  E++G++HF+EHMLFKGTT R+
Sbjct: 10  DIEMTTLANGVRVITEAMQHVRSVSVGIWIGAGSRRETTEQNGISHFIEHMLFKGTTTRS 69

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I   ++ +GG+++A+T+ E   ++  VL +H+  A E++ D++ N  F   DIE+E+
Sbjct: 70  AEDIARAVDALGGNLDAFTAKELVCFNTKVLDQHLSQAFEVLADLVLNPMFREEDIEKEK 129

Query: 121 NVVLEEIGMSEDDSWDFLDAR-FSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
            V+LEEI M E DS D+L    FS   WKD  +G+PILG P+++  F    I  F    Y
Sbjct: 130 GVILEEIKM-EADSPDYLVHEIFSSNFWKDHPLGKPILGTPQSVRRFDSTMIRDFYRSVY 188

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           +   M V   G + HE   + V+ YF ++         ++P+ +       K+ L + H+
Sbjct: 189 SPANMVVTAAGHMTHEGLTALVQQYFASLPPGPAAPPDLQPSTHARIALRNKKSLEQVHL 248

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            LG         + +   +L ++LG GMSSRLFQ +RE++GL Y++ +    + D G L 
Sbjct: 249 CLGVPSYPLPHEERFACYVLNTLLGGGMSSRLFQNIRERQGLAYAVFSELNPYRDTGCLS 308

Query: 299 IASATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T+ E+   +  SI  E  Q   + +   E+ +    +   L+   E +  R   ++
Sbjct: 309 IYAGTSAESARQVVESITTEFRQLKGDRVGDEELRRAKDHLKGSLMLGLESTASRMSNLA 368

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILG 402
           +Q M+ G     ++++++I A+T ED+  +A+  F S    L ILG
Sbjct: 369 RQEMYFGRFFTLDELVESIEAVTAEDVRRIAQTFFDSRQIALTILG 414


>gi|218754523|ref|ZP_03533319.1| zinc protease pepR [Mycobacterium tuberculosis GM 1503]
 gi|254551841|ref|ZP_05142288.1| zinc protease pepR [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|289762954|ref|ZP_06522332.1| zinc protease pepR [Mycobacterium tuberculosis GM 1503]
 gi|289710460|gb|EFD74476.1| zinc protease pepR [Mycobacterium tuberculosis GM 1503]
          Length = 438

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 141/411 (34%), Positives = 223/411 (54%), Gaps = 15/411 (3%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A 
Sbjct: 16  RRTTLPGGLRVVTEFLPAVHSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSAV 75

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I + ++ VGG++NA+T+ EHT Y+A VL   +PLA++++ D++ N      D+E ER+V
Sbjct: 76  DIAQAMDAVGGELNAFTAKEHTCYYAHVLGSDLPLAVDLVADVVLNGRCAADDVEVERDV 135

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F   ++ D  +GRP++G  +++S  T  ++ SF  R YT +
Sbjct: 136 VLEEIAMRDDDPEDALADMFLAALFGDHPVGRPVIGSAQSVSVMTRAQLQSFHLRRYTPE 195

Query: 183 RMYVVCVGAVDHEFCVSQVESYFN--VCSVAKIKESMKPAVYVGGE---YIQKRDLAEEH 237
           RM V   G VDH+  V+ V  +F   +    ++    K    V G     +  RD  + H
Sbjct: 196 RMVVAAAGNVDHDGLVALVREHFGSRLVRGRRLVAPRKGTGRVNGSPRLTLVSRDAEQTH 255

Query: 238 MMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
           + LG    G  ++ R  +  ++L + LG G+SSRLFQEVRE RGL YS+ +  + F+D+G
Sbjct: 256 VSLGIRTPGRGWEHR--WALSVLHTALGGGLSSRLFQEVRETRGLAYSVYSALDLFADSG 313

Query: 296 VLYIASATAKE---NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
            L + +A   E   ++M +T+ ++E V    + I + E       +   L+   E S  R
Sbjct: 314 ALSVYAACLPERFADVMRVTADVLESVAR--DGITEAECGIAKGSLRGGLVLGLEDSSSR 371

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              + +  +  G     E  +  I  +T E++  VA+ + S     A+LGP
Sbjct: 372 MSRLGRSELNYGKHRSIEHTLRQIEQVTVEEVNAVARHLLSRRYGAAVLGP 422


>gi|58584481|ref|YP_198054.1| Zn-dependent peptidase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58418797|gb|AAW70812.1| Zn-dependent peptidase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 421

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 234/413 (56%), Gaps = 10/413 (2%)

Query: 5   ISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++K  +G+ +ITE M  IDS  + + +  GSR E   ++G++HFLEHM FKGT  RTA E
Sbjct: 4   VTKLDNGLRIITEQMRDIDSVALNIRVGVGSRAESANQNGISHFLEHMAFKGTKTRTAFE 63

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I +  + +GG  NA T  E TSY+A VLK+ V + ++I+ D+L NS+F   ++ERE+ VV
Sbjct: 64  IAKTFDDIGGVFNASTGRERTSYYAKVLKKDVKIGIDILIDILMNSTFPKDELEREKGVV 123

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           ++EI    D   D +  ++ E  +KDQ  GR ILG  +T+ SF    + ++++ +Y  + 
Sbjct: 124 IQEIFQINDSPSDIIFDKYFEAAYKDQPFGRSILGTQDTVKSFAQGDLNNYINEHYFGEN 183

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           +     G V+HE      + + +  S  K+KES + A   GGEY++ R L + H+++GF 
Sbjct: 184 IIFAVAGNVEHEEIAQLTKDFLSKVSSQKLKES-QNANCTGGEYLEHRKLDQVHLLIGFP 242

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
             +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + +++D G+L I + T
Sbjct: 243 SVSCHDDRYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTDTGMLSIFAGT 302

Query: 304 AKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
              N+  L  SI   ++ L  N + + E+++   +I ++++ S+E     A  +      
Sbjct: 303 DSSNLDKLLKSITTELKKLSTNDLREEEVNRVKERIKSQILMSRESVSSCAEALEHYYGN 362

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILG-----PPMDHV 408
               +  +++I+  SA+T  D+    +++ S     TLA +G     P  D V
Sbjct: 363 YNRYISKDELIEKTSAVTTADVKRAVEELLSKHEKTTLAAIGEIKSLPGYDKV 415


>gi|326776209|ref|ZP_08235474.1| processing peptidase [Streptomyces cf. griseus XylebKG-1]
 gi|326656542|gb|EGE41388.1| processing peptidase [Streptomyces cf. griseus XylebKG-1]
          Length = 459

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 223/419 (53%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPTLNGATHYLEHLLFKGTAQRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-NVCSVAKI-------KESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F  V ++++        +E  +     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKVGALSRTDAVPMAPREGSRTLRAAGKVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENI-----EQREIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+ +     +  EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDRVATHGLDDDEITRAIGQLSGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+ +T +D+  VA ++ +  P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLARIAEVTPDDVRQVAGELLTRRPSLSVIGPLKD 448


>gi|290957008|ref|YP_003488190.1| M16 family endopeptidase [Streptomyces scabiei 87.22]
 gi|260646534|emb|CBG69631.1| putative M16 family endopeptidase [Streptomyces scabiei 87.22]
          Length = 459

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 224/419 (53%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTGRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++ + DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDTVCDMLTGSLIREEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRIRRFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK--------RD 232
              + V C G VDH   V QV + F         ++   A   G   ++         R 
Sbjct: 214 PTHLVVACAGNVDHNKVVRQVRAAFESAGALTRADATPIAPRDGRRALRTAGRVELVGRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+ + +      EI++   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDQVAEHGLPDDEIERAIGQLRGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  ++++  ++A+T +++  VA+++    P+L+++GP  D
Sbjct: 390 DTGAIMNRIGKSELCWGEQMSVDEMLARMAAVTPDEVREVAREVLGRRPSLSVIGPLKD 448


>gi|182435575|ref|YP_001823294.1| putative protease [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|178464091|dbj|BAG18611.1| putative protease [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 459

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 220/419 (52%), Gaps = 18/419 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPTLNGATHYLEHLLFKGTAQRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         +++  A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKAGALSRTDAVPMAPREGSRTLRAAGKVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENI-----EQREIDKECAKIHAKLIKSQE 347
           D G+  + +      +      ++++ +  L+ +     +  EI +   ++    +   E
Sbjct: 334 DCGLFGVYAGCRPSQV----HDVLKICRDELDRVATHGLDDDEITRAIGQLSGSTVLGLE 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +      I K  +  G  +  + ++  I+ +T +D+  VA ++ +  P+L+++GP  D
Sbjct: 390 DTGALMNRIGKSELCWGEQMSVDDMLARIAEVTPDDVRQVAGELLTRRPSLSVIGPLKD 448


>gi|312139342|ref|YP_004006678.1| metallopeptidase [Rhodococcus equi 103S]
 gi|325672778|ref|ZP_08152474.1| M16 family peptidase [Rhodococcus equi ATCC 33707]
 gi|311888681|emb|CBH47993.1| putative metallopeptidase [Rhodococcus equi 103S]
 gi|325556655|gb|EGD26321.1| M16 family peptidase [Rhodococcus equi ATCC 33707]
          Length = 446

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 138/409 (33%), Positives = 218/409 (53%), Gaps = 23/409 (5%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + SA V V +  GSR+E+    G AHFLEH+LFK T  RTA +I + +
Sbjct: 30  GGLRVVTEHVPGVRSASVGVWVGVGSRDEQPSVAGAAHFLEHLLFKSTPTRTALDIAQVM 89

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+TS EHT ++A VL + +PLA++++ D++        D++ ER VVLEEI 
Sbjct: 90  DGVGGELNAFTSKEHTCFYAHVLDDDLPLAVDLVSDVVLRGRCRAVDVDVERQVVLEEIS 149

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   ++ D  +GRP++G  ++I S T  ++ SF  R YT +RM V  
Sbjct: 150 MRDDDPEDLLGDAFLTALFGDHPVGRPVIGSVDSIESMTRSQLHSFHVRRYTPERMVVAV 209

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRDLAEEHMM 239
            G V+HE  V  V + F+      +   + PA   GG           + KRD  + H+ 
Sbjct: 210 AGNVEHEHTVELVRAAFS----GHLDRDVDPAPRRGGAIRLRTAPTLSLTKRDSEQAHLA 265

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG           +  ++L + +G G+SSRLFQE+RE+RGL YS+ +  + F+D G   +
Sbjct: 266 LGVRAFGRHEGHRWPLSVLNAAVGGGLSSRLFQEIREERGLAYSVYSGVDTFADTGAFSV 325

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREI-DKECAK----IHAKLIKSQERSYLRAL 354
            +    EN+  + + I EV    L N+    I D ECA+    +   L+   E S  R  
Sbjct: 326 YAGCQPENLGEVATLIREV----LANVASDGITDAECARAKGSLRGSLVLGLEDSGSRMT 381

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            I +  +  G+     + +  I  +T +++  VA+ +       A++GP
Sbjct: 382 RIGRSELNYGNHQSVSETLARIDEVTTDEVREVARVLLRRPFAAAVVGP 430


>gi|291009327|ref|ZP_06567300.1| putative zinc protease [Saccharopolyspora erythraea NRRL 2338]
          Length = 419

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 222/412 (53%), Gaps = 15/412 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P   SA + + +  GSR+E +++ G AH+LEH+LFKGT KRTA
Sbjct: 1   MRRTVLPGGLRVVTEQVPGARSASMGIWVGVGSRDESRQQAGAAHYLEHLLFKGTAKRTA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I +EI+ VGG++NA+TS EHT Y+A VL E +PLA++++ D++ ++    +D++ ER+
Sbjct: 61  VQIAQEIDAVGGELNAFTSKEHTCYYAHVLDEDLPLAVDMLCDVVFDAVNAKADVDVERS 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F+E V  D  +GR +LG  E+I S +  ++  F   +Y  
Sbjct: 121 VVLEEIAMRDDDPEDLLHETFTEAVLGDHPLGRSVLGTEESIESMSRARVHGFYRSSYQL 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRD 232
            RM V   G ++H    ++V          ++     PA    G           + + D
Sbjct: 181 PRMVVAVAGNIEH----ARVLRLLRKAIGDRLDGDSAPAPPRSGRARLPRQRPLVLHEDD 236

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L + LG GMSSRLFQE+REKRGL YS+ +    ++
Sbjct: 237 TEQAHLLLGCRGIDRHDERRFALGVLNAALGGGMSSRLFQEIREKRGLAYSVYSSTTAYA 296

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +    + +  + + +  V+  +  + + + E+ +   ++   L+   E +  
Sbjct: 297 DTGTFSVYAGCTPDRLGEVAAVVRGVLAGVAADGLTEDEVARGRGQLRGGLVLGLEDTAS 356

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   I K  +  G  L   + ++ I A+T +D+  +A ++     T A++GP
Sbjct: 357 RMTRIGKSELNYGRHLSVAQTLERIDAVTAQDVAELAAELLQRPLTTAVVGP 408


>gi|111225111|ref|YP_715905.1| putative zinc protease [Frankia alni ACN14a]
 gi|111152643|emb|CAJ64384.1| putative zinc protease [Frankia alni ACN14a]
          Length = 470

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 135/416 (32%), Positives = 216/416 (51%), Gaps = 15/416 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ VITE +P + SA + V +  GSR+E     G +H+LEH+LFKGT  R A
Sbjct: 51  VRRTVLPGGLRVITERVPGVRSAAIGVWVGVGSRDETPVTAGCSHYLEHLLFKGTPTRDA 110

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I   +E VGGD+NA+T  E+T Y+A VL   + +A+ ++ DM++NS     D+E ER 
Sbjct: 111 LTISASVEAVGGDLNAFTGKEYTCYYARVLDSDLAMAVGVVADMVTNSLVTADDVEAERG 170

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M EDD  D +   F+E +     +GRP+LG  E+I     E I  +    Y  
Sbjct: 171 VILEEIAMHEDDPGDVVHDVFAEAMLGASALGRPVLGTIESIEGLGRETIADYYRSRYVP 230

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKRD 232
             M V   G ++H+  ++ V   F       +  +  P+    G Y         + +R 
Sbjct: 231 PAMVVSVAGNLEHDRVLALVADAFG----DHLTSAGDPSAVRAGRYDYPPAPGIVVSERP 286

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + +++LG  G +      +   +L++ LG GMSSRLFQEVREKRGL YS+ +   +F+
Sbjct: 287 TEQANLVLGTVGVSRHDPRRFALGVLSTALGGGMSSRLFQEVREKRGLAYSVYSFASHFA 346

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +  A +    + +   + V+S+ E  I   E+D+   + H  L+   E +  
Sbjct: 347 DAGLFGVYAGCAPKRADEVLAIARDQVRSIAERGISAEELDRARGQSHGSLVLGLEDTGS 406

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           R   + K  +  G +L  ++II  + A+T +D+  VA  +      L ++GP  DH
Sbjct: 407 RMSRLGKSELVHGELLSVDEIIARVDAVTLDDVRQVAASLVEQPWALGVIGPFDDH 462


>gi|134102360|ref|YP_001108021.1| putative zinc protease [Saccharopolyspora erythraea NRRL 2338]
 gi|133914983|emb|CAM05096.1| putative zinc protease [Saccharopolyspora erythraea NRRL 2338]
          Length = 449

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 222/412 (53%), Gaps = 15/412 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P   SA + + +  GSR+E +++ G AH+LEH+LFKGT KRTA
Sbjct: 31  MRRTVLPGGLRVVTEQVPGARSASMGIWVGVGSRDESRQQAGAAHYLEHLLFKGTAKRTA 90

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I +EI+ VGG++NA+TS EHT Y+A VL E +PLA++++ D++ ++    +D++ ER+
Sbjct: 91  VQIAQEIDAVGGELNAFTSKEHTCYYAHVLDEDLPLAVDMLCDVVFDAVNAKADVDVERS 150

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F+E V  D  +GR +LG  E+I S +  ++  F   +Y  
Sbjct: 151 VVLEEIAMRDDDPEDLLHETFTEAVLGDHPLGRSVLGTEESIESMSRARVHGFYRSSYQL 210

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRD 232
            RM V   G ++H    ++V          ++     PA    G           + + D
Sbjct: 211 PRMVVAVAGNIEH----ARVLRLLRKAIGDRLDGDSAPAPPRSGRARLPRQRPLVLHEDD 266

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L + LG GMSSRLFQE+REKRGL YS+ +    ++
Sbjct: 267 TEQAHLLLGCRGIDRHDERRFALGVLNAALGGGMSSRLFQEIREKRGLAYSVYSSTTAYA 326

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +    + +  + + +  V+  +  + + + E+ +   ++   L+   E +  
Sbjct: 327 DTGTFSVYAGCTPDRLGEVAAVVRGVLAGVAADGLTEDEVARGRGQLRGGLVLGLEDTAS 386

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   I K  +  G  L   + ++ I A+T +D+  +A ++     T A++GP
Sbjct: 387 RMTRIGKSELNYGRHLSVAQTLERIDAVTAQDVAELAAELLQRPLTTAVVGP 438


>gi|291523668|emb|CBK81961.1| Predicted Zn-dependent peptidases [Coprococcus catus GD/7]
          Length = 432

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 127/403 (31%), Positives = 228/403 (56%), Gaps = 9/403 (2%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ V  E MP   S  + V ++AGS NE ++ +GMAH +EHMLFKGT KRTA+E+ + 
Sbjct: 8   SNGLKVAMEYMPQYRSVSMGVWVKAGSVNENKQTNGMAHVIEHMLFKGTEKRTARELADA 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           + ++GG+++AYT+ E+T ++   L EH+  A++I+GDMLSNS  + +D+++E  V+ EEI
Sbjct: 68  MTEIGGNMDAYTTKEYTCFYTKTLYEHLFYAIDILGDMLSNSKIDENDLKKELGVIAEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M +D   D +  R  E++W++  +G  I G  +T+  F  + ++ F+ + YTADRM + 
Sbjct: 128 DMYDDSPEDIVHERLQEVIWREHSLGYLISGDKQTVLGFKRQDVLDFMKQYYTADRMTIA 187

Query: 188 CVGAVDHEFCVSQVESYFN------VCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             G  +    +  +E+ F         S+ +    +  A Y    Y+Q +D+ + HM++ 
Sbjct: 188 ISGYFEEAKVLEALENCFGGIAPGCKASLLEANAQIATAKYYPSLYMQHKDVEQVHMIIA 247

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F    Y   + Y+ +++ S+LG  ++SRLFQ +RE+ GL Y+I ++  ++   G+ +I +
Sbjct: 248 FESLDYYDPERYILSVVNSLLGGNVNSRLFQTIREEMGLSYAIYSYGSSYEKGGLFHIYA 307

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           A     +  +  ++V+++Q L  E +  RE+      +   LI S E +Y R     K  
Sbjct: 308 AVHPNQVRPVLKAVVDIIQKLKNELVSDRELYIVKESVKTDLIISDESTYNRISNYGKSY 367

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           +   +I   E+  + I  +T E++    +K F  S  +L+++G
Sbjct: 368 IHGETIETVEEAAEKIGKVTAEEVRAFVQKHFDLSQMSLSLVG 410


>gi|326202155|ref|ZP_08192025.1| processing peptidase [Clostridium papyrosolvens DSM 2782]
 gi|325987950|gb|EGD48776.1| processing peptidase [Clostridium papyrosolvens DSM 2782]
          Length = 411

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/391 (33%), Positives = 209/391 (53%), Gaps = 11/391 (2%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ ++ E +P + S  V + +  GSRNE  E +G++HF+EHMLFKGTTKR+AK+I E 
Sbjct: 8   SNGLRLVYEKIPYVRSVSVGIWVGTGSRNETSENNGISHFIEHMLFKGTTKRSAKDIAEC 67

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           I+ +GG INA+T  E T Y+   L  H+ +A++++ DM  NSSF   DI  E+ VV+EEI
Sbjct: 68  IDAIGGQINAFTGKECTCYYTKTLDTHLDIAVDVLADMFFNSSFAGDDINVEKRVVIEEI 127

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
           GM ED   + +   FSEMVW    +G PILG    I+ F  + I+ +++  YT     + 
Sbjct: 128 GMYEDTPEELVHDIFSEMVWDGNPLGYPILGTEMCINKFDKDMILKYMNEFYTPYNTVIS 187

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
             G  D    +  V  YF      K       PA Y   + ++++D  + H+ +GF G  
Sbjct: 188 VAGNFDEAKLIELVNQYFQDWKFGKTFSNKFSPAQYKVNKIVREKDTEQVHLCMGFEGVE 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
           + +   Y    L +ILG GMSSRLFQ +REKRGL YSI ++   +  +G+  I +    E
Sbjct: 248 HGNEKLYSLLSLNNILGGGMSSRLFQTIREKRGLVYSIYSYPSTYQGSGLFVIYAGMNPE 307

Query: 307 NIMALTSSIVEVVQSLLEN-----IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            +     +++++ +S L N     I + E+ K   ++    I   E +  R   I K  +
Sbjct: 308 YL----QTVIDLTKSELNNIIKDGITKDELSKTKEQLKGNYILGLESTSSRMNSIGKSEL 363

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             G I   E+++  I  +  + +  + K++ 
Sbjct: 364 MLGKINTPEEVLQKIDRVNMDSVDEMIKRVL 394


>gi|288921718|ref|ZP_06415985.1| peptidase M16 domain protein [Frankia sp. EUN1f]
 gi|288346890|gb|EFC81200.1| peptidase M16 domain protein [Frankia sp. EUN1f]
          Length = 467

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/413 (31%), Positives = 215/413 (52%), Gaps = 7/413 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ VITE +P + S  + V +  GSR+E     G +H+LEH+LFKGT  R 
Sbjct: 47  TVRRTVLPGGLRVITEKVPGVRSVAIGVWVGVGSRDETPLTGGCSHYLEHLLFKGTPSRD 106

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I   IE VGGD+NA+T+ E+T Y+A VL   + LA++++ DM++NS     D+E ER
Sbjct: 107 ALSISAAIEAVGGDLNAFTAKEYTCYYARVLDSDLDLAVDVVCDMVANSLVTADDVEAER 166

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M EDD  D +   F++ V    ++GRP+LG  +TI +   E I  +    Y 
Sbjct: 167 GVILEEIAMHEDDPGDVVHDVFADAVLGSSVLGRPVLGTVDTIQALGRETIFDYYRERYA 226

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAE 235
              + +   G ++H+  + +V   F            ++    P     G  + +R   +
Sbjct: 227 PPALVISIAGNLEHDQALDRVVRAFADHLGGPARPQDVRRGEYPFPPPPGIVVDRRPTEQ 286

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H++LG  G +      Y   +L++ LG GMSSRLFQEVREKRGL YS+ +    F+D G
Sbjct: 287 AHVVLGTVGLSRHDPRRYALGVLSTALGGGMSSRLFQEVREKRGLAYSVYSFDNQFADAG 346

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRAL 354
           +  + +         +     E VQ + E+ I Q E+D+   +    L+ + E +  R  
Sbjct: 347 LFGVYAGCTPGRADNVLEICREQVQQIAEHGITQEELDRARGQNRGGLVLNLEDTGSRMS 406

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
            + K  +  G +L  ++++  + A+T +D+  +A ++      L ++GP  DH
Sbjct: 407 RLGKSELVHGELLSVDEVLARVEAVTLDDVRALAGELVDQPWALGVIGPFDDH 459


>gi|291302561|ref|YP_003513839.1| peptidase M16 domain-containing protein [Stackebrandtia nassauensis
           DSM 44728]
 gi|290571781|gb|ADD44746.1| peptidase M16 domain protein [Stackebrandtia nassauensis DSM 44728]
          Length = 438

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 224/415 (53%), Gaps = 17/415 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E Q+  G +HFLEH+LFKGT +R+
Sbjct: 17  TVRRTVLPGGLRVLTESIPAMRSASVGVWVGIGSRDESQQLSGASHFLEHLLFKGTNRRS 76

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I  +IE VGG+ NAYT+ E T Y+A VL E VPLA++++ D++++S  +  D+E ER
Sbjct: 77  ALDISAQIEAVGGETNAYTAKEFTCYYARVLDEDVPLAIDVLADVITDSKLDADDVETER 136

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M  D+  D +   F+ +++ D  +   I G P +I +   ++I  F  R YT
Sbjct: 137 GVILEEIAMQRDEPGDEVHDIFAALMFGDHPLAHDISGTPASIEAMDRDQIHRFYKRRYT 196

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNV------CSVAKIKE---SMKPAVYVGGEYIQKR 231
           A  M V   G VDHE  V+ V+  F           A +++   ++ PA       +  R
Sbjct: 197 APHMVVAAAGNVDHEQVVTLVQKGFAPLLSDVDAEPAPLRDETATVPPAPTR--LRVATR 254

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
           D  + H++LG +G A +    +   +L  ILG GMSSRLF  +RE  GL YS+ +    +
Sbjct: 255 DSEQAHLVLGCHGLARRDERRFAFEVLGGILGGGMSSRLFHRIREDEGLAYSVFSSTSEY 314

Query: 292 SDNGVLYIASATAKEN---IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           ++ G+  + +    +N   ++ LT+ ++  + +  + +   E+ +    +   L+   E 
Sbjct: 315 AETGLFSVYAGCTPDNAHRVLELTNEVLAEIAA--DGVTASELKRGKGMVKGGLVLGMED 372

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  R   + +  +  G  L  ++I+  + A+T  D+  +A  + S   +LA+ GP
Sbjct: 373 TGSRMARLGRGELLFGDKLTVDEILAKVDAVTLADVAELAAVVLSRPRSLAVAGP 427


>gi|296330886|ref|ZP_06873361.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674404|ref|YP_003866076.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296151891|gb|EFG92765.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412648|gb|ADM37767.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 409

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 129/396 (32%), Positives = 226/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ R+A+EI E  
Sbjct: 9   NGVRVVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+ +++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET++SF  + +  ++   YT DR+ +  
Sbjct: 129 MYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +   F +  VE +F           ++   +   +  +K++  + H+ LGF G    
Sbjct: 189 AGNISDSF-IKDVEKWFGSYEAKGKATGLEKPEFYTEKLTRKKETEQAHLCLGFKGLQVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I   T    +
Sbjct: 248 HERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTGANQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E + +L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 QQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNELLLGKHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ ++A+  E + G+A+++F+    LA++ P
Sbjct: 368 TLDEIINELNAVNLERVNGLARQLFTDDYALALISP 403


>gi|304404301|ref|ZP_07385963.1| peptidase M16 domain protein [Paenibacillus curdlanolyticus YK9]
 gi|304347279|gb|EFM13111.1| peptidase M16 domain protein [Paenibacillus curdlanolyticus YK9]
          Length = 421

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 119/396 (30%), Positives = 222/396 (56%), Gaps = 2/396 (0%)

Query: 9   SSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ V+ E +P   S    + ++ GSR+E ++++G++HF+EHMLFKGT + TAK+I + 
Sbjct: 7   SNGLRVVVEPIPTCRSVSFGIWVKTGSRHENEQDNGVSHFIEHMLFKGTERHTAKDIADL 66

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
            + +GG++NA+TS E+T Y A VL +H+P+A++ + DM   S F+  ++ +E+NV+LEEI
Sbjct: 67  FDGIGGNVNAFTSKEYTCYFAKVLDQHLPIAVDALADMFFESKFDADELAKEKNVILEEI 126

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M ED   D +    S   + D  +   ILG  + +++ T + + +++   Y  D + + 
Sbjct: 127 AMYEDTPDDKVHDEASRAAYGDHPLAYSILGLEDRLTAMTGDDLRTYMRNQYRIDNVVIS 186

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
             G ++ +  +  +E +F   +    +  +    + G     ++   + H+ L F GC+ 
Sbjct: 187 VAGNIEEQSLLVLLEQHFGAFANHGTEPVLSTPTFRGDYVFHQKQTEQNHICLSFPGCSI 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              + Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +F+D+G+  I + TA + 
Sbjct: 247 ADPNLYAMVLLNNALGGGMSSRLFQEIREKRGLAYSVYSYHTSFADSGLFTIYAGTAPKQ 306

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
              +    +E++  L  N +   E+ +   ++   LI S E +  R     K  +  G  
Sbjct: 307 TTEVLDITMELLGELAANGLTDAELHRGKEQLKGSLILSLESTSSRMNRNGKNELMLGRH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
              ++++D I  ++  DIV + K++ +   ++A++G
Sbjct: 367 YTLDEMLDRIDEVSMNDIVNMTKRMLNVPFSVAVVG 402


>gi|111023692|ref|YP_706664.1| metalloendopeptidase [Rhodococcus jostii RHA1]
 gi|110823222|gb|ABG98506.1| metalloendopeptidase [Rhodococcus jostii RHA1]
          Length = 514

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 142/417 (34%), Positives = 219/417 (52%), Gaps = 23/417 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E+    G AHFLEH+LFK T  R+
Sbjct: 90  GVRRTVLPGGLRVVTEYVPGVRSASVGVWVGVGSRDEQPTVAGAAHFLEHLLFKATPSRS 149

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+TS EHT ++A VL + +PLA++++ D++       +D++ ER
Sbjct: 150 ALDIAQVMDGVGGELNAFTSKEHTCFYAHVLDDDLPLAIDLVSDVVLRGRCRSADVDVER 209

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+I S T  ++ SF  R YT
Sbjct: 210 QVVLEEISMRDDDPEDLLGDAFLTALYGDHPVGRPVIGSVESIESMTRTQLHSFHVRRYT 269

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY---------IQKR 231
             RM V   G V+HE  V  V   F       +  + +PA    G           +  R
Sbjct: 270 PPRMVVAVAGNVEHEPTVELVRRAF----AGHLDSASEPAPRRAGTLRLRAEPTLSLTNR 325

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
           D  + H+ LG           +  ++L + +G G+SSRLFQEVRE RGL YS+ +  + F
Sbjct: 326 DSEQVHLSLGVRAFGRHESHRWALSVLNAAVGGGLSSRLFQEVREIRGLAYSVYSGIDTF 385

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKECAK----IHAKLIKSQ 346
           SD G   I +    EN+  +T+ I EV    L N+    I D ECA+    +   L+   
Sbjct: 386 SDTGAFSIYAGCQPENLGEVTTVIREV----LSNVAADGITDAECARAKGSLRGGLVLGL 441

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           E S  R   I +  +  G+     + +  I A+T +++  VA+ +       A++GP
Sbjct: 442 EDSGSRMHRIGRSELNYGNHRSITETLSKIDAVTTDEVRDVARVLLQRPFGAAVVGP 498


>gi|31789481|gb|AAP58594.1| putative protease [uncultured Acidobacteria bacterium]
          Length = 432

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 213/387 (55%), Gaps = 2/387 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           SG+ +ITE MP + S  + V +  G+R+E  E  G+AHF+EHMLFKGT  R+A++I + I
Sbjct: 22  SGLRLITEQMPHVRSVSIGVWLARGARHEPPEHGGIAHFVEHMLFKGTESRSAEDIAQAI 81

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG ++A+T+ E+  Y+  VL EH+P A+E++ D++ N +F+  DIE+E+ V+LEEI 
Sbjct: 82  DSIGGQMDAFTAKEYAGYYLKVLDEHLPFAVEVLSDIVMNPAFSDDDIEKEKKVILEEIK 141

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +   F+E  W D  +GRPILG  ET+ S   E +  +    Y+A  + V  
Sbjct: 142 MVEDTPDDLVHELFTENFWADHPLGRPILGTRETVESLAQENLRRYFGGAYSAPHLIVSA 201

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
           VG ++H   +  + + F       I    +P        ++ ++L + H+ LG +G    
Sbjct: 202 VGNIEHARVLQLIANAFERLPTTAIAIDGQPPRKTTSVLVRNKELEQSHVCLGTHGYQQD 261

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D + + +L ++LG  MSSRLFQ VREKRGL Y++ +    + D G L I +  A E +
Sbjct: 262 HEDRFASYVLNTVLGGSMSSRLFQNVREKRGLAYAVFSGLVAYRDTGSLTIYAGCANEAV 321

Query: 309 MALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L   +V E+ +  +E +   E+ +    +   L+   E +  R   +++Q ++     
Sbjct: 322 GELIDVVVAELRRMRIEPLSDAELTRARDHLKGSLMLGLESTSSRMSNLARQEIYFERQF 381

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSS 394
             ++ +  I  +T +D+  VA  + ++
Sbjct: 382 GLDETLAGIGRVTRDDVQRVAADLLAN 408


>gi|58700244|ref|ZP_00374724.1| peptidase, M16 family [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58533239|gb|EAL57758.1| peptidase, M16 family [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 306

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 186/301 (61%), Gaps = 2/301 (0%)

Query: 1   MNL-RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ R++K  +G+ +ITE V  IDS  + + +  GSR E  +++G++HFLEHM FKGT  
Sbjct: 1   MNVPRVTKLDNGLRIITEQVRDIDSVALSIRVGVGSRAESAKQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E T+Y+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGVFNASTGRESTTYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIVFDKYFEAAYKDQPFGRSILGTQDTVKSFTRGDLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + M     G V+HE  V+  + +F+     K+K+S     + GGEY++ R L + H+
Sbjct: 181 YFGENMLFAVAGNVEHEEVVALTKDFFSKIHSKKLKKSQNATSHTGGEYLEHRKLDQVHL 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + +++D G  +
Sbjct: 241 LIGLPSVSRHDDKYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTDTGCFH 300

Query: 299 I 299
            
Sbjct: 301 F 301


>gi|182417553|ref|ZP_02948879.1| peptidase M16 domain protein [Clostridium butyricum 5521]
 gi|237667797|ref|ZP_04527781.1| processing proteinase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182378566|gb|EDT76094.1| peptidase M16 domain protein [Clostridium butyricum 5521]
 gi|237656145|gb|EEP53701.1| processing proteinase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 435

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 142/389 (36%), Positives = 211/389 (54%), Gaps = 5/389 (1%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+TE +  ++S  V V ++ GSRNE  + +G++HF+EHM FKGT KRT+KE++EEI
Sbjct: 9   NGLRVVTEKIEHLNSISVGVMVQNGSRNESDDVNGISHFIEHMFFKGTEKRTSKEVMEEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+TS E T Y+   L  H+ L+L+I+ D+L N+ F+P +IE+E+ VV+EEI 
Sbjct: 69  ENVGGQINAFTSKEATCYYIKALNTHLDLSLDILSDILLNAKFDPDEIEKEKGVVVEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MS+D   D LD   S   + +  +G PILG  E + SFT EKII F+   YT     +  
Sbjct: 129 MSQDSPEDVLDDAHSRACFGNSSLGNPILGTAELVRSFTREKIIKFIKEKYTPYNSVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-YIQKRDLAEEHMMLGFNGCAY 247
            G  D       +E  F       + +     V +  +    K+++ + H+ LG  G  Y
Sbjct: 189 CGKFDDNELKDLIEKNFGEWKSEVVYKPTYGNVVINSDSKYAKKEIEQLHVSLGLEGLPY 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
                Y   IL +ILG G SS LFQ+VRE+ GLCYSI ++ + F   G + I +   K N
Sbjct: 249 GDEYNYPLVILNNILGGGASSILFQKVREELGLCYSIGSYLQPFQGVGTVNIYAGLNK-N 307

Query: 308 IMALTSSIVEVVQSLL--ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
                  +++   SL   + I  R+++    KI A  I   E +  R    +K  +F   
Sbjct: 308 YGEKALEVIDREVSLFAKDGITDRQLEINKEKIKANYILGLESTSSRMFANAKSYLFRNK 367

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSS 394
           +   E +I+TI  I  ED+  V  K F +
Sbjct: 368 VKTQEFVIETIDKINKEDVQYVLDKCFKN 396


>gi|118472683|ref|YP_886994.1| peptidase, M16 family protein [Mycobacterium smegmatis str. MC2
           155]
 gi|118173970|gb|ABK74866.1| peptidase, M16 family protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 434

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 140/414 (33%), Positives = 223/414 (53%), Gaps = 17/414 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RT
Sbjct: 10  QVRRTTLPGGLRVVTEYLPYVRSASVGVWVGVGSRDEGRSVAGAAHFLEHLLFKSTPTRT 69

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++        D+E ER
Sbjct: 70  AVDIAQTVDAVGGELNAFTAREHTCYYAHVLDSDLELAVDLVADVVLRGRCAAEDVEVER 129

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+IS  T  ++ SF  R YT
Sbjct: 130 DVVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVIGSIESISEMTRAQLHSFHVRRYT 189

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP---AVYVGGE---YIQKRDLA 234
            DRM +   G VDH+  V+    +F    + + ++++ P   +  V G     + +RD  
Sbjct: 190 PDRMVLAVAGNVDHDEVVALAREHFG-RRLVQGRDAVPPRKGSGRVPGRPSLRVVERDGE 248

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + H+ LG           +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + FSD+
Sbjct: 249 QTHVSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQEIRETRGLAYSVYSTVDTFSDS 308

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKEC----AKIHAKLIKSQERS 349
           G L I +    E        +V V   +LE + +  I + EC      +   L+   E S
Sbjct: 309 GALSIYAGCLPERF----EEVVRVTTDVLETVARDGISENECRIAKGSLRGGLVLGLEDS 364

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   I +  +  G     E+ +  I A+T +++  VA+++ +     A+LGP
Sbjct: 365 ASRMHRIGRAELNYGEHRSIEQTLAQIDAVTLDEVNAVARQLLTRDYGAAVLGP 418


>gi|317129154|ref|YP_004095436.1| peptidase M16 domain protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474102|gb|ADU30705.1| peptidase M16 domain protein [Bacillus cellulosilyticus DSM 2522]
          Length = 412

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 212/387 (54%), Gaps = 2/387 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I  GSR E ++++G++HFLEHM FKGT  RTA++I E  + +GG +NA+TS
Sbjct: 21  VRSVAIGIWIGTGSRFETKQQNGVSHFLEHMFFKGTKSRTAQQIAESFDSIGGHVNAFTS 80

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y++ VL  H   A++++ DM  NS F+ +++ +E+ VVLEEI M ED   D +  
Sbjct: 81  KEYTCYYSKVLDTHAKHAVDVLADMYFNSIFDTNELNKEKGVVLEEIKMYEDTPDDIVHD 140

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
             S+  + +  +G PILG  ET+S F+ E +I ++ + Y AD + +   G V+ +F V  
Sbjct: 141 LLSKASFGEHPLGYPILGTEETLSQFSAESLIEYMDQYYNADNVVISICGNVEEDF-VQY 199

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           V+  F+     K  +++    +      +K+D  + H+ +GF G    +   Y   +L +
Sbjct: 200 VQEVFSKMKKGKSNKTLNKPTFNSDRIARKKDTEQAHICIGFEGFPLNNEQIYSLILLNN 259

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
            LG  MSSRLFQEVREKRGL YS+ ++H  F D G++ + + T +  +  L   ++  V 
Sbjct: 260 TLGGSMSSRLFQEVREKRGLAYSVFSYHSAFHDTGMVTVYAGTGQNQLDELFEVLMNTVN 319

Query: 321 SL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAI 379
            +  E + ++E+     ++   L+   E +  R     K  +  G     + II +I  +
Sbjct: 320 IVKTEGMTEKELQNGKEQLKGSLMLGLESTNSRMSRNGKNELLLGRHRSLDDIIHSIDQV 379

Query: 380 TCEDIVGVAKKIFSSTPTLAILGPPMD 406
           T + I   + +IFS   +L ++ P  D
Sbjct: 380 TLDMIKETSDQIFSKDYSLTVISPKGD 406


>gi|240171317|ref|ZP_04749976.1| zinc protease PepR [Mycobacterium kansasii ATCC 12478]
          Length = 424

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 140/413 (33%), Positives = 225/413 (54%), Gaps = 17/413 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P + SA V + I  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 1   MRRTTLPGGLRVVTEYLPSVRSASVGLWIGVGSRDEGVTVAGAAHFLEHLLFKSTPTRTA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 61  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDADLALAMDLVSDVVLNGRCAADDVELERD 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ +  +GRP++G  +++S+ T  ++ SF  R YT 
Sbjct: 121 VVLEEIAMRDDDPEDALADLFLSALFGNHPVGRPVIGTVQSVSAMTRAQLQSFHLRRYTP 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAE 235
           +RM V   G VDH   V+ V  +F    + + +  + P    G      G  + +RD  +
Sbjct: 181 ERMVVAVAGNVDHGEVVALVREHFG-PRLVRGRRPVAPRKGAGRVNGMPGLTLAERDAEQ 239

Query: 236 EHMMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            H+ LG    G  +Q R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D
Sbjct: 240 THVSLGIRTPGRGWQHR--WALSVLHTALGGGLSSRLFQEIREARGLAYSVCSALDIFAD 297

Query: 294 NGVLYIASATAKEN---IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           +G L + +A   E    +M +T+ ++E V    + I + E       +   L+   E S 
Sbjct: 298 SGALSVYAACLPERFAEVMRVTADVLESVAR--DGITEAECRIAKGSLRGGLVLGLEDSS 355

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   I +  +  G     E  +  I  +T E++  VA+++  +    A+LGP
Sbjct: 356 SRMSRIGRSELNYGKHRSIEHTLQQIERVTVEEVNMVARRLLGNRYGAAVLGP 408


>gi|169630187|ref|YP_001703836.1| hypothetical protein MAB_3105c [Mycobacterium abscessus ATCC 19977]
 gi|169242154|emb|CAM63182.1| Hypothetical protease [Mycobacterium abscessus]
          Length = 411

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 137/395 (34%), Positives = 216/395 (54%), Gaps = 13/395 (3%)

Query: 19  MP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINA 77
           MP + SA V V +  GSR+E +   G AHFLEH+LFK T  R+A +I + I+ VGG++NA
Sbjct: 1   MPSVRSASVGVWVDVGSRDEGRSVAGAAHFLEHLLFKSTPTRSAADIAQSIDAVGGELNA 60

Query: 78  YTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDF 137
           +T+ E T Y+A VL   + LA++++ D++        D+E ER+VVLEEI M +DD  D 
Sbjct: 61  FTAREQTCYYAHVLDSDLELAIDLVADVVLRGRCASDDVEVERDVVLEEIAMRDDDPEDL 120

Query: 138 LDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFC 197
           L   F   ++ D  IGR +LG  E+IS+ T  ++ SF  R Y  +RM +   G ++H+  
Sbjct: 121 LGEAFLGALFGDHPIGRSVLGSSESISAMTRAQLHSFHVRRYRPERMVLAVAGNIEHDRV 180

Query: 198 VSQVESYF------NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN--GCAYQS 249
           V     YF      +V +VA  K S + A   G E +  RD  + H+ LG    G  +Q 
Sbjct: 181 VRLARKYFKSHLDSSVRTVAPRKGSGRVAAKPGLELVS-RDGEQVHLSLGVRTPGRGWQH 239

Query: 250 RDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIM 309
           R  +  ++L S LG G+SSRLFQE+RE+RGL Y++ +  + FSD G L + +  + E   
Sbjct: 240 R--WALSVLNSALGGGLSSRLFQEIREQRGLVYAVYSTVDTFSDTGALSVYAGCSPERFD 297

Query: 310 ALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILC 368
            +T    +V+ S++E+     EID+    +   L+   E S  R   + +  +  G    
Sbjct: 298 EVTKVTSQVLGSVVEDGFTPAEIDRAKGALSGGLVLGLEDSASRMNRLGRSELNNGKHRT 357

Query: 369 SEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               +D I A+T +++  +A+++       A++GP
Sbjct: 358 ISATLDRIDAVTADEVNAIARQLLGGPAGAAVVGP 392


>gi|299138879|ref|ZP_07032056.1| processing peptidase [Acidobacterium sp. MP5ACTX8]
 gi|298599033|gb|EFI55194.1| processing peptidase [Acidobacterium sp. MP5ACTX8]
          Length = 443

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 130/397 (32%), Positives = 221/397 (55%), Gaps = 6/397 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R +   +G+ V+TE MP   S  + V I +GSR+E  E +G+AHF+EHM+FKGTT R+
Sbjct: 22  DIRKTTLPNGLLVLTERMPHFRSVSMGVWIDSGSRDEAPEVNGIAHFIEHMVFKGTTTRS 81

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+++  E++ +GG+++A+T  E   ++  VL E+VP AL+++ D++ + +F P D+ RE+
Sbjct: 82  AQQLAREVDSIGGNLDAFTGKETVCFNIKVLDENVPAALDLLTDLVLHPTFAPDDLAREQ 141

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M ED+    +   F++  WK+  +GRPILG  +T+SSFT + + +  +R +T
Sbjct: 142 GVILEEIKMDEDNPDYLVHELFTQNFWKNDALGRPILGTAKTVSSFTQQIVFNEYARLFT 201

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI---QKRDLAEEH 237
              M     G +DH+  V+QV   F   S +   + ++PA      +I    K+ L +  
Sbjct: 202 PPNMVFSAAGNLDHDDFVAQVAQAFGSLSASSGSKLVRPAAPQAFPHITLKNKKSLEQVQ 261

Query: 238 MMLGFNGCAYQSRDFYLTNILASIL-GDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
             L          D +  ++L SIL G GMSSRLFQ +RE+RGL YSI +    F D G 
Sbjct: 262 FCLAMPSLEVSHPDRFTVHLLNSILGGGGMSSRLFQSIREERGLAYSIYSETNPFRDTGS 321

Query: 297 LYIASATAKENIM-ALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L + +  A +     L  ++ E  +   E + + E+ +   +    ++   E S  R   
Sbjct: 322 LAVYAGCAIDKTREVLDLTLAEFSRMKHELVSEEELKRVKDQSKGNMVLGLESSSSRMSN 381

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           +++Q M+ G     E +   +  ++ EDI  +A+++F
Sbjct: 382 LARQQMYYGEFFSVEDLTAEVDRVSREDIQRLAQQLF 418


>gi|145224602|ref|YP_001135280.1| peptidase M16 domain-containing protein [Mycobacterium gilvum
           PYR-GCK]
 gi|145217088|gb|ABP46492.1| peptidase M16 domain protein [Mycobacterium gilvum PYR-GCK]
          Length = 424

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 218/413 (52%), Gaps = 17/413 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++   G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RTA
Sbjct: 1   MRRTRLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT Y+A VL   + LA++++ D++ N    P D+E ER+
Sbjct: 61  VQIAQAVDAVGGELNAFTSREHTCYYAHVLDSDLELAVDLVADVVLNGRCEPDDVEVERD 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +I+  T  ++ SF  R YT 
Sbjct: 121 VVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVVGSVASIAGMTRSQLHSFHVRRYTP 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP---AVYVGGEY---IQKRDLAE 235
           DRM V   G ++H+  V  V  +F    + + +  + P   A  V G     + KRD  +
Sbjct: 181 DRMVVAVAGNIEHDEVVRLVRRHFG-RHLVRGRSPVAPRKGAGRVAGRPTLELVKRDAEQ 239

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ LG           +  ++L + LG G+SSRLFQ++RE RGL YS+ +  + F+D G
Sbjct: 240 THLSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQQIRETRGLAYSVYSTVDTFADTG 299

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREID-KEC----AKIHAKLIKSQERSY 350
            L I +    E        +V V   +L ++ +  I   EC      +   L+   E S 
Sbjct: 300 ALSIYAGCQPERF----DEVVRVTTDILADVARDGITADECRIAKGSLRGGLVLGLEDSG 355

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   I +  +  G        +  I  +T +++  VA+++ +     A+LGP
Sbjct: 356 SRMNRIGRSELNFGEHRTIADTLSKIDEVTIDEVNAVARQLLTRPFGAAVLGP 408


>gi|154686088|ref|YP_001421249.1| MlpA [Bacillus amyloliquefaciens FZB42]
 gi|154351939|gb|ABS74018.1| MlpA [Bacillus amyloliquefaciens FZB42]
          Length = 411

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 132/405 (32%), Positives = 228/405 (56%), Gaps = 4/405 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E  P + S  + V I  GSR+E  + +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRVVLENNPTVRSVAIGVWIGTGSRHETPDTNGISHFLEHMFFKGTNTRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+  ++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSAFDEDELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET+SSF  + +   +   YT DR+ +  
Sbjct: 129 MYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLSSFNGDSLRQHMDDFYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V  +F +  VE +F           +    +   +  +K+D  + H+ LGF G    
Sbjct: 189 AGNVTEQF-IKDVEKWFGTYEAKGKASGISEPEFHYEKLTRKKDTEQAHLCLGFKGLKVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I   T    +
Sbjct: 248 DPDIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTGANQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E +  L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 GLLSETIQETLSVLKRDGITPKELENSKEQMKGSLMLSLESTNSKMSRNGKNELLLGKHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTS 412
             ++II  ++A++ E + G+++++F+    L+++  P  ++P +S
Sbjct: 368 TMDEIITELNAVSLESVNGLSRRLFTDDYALSLI-SPTGNMPASS 411


>gi|304316854|ref|YP_003851999.1| peptidase M16 domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778356|gb|ADL68915.1| peptidase M16 domain protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 416

 Score =  229 bits (583), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 130/393 (33%), Positives = 216/393 (54%), Gaps = 3/393 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + I K  + I V+   MP + S ++ + ++ GSR+E++E++G++HF+EHM+FKG+ +R A
Sbjct: 1   MYIQKKINDIDVVAYRMPYVSSVYIGIWLKVGSRHEKKEQNGISHFIEHMVFKGSKRRNA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I EEI+ +GG +N +T  E T ++  V K +V  A+ ++ DM+ N  FN  DIE+E+ 
Sbjct: 61  KDIAEEIDNIGGQLNGFTGKESTCFYVKVYKSYVEKAINVLFDMVFNPLFNCDDIEKEKK 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEI M+ D   D      S ++W    +  P+LG   TI S   + II +   NY  
Sbjct: 121 VVIEEINMNNDSPEDLAYDMLSSLIWNGNSLSFPVLGTEGTIKSMDRDTIIKYYKSNYIK 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G  D     S  E   NV S    K   KP ++  G   + ++  + ++ L 
Sbjct: 181 ENIVISIAGNFDDSIFDSIAEKTSNVMSSETGKIVEKP-IWKKGIIFKSKEFEQVNICLS 239

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
                Y   + Y  +I+++  G GMSSRLFQ++RE++GL YSI ++   + D G   I +
Sbjct: 240 MPSIKYSFENIYSLSIISNAFGGGMSSRLFQKIREEKGLVYSIYSYPSTYIDTGAFTIFA 299

Query: 302 ATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           +T+ EN+  +   I + + S+ EN   + EIDK   ++   ++   +    R   I K +
Sbjct: 300 STSIENLKDVYELINDEIYSVKENGFSEDEIDKFKEQLKISILMDMDSISSRMSVIGKSL 359

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
           +F G I   + IID I +I  ED+  +AKKIF+
Sbjct: 360 LFLGKIYTVDDIIDKIKSIKYEDVNNLAKKIFN 392


>gi|302542112|ref|ZP_07294454.1| M16 family peptidase [Streptomyces hygroscopicus ATCC 53653]
 gi|302459730|gb|EFL22823.1| M16 family peptidase [Streptomyces himastatinicus ATCC 53653]
          Length = 459

 Score =  229 bits (583), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 127/415 (30%), Positives = 218/415 (52%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPSGLRILTETLPSVRSATFGIWAHVGSRDETPTLNGATHYLEHLLFKGTRRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S  + +D++ ER
Sbjct: 94  ALDISAAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSVIDAADVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   FS  +  D  +GRP+LG  +T++    ++I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFSHTMLGDTPLGRPVLGTVDTVNGLGRDQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH+  V QV   F         ++   A   G + I+         R 
Sbjct: 214 PTHLVVAAAGNVDHDTVVRQVSDAFEQAGALTRGDATPIAPRSGSKAIRTAGRVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L + LG GMSSRLFQEVREKRGL YS+ +++  F+
Sbjct: 274 TEQAHVILGMPGIPRTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYNSGFA 333

Query: 293 DNGVLYIASATAKENIM-ALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +   L     E+ Q   + +   E+ +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDQVARDGLTDEELRRAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +     +  + ++  I ++T +++  VA+ +    P+L+++GP  D
Sbjct: 394 LMNRIGKSELCWADQMSVDDMLARIQSVTPDEVREVARDVLGQRPSLSVIGPLKD 448


>gi|297617198|ref|YP_003702357.1| peptidase M16 domain protein [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145035|gb|ADI01792.1| peptidase M16 domain protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 446

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 216/390 (55%), Gaps = 10/390 (2%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G  +++E +P + S  + + +  GSR+E  E +G  HF+EH+LFKGT  RTAK+I E  
Sbjct: 9   NGARLVSEEIPHLRSVAMGIYVGVGSRDEADEMNGTTHFIEHLLFKGTATRTAKDIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E +GG +NAYTS E+T ++A  L E+   AL+I+ DM+ NS F   D+  E+ V++EEIG
Sbjct: 69  ESIGGQLNAYTSKEYTCFYARTLDENFEEALDILFDMVFNSVFMDKDLLTEKGVIVEEIG 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   FS+++W++  +GRPILG  ET+ +   E +I +  + Y    M +  
Sbjct: 129 MYEDSPDELIHDVFSQLLWRNHALGRPILGTKETVMALKRESVIEYYRQYYVPSNMVIAI 188

Query: 189 VGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
            G +++     +V  +      +  S AK+   + P   +    +  +D  +  + +G  
Sbjct: 189 AGNINNSMVRDKVSEWLHRVQNHPVSRAKLPPDIPPKNEL---RLITKDTEQVQLCIGTP 245

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
             +Y   + ++ NI+ SILG G+ SRLFQ +RE++GL YS+  +  ++SD+G   I +AT
Sbjct: 246 SISYSHDERHVQNIMNSILGGGIGSRLFQTIREEKGLAYSVYTYPTSYSDSGSFCIYAAT 305

Query: 304 AKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           + E I  L + + E +     N +   EI++   +I A +    E    R   + K VMF
Sbjct: 306 SPEKINDLMAGLGEELDKFRTNGVTADEINRAQRQIKANMYLGMESVMNRMSRLGKSVMF 365

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              I+  E++ID I A+T +DI   A ++ 
Sbjct: 366 YDRIIPLEEVIDNIMAVTADDIQRFANQVL 395


>gi|322418696|ref|YP_004197919.1| peptidase M16 domain-containing protein [Geobacter sp. M18]
 gi|320125083|gb|ADW12643.1| peptidase M16 domain protein [Geobacter sp. M18]
          Length = 418

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 229/403 (56%), Gaps = 5/403 (1%)

Query: 5   ISKTS--SGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           I KT+  SGI VITE +P  S+  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R++
Sbjct: 2   IKKTTLNSGIRVITERIPYASSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTDRRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++++ D+  +S+F+  +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPRAVDLLTDIFLHSTFDNEEIEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D +   F +  WK   +G  ILG  E+++  + + II++  + Y A
Sbjct: 122 VVLQEINMMEDTPDDLIHDLFHQHFWKGHPLGMSILGDAESVTGLSRDAIIAYKDQMYRA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + V   G V H+   + +E + +       +    P VY     + ++DL + H+ LG
Sbjct: 182 DDIIVTAAGNVAHDKLTALLEEFLHGVEPGHGRCESAPPVYERRIELVEKDLEQIHVCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK GL YS+ ++  + +D G L + +
Sbjct: 242 LKGVQQSHPQRYDAFIMNAILGGSMSSRLFQEVREKSGLAYSVYSYIASHADAGSLVVYA 301

Query: 302 ATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             + EN   L   ++ E+ +   E +   +++    ++   L+ S E S  R   ++K  
Sbjct: 302 GASPENSKELLEIMLREIGRFKTEPVPADQLEGAREQLKGNLLLSLESSDNRMSRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           ++ G+ L    I++    +T E I  +A++I  +S  TL +LG
Sbjct: 362 IYFGTPLPLTDIMEGFDRVTSESIQQLAREILDNSALTLVMLG 404


>gi|183981939|ref|YP_001850230.1| zinc protease PepR [Mycobacterium marinum M]
 gi|183175265|gb|ACC40375.1| zinc protease PepR [Mycobacterium marinum M]
          Length = 438

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 219/416 (52%), Gaps = 23/416 (5%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 15  LRRTTLPGGLRVVTEYLPAVRSASVGVWVGVGSRDEGTTVAGAAHFLEHLLFKSTPTRTA 74

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA+E++ D++ N      D+E ER+
Sbjct: 75  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDNDLELAVELVADVVLNGRCAADDVELERD 134

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  +++S+ T  ++ SF  R YT 
Sbjct: 135 VVLEEIAMRDDDPEDALADMFLTAMYGDHPVGRPVIGSTQSVSAMTRAQLHSFHMRRYTP 194

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRD 232
           DRM V   G VDH   V  V  +F      ++    +P     G           +  R+
Sbjct: 195 DRMVVAVAGNVDHNQVVGLVREHFG----PRLVRGRRPVAPRKGTGRVNGTPQLVLADRE 250

Query: 233 LAEEHMMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHEN 290
             + H+ LG    G  ++ R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + 
Sbjct: 251 AEQTHVSLGVRTPGRGWEHR--WALSVLHTALGGGLSSRLFQEIRESRGLAYSVYSALDI 308

Query: 291 FSDNGVLYIASATAKEN---IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
           F+D+G L + +A   E    +M +T  ++E V    + I + E       +   L+   E
Sbjct: 309 FADSGALSVYAACLPERFAEVMRVTREVLEAVAR--DGITESECRIAKGSLRGGLVLGLE 366

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            S  R   I +  +  G     E  +  I  +T +++  +A+++       A+LGP
Sbjct: 367 DSSSRMSRIGRSELNYGKHRTIEHTLQQIDRVTVDEVNALARRLLVKRYGAAVLGP 422


>gi|15842320|ref|NP_337357.1| M16 family peptidase [Mycobacterium tuberculosis CDC1551]
 gi|254232880|ref|ZP_04926207.1| zinc protease pepR [Mycobacterium tuberculosis C]
 gi|13882615|gb|AAK47171.1| peptidase, M16 family [Mycobacterium tuberculosis CDC1551]
 gi|124601939|gb|EAY60949.1| zinc protease pepR [Mycobacterium tuberculosis C]
 gi|323718628|gb|EGB27792.1| zinc protease pepR [Mycobacterium tuberculosis CDC1551A]
          Length = 438

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/415 (33%), Positives = 222/415 (53%), Gaps = 23/415 (5%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A 
Sbjct: 16  RRTTLPGGLRVVTEFLPAVHSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSAV 75

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I + ++ VGG++NA+T+ EHT Y+A VL   +PLA++++ D++ N      D+E ER+V
Sbjct: 76  DIAQAMDAVGGELNAFTAKEHTCYYAHVLGSDLPLAVDLVADVVLNGRCAADDVEVERDV 135

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F   ++ D  +GRP++G  +++S  T  ++ SF  R YT +
Sbjct: 136 VLEEIAMRDDDPEDALADMFLAALFGDHPVGRPVIGSAQSVSVMTRAQLQSFHLRRYTPE 195

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRDL 233
            M V   G VDH+  V+ V  +F     +++    +P     G           +  RD 
Sbjct: 196 WMVVAAAGNVDHDGLVALVREHFG----SRLVRGRRPVAPRKGTGRVNGSPRLTLVSRDA 251

Query: 234 AEEHMMLGFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
            + H+ LG    G  ++ R  +  ++L + LG G+SSRLFQEVRE RGL YS+ +  + F
Sbjct: 252 EQTHVSLGIRTPGRGWEHR--WALSVLHTALGGGLSSRLFQEVRETRGLAYSVYSALDLF 309

Query: 292 SDNGVLYIASATAKE---NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           +D+G L + +A   E   ++M +T+ ++E V    + I + E       +   L+   E 
Sbjct: 310 ADSGALSVYAACLPERFADVMRVTADVLESVAR--DGITEAECGIAKGSLRGGLVLGLED 367

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           S  R   + +  +  G     E  +  I  +T E++  VA+ + S     A+LGP
Sbjct: 368 SSSRMSRLGRSELNYGKHRSIEHTLRQIEQVTVEEVNAVARHLLSRRYGAAVLGP 422


>gi|308173634|ref|YP_003920339.1| specific processing protease [Bacillus amyloliquefaciens DSM 7]
 gi|307606498|emb|CBI42869.1| specific processing protease [Bacillus amyloliquefaciens DSM 7]
 gi|328553434|gb|AEB23926.1| specific processing protease [Bacillus amyloliquefaciens TA208]
 gi|328911774|gb|AEB63370.1| specific processing protease [Bacillus amyloliquefaciens LL3]
          Length = 411

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 131/405 (32%), Positives = 228/405 (56%), Gaps = 4/405 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E  P + S  + V I  GSR+E  + +G++HFLEHM FKGT  R+A+EI E  
Sbjct: 9   NGVRVVLENNPTVRSVAIGVWIGTGSRHETPDTNGISHFLEHMFFKGTNTRSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+  ++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSAFDEDELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET+S+F  + +   +   YT DR+ +  
Sbjct: 129 MYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLSAFNGDSLRQHMDNFYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V  +F +  VE +F           +    +   +  +K+D  + H+ LGF G    
Sbjct: 189 AGNVTEQF-IKDVEKWFGTYEAKGKASGISQPEFHYEKLTRKKDTEQAHLCLGFKGLKVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I   T    +
Sbjct: 248 DPDIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTGANQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E +  L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 GLLSETIQETLSVLKRDGITPKELENSKEQMKGSLMLSLESTNSKMSRNGKNELLLGKHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTS 412
             ++II  ++A++ E + G+++++F+    L+++  P  ++P +S
Sbjct: 368 TMDEIIAELNAVSLESVNGLSRRLFTDDYALSLI-SPTGNMPASS 411


>gi|145593930|ref|YP_001158227.1| peptidase M16 domain-containing protein [Salinispora tropica
           CNB-440]
 gi|145303267|gb|ABP53849.1| peptidase M16 domain protein [Salinispora tropica CNB-440]
          Length = 466

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/418 (31%), Positives = 228/418 (54%), Gaps = 22/418 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P + S    + +  GSR+E   + G AHFLEH+LFKGT +RT
Sbjct: 39  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVSVGSRDETGPQSGAAHFLEHLLFKGTHRRT 98

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S   P D+E ER
Sbjct: 99  ALEISSGIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTPEDVEVER 158

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ +  +GR I G  +T++  T  +I  F  R+YT
Sbjct: 159 GVILEEIAMHDDEPGDEVHDLFARAVYGEHPLGRLISGTEQTVTPMTRRQIQGFYRRHYT 218

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-------NVCSVAKIKES-----MKPAVYVGGEYI 228
           A R+ +   G +DH   V  V           +  + A  + +      KPA  +    +
Sbjct: 219 APRIVIAAAGNLDHSSVVKLVRQALRGSPLDTDPAAPAPYRSATPVVRTKPATTL----V 274

Query: 229 QKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHH 288
             ++  + H++LG +G   +    +   +L +ILG GMSSRLFQE+RE+RGL YS+ ++ 
Sbjct: 275 GPKETEQAHVVLGCSGIDRRDERRFALGVLNNILGGGMSSRLFQEIREQRGLAYSVYSYA 334

Query: 289 ENFSDNGV--LYIASATAKEN-IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKS 345
              +D+G+  +Y   A  + N ++ L  +  E+ +   + +   E+ +         +  
Sbjct: 335 SQHADSGLFSVYAGCAPGRANEVLELIRA--ELARVAADGLTAAELARGKGMSKGGFVLG 392

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            E S  R   ++K  +  G ++  + ++  + A+T  D+  +A ++ S   +LA++GP
Sbjct: 393 LEDSGSRMSRLAKGELLYGELMPVDTLLARVDAVTVADVNTLAAELLSRPMSLAVVGP 450


>gi|251797389|ref|YP_003012120.1| peptidase M16 domain protein [Paenibacillus sp. JDR-2]
 gi|247545015|gb|ACT02034.1| peptidase M16 domain protein [Paenibacillus sp. JDR-2]
          Length = 421

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 126/397 (31%), Positives = 220/397 (55%), Gaps = 4/397 (1%)

Query: 9   SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ V+ E +P   S    + ++ GSRNE  E +G++HF+EHMLFKGT  RTAK+I + 
Sbjct: 7   SNGLRVVVEYLPTFRSVSFGIWVKTGSRNETPENNGISHFVEHMLFKGTNGRTAKDIADL 66

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
            + +GG++NA+TS E+T Y A VL EH+P+A++ + DM   S  +  ++ +E+NV+LEEI
Sbjct: 67  FDGIGGNVNAFTSKEYTCYFAKVLDEHLPIAVDALSDMFFESKLDAEELAKEKNVILEEI 126

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            M ED   D +    S   + D  +   ILG  E +++   E +  +++  YT +   + 
Sbjct: 127 SMYEDTPDDKVHDEASRAAYGDHPLAYSILGLEERLAAMNSESLRGYMNDTYTIENTVIS 186

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ-KRDLAEEHMMLGFNGCA 246
             G V+    ++ +E YF      K K  +  A    G+Y+  K+   + H+ L F GC+
Sbjct: 187 VAGNVEETKLLALLEQYFGRFK-NKGKSGIVTAPTFHGDYVYFKKKTEQNHLCLTFPGCS 245

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
                 Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +++D+G+  + + TA +
Sbjct: 246 NSDPQLYAMILLNNALGGGMSSRLFQEIREKRGLAYSVYSYHTSYADSGLFTVYAGTAPK 305

Query: 307 NIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
               +    +E ++ L ++ +   E+ +   ++   LI S E +  R   + K  +  G 
Sbjct: 306 QTKEVLDLTLEQMEELSVKGLSDEELHRGKEQLKGSLILSLESTSSRMNRLGKNELMIGR 365

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
               ++++  I  +T +D+  V +++ S    +A++G
Sbjct: 366 HFTLDEMLQRIDNVTMKDVREVTERMLSVPFAVAMVG 402


>gi|325290351|ref|YP_004266532.1| processing peptidase [Syntrophobotulus glycolicus DSM 8271]
 gi|324965752|gb|ADY56531.1| processing peptidase [Syntrophobotulus glycolicus DSM 8271]
          Length = 440

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 124/410 (30%), Positives = 224/410 (54%), Gaps = 3/410 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+TE +  + SA + + + AGSR E+    G++HF+EHM FKGT KRTA+++ E +
Sbjct: 30  NGVRVLTEEIDYLRSAAIGIWVGAGSRYEKSGYEGISHFIEHMFFKGTKKRTARQLAESL 89

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG +NA+T+ E T Y+A VL E + LA++++ DM  +S F+P +IE+E+NVVLEE+ 
Sbjct: 90  ESVGGQLNAFTTKEMTCYYAKVLDEDIDLAIDVLSDMFFHSLFDPKEIEKEKNVVLEEVK 149

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M  D   + +   FS+ +W +  +G PILG   +I S   +KI+ ++   Y  D++ +  
Sbjct: 150 MYLDTPDELIHDLFSQYIWNEHPLGMPILGDEGSIKSLDRDKIMDYLETQYCPDKIVISA 209

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G + H+     +E + +     ++     P   V    + K D  + H++LG  G    
Sbjct: 210 AGKIKHDHIGKSLEQFGSFERQKEVSVYCHPVAKVIRTSMPK-DTEQMHLVLGVPGIGQN 268

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y  +++ +ILG G+SSRLFQE+RE+RGL YS+ ++H  + D G+  + +  +  NI
Sbjct: 269 DEDMYALHVINNILGGGLSSRLFQEIREQRGLAYSVYSYHATYVDTGLFAVYAGASPGNI 328

Query: 309 MALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   I+  +  +  + + + E+ +  A+I   L    E S      + K  +    + 
Sbjct: 329 EEVIKCILHEINGIRSKGLSEEELRRVVAQIKGNLYLGMESSSSIMSRLGKTELSFDRVK 388

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
            +E+ ++ +  +T +DI  V ++++       +     +  P   ++I+A
Sbjct: 389 TAEETVEKLEKVTLKDIDRVMERLWHKDKVSMLTIGSKEFTPDFDQIINA 438


>gi|152965435|ref|YP_001361219.1| peptidase M16 domain protein [Kineococcus radiotolerans SRS30216]
 gi|151359952|gb|ABS02955.1| peptidase M16 domain protein [Kineococcus radiotolerans SRS30216]
          Length = 457

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/414 (31%), Positives = 218/414 (52%), Gaps = 25/414 (6%)

Query: 11  GITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           G  V+TE MP   SA V   +  GSR+E +   G  HFLEH+LFKGT +R A +I    +
Sbjct: 42  GARVLTEAMPGQRSASVGCWVGVGSRDETKGHFGSTHFLEHLLFKGTERRDAMDIASAFD 101

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGG+ NA T  EHT+Y+A VL   +P+A++++ DM++++  +  D   ER V+LEE+ M
Sbjct: 102 AVGGEANAATGKEHTTYYARVLDADLPMAIDVVTDMVTSAVLDDDDFTSEREVILEELAM 161

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
           ++DD  D    RF+E+V     + RPI G P+TI +   + + +    +Y    +     
Sbjct: 162 NDDDPGDVAHERFAELVLGRHPLARPIGGTPDTIRAVGRDDVWAHYREHYQPSSLVFTAA 221

Query: 190 GAVDHEFCVSQVESYFNVCSVAKIKESMKP---------AVYVGGEYIQKRDLAEEHMML 240
           G +DH+  V+ V+   +  +    + + +P          +  G   +  R   + H++L
Sbjct: 222 GGLDHDEVVACVQRELDRAAGDLAQAAPRPRRTSGEVSGGLEAGAALVVDRQTEQAHVLL 281

Query: 241 GFNG-CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV--L 297
           G  G  A   R F L+ +L ++LG GMSSRLFQEVREKRGL YS+ + + N++D+G   L
Sbjct: 282 GMTGITATDERRFTLS-VLNAVLGGGMSSRLFQEVREKRGLAYSVYSFNANYADSGYVGL 340

Query: 298 YIASATAKENIMALTSSIVEVVQSLLEN-----IEQREIDKECAKIHAKLIKSQERSYLR 352
           Y   + AK       + + E++ + LE      +E  E+ +   ++   L+   E S  R
Sbjct: 341 YAGCSPAK------AAQVAELMLAELEKLATSPLEAEELGRGVGQLTGGLVLGLEDSGSR 394

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
              + K  +  G  L  + ++  + A+T ED+  +A  + S   ++ ++GP  D
Sbjct: 395 MNRLGKSELTHGQFLDVDGVLANVRAVTAEDVQTLAADLLSRPRSVTVVGPFAD 448


>gi|881434|gb|AAA73485.1| ORFP [Bacillus subtilis]
          Length = 409

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 226/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ ++A+EI E  
Sbjct: 9   NGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTKSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+ +++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET++SF  + +  ++   YT DR+ +  
Sbjct: 129 MYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +   F +  VE +F           ++   +   +  +K++  + H+ LGF G    
Sbjct: 189 AGNISDSF-IKDVEKWFGSYEAKGKATGLEKPEFHTEKLTRKKETEQAHLCLGFKGLEVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I   T    +
Sbjct: 248 HERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTGANQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E + +L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 QQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNELLLGKHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ ++A+  E + G+A+++F+    LA++ P
Sbjct: 368 TLDEIINELNAVNLERVNGLARQLFTEDYALALISP 403


>gi|56963985|ref|YP_175716.1| Zn-dependent protease [Bacillus clausii KSM-K16]
 gi|56910228|dbj|BAD64755.1| Zn-dependent protease [Bacillus clausii KSM-K16]
          Length = 414

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 228/404 (56%), Gaps = 4/404 (0%)

Query: 10  SGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +I E    I S  + + ++ GSRNE  EE+G++HF+EHMLFKGT  R+AK+I E  
Sbjct: 9   NGVRIIAEANEAIRSVAIGIWVKTGSRNESNEENGISHFIEHMLFKGTKTRSAKQIAEAF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+T+ E+T Y+A VL EH  LAL+++ DM  +S F+ ++IERE+ VVLEEI 
Sbjct: 69  DRIGGQVNAFTAKEYTCYYAKVLDEHAALALDVLQDMFFDSIFDKTEIEREKKVVLEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+ V+    +  PILG  +T+ +F+ ++I  ++ R Y  +R+ V  
Sbjct: 129 MVEDTPDDLVHDLLSQAVFGRSSLANPILGTEDTLQTFSRQQISDYMKRFYAGERVVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G  D +  + Q+   F+    A    ++  A +      +++D  + H+ L + G    
Sbjct: 189 CGHFD-DALLEQIRQTFSRVKRAPEPFAVPTATFSPTVKYRQKDSEQAHLCLAYPGLEIG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
           S   +   +L + LG  MSSRLFQ +RE++GLCYS+ ++H ++   G L I + T    +
Sbjct: 248 SNRSFGLILLNNALGGSMSSRLFQTIREEQGLCYSVFSYHSSYEQIGTLTIYAGTQMAQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             LT ++ EV +++  E + ++E++    ++   ++   E +  R     K  +      
Sbjct: 308 PKLTEALAEVTKAVRAEGLSKKELENGKEQLKGSIMLGLESTSSRMTRNGKNELLLQEHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
             +++I  I+A++ E +  +A ++   TP ++++    + +P+T
Sbjct: 368 TLDELIADINAVSLEMVNDLASQLLRDTPAVSLVASS-ETMPST 410


>gi|221309549|ref|ZP_03591396.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313873|ref|ZP_03595678.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318796|ref|ZP_03600090.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221323068|ref|ZP_03604362.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|255767376|ref|NP_389553.2| specific processing protease [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|321315438|ref|YP_004207725.1| specific processing protease [Bacillus subtilis BSn5]
 gi|239938816|sp|Q04805|YMXG_BACSU RecName: Full=Uncharacterized zinc protease ymxG; AltName:
           Full=ORFP
 gi|225185003|emb|CAB13544.2| specific processing protease [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484225|dbj|BAI85300.1| mitochondrial processing peptidase-like [Bacillus subtilis subsp.
           natto BEST195]
 gi|320021712|gb|ADV96698.1| specific processing protease [Bacillus subtilis BSn5]
          Length = 409

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 226/396 (57%), Gaps = 3/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ ++A+EI E  
Sbjct: 9   NGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTKSAREIAESF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+ +++++E+NVV EEI 
Sbjct: 69  DRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEKNVVYEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S+  + +  +G PILG  ET++SF  + +  ++   YT DR+ +  
Sbjct: 129 MYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYTPDRVVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +   F +  VE +F           ++   +   +  +K++  + H+ LGF G    
Sbjct: 189 AGNISDSF-IKDVEKWFGSYEAKGKATGLEKPEFHTEKLTRKKETEQAHLCLGFKGLEVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I   T    +
Sbjct: 248 HERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTGANQL 307

Query: 309 MALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             L+ +I E + +L  + I  +E++    ++   L+ S E +  +     K  +  G   
Sbjct: 308 QQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNELLLGKHK 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++II+ ++A+  E + G+A+++F+    LA++ P
Sbjct: 368 TLDEIINELNAVNLERVNGLARQLFTEDYALALISP 403


>gi|332703815|ref|ZP_08423903.1| processing peptidase [Desulfovibrio africanus str. Walvis Bay]
 gi|332553964|gb|EGJ51008.1| processing peptidase [Desulfovibrio africanus str. Walvis Bay]
          Length = 424

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 136/404 (33%), Positives = 211/404 (52%), Gaps = 3/404 (0%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           S+  +GI V+TE +P   SA + + I AGS +E+  + GMAHF EHM FKGT  RTA +I
Sbjct: 12  SQLDNGIRVVTERIPATRSASLGIWIEAGSLDEQPNQEGMAHFWEHMAFKGTLTRTALDI 71

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            ++++++GG  NA+T  EHT +HA ++   +  A++I+ D++     +PSDI  E++VVL
Sbjct: 72  AKDLDRLGGFSNAFTGREHTCFHARMVDTGLADAMDILSDIVLRPRLDPSDILLEQDVVL 131

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           +EI M  D   D+L   F  + W +  +   ILG   T+  F P  + ++   +Y   RM
Sbjct: 132 QEIAMVNDTPEDYLFEHFWSVYWTEPAMAHSILGNDNTVQGFVPAMLDAWRQEHYKPGRM 191

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
            V   GAVDHE  V+     F     A        +          RD+ + H++LGF G
Sbjct: 192 LVAAAGAVDHEKLVNLASRTFGSLPPASDARQQSLSGVQSRRQAIDRDMEQTHVLLGFPG 251

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
            A      +    L S+LG  MSSRLFQEVRE+RGL YS+ + H+  ++ GVL + +AT 
Sbjct: 252 VALTDERRFALAYLNSLLGGQMSSRLFQEVRERRGLAYSVYSSHQALANQGVLQVYAATQ 311

Query: 305 KENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
                 + S I++ +  L +  +++ EI      +   L    E S  R L ++K     
Sbjct: 312 PGKCREMLSVILQELHELAQGKVDEAEIAHCRDHLLGMLYLGTESSEDRMLRLAKNHYLF 371

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGPPMD 406
           G  +  E+    ++A+  +DI  VA+   +     L ILGP +D
Sbjct: 372 GRHVPVEETAAKLNAVNLDDIRAVARDFLAPDQACLCILGPDVD 415


>gi|254776110|ref|ZP_05217626.1| PepR [Mycobacterium avium subsp. avium ATCC 25291]
          Length = 413

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 136/402 (33%), Positives = 221/402 (54%), Gaps = 17/402 (4%)

Query: 14  VITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVG 72
           ++TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA +I + ++ VG
Sbjct: 1   MVTEYLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRTAVDIAQAMDAVG 60

Query: 73  GDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSED 132
           G++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+VVLEEI M +D
Sbjct: 61  GELNAFTAKEHTCYYAHVLDADLELAVDLVADVVLNGRCAAEDVELERDVVLEEIAMRDD 120

Query: 133 DSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAV 192
           D  D L   F   ++ D  +GRP++G   +++S T  ++ SF  R YT +RM V   G V
Sbjct: 121 DPEDALGDMFLGALFGDHPVGRPVIGTARSVASMTRTQLHSFHVRRYTPERMVVAVAGNV 180

Query: 193 DHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAEEHMMLGFN--G 244
           DH+  V+ V  +F    + + ++ + P    G      G  +  RD  + H+ LG    G
Sbjct: 181 DHDEVVAMVREHFG-PHLVRGRQPIAPRKGAGRVNGRPGLLLGTRDAEQTHVSLGVRTPG 239

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +Q R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G L + +A  
Sbjct: 240 RGWQHR--WALSVLHTALGGGLSSRLFQEIRELRGLAYSVYSTVDIFADSGALSVYAACQ 297

Query: 305 KEN---IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            E    +MA+TS ++E V    + I + E       +   L+   E S  R   + +  +
Sbjct: 298 PERFAEVMAVTSGVLESVAR--DGITESECRIAKGSLRGCLVLGLEDSGSRMSRLGRNEL 355

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             G     E  +  I  ++ +++  +A+++ +     A+LGP
Sbjct: 356 NYGRHRSIEHTLAQIDRVSVDEVNAIARRLLTQRYGAAVLGP 397


>gi|295687736|ref|YP_003591429.1| processing peptidase [Caulobacter segnis ATCC 21756]
 gi|295429639|gb|ADG08811.1| processing peptidase [Caulobacter segnis ATCC 21756]
          Length = 423

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 212/404 (52%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   +    +G+ V+ + MP +++  + V    G+  E     G +H LEHM+FKG  +R
Sbjct: 1   MTATLRTLKNGVRVVCDPMPGLETLALSVVAGRGAAYEDPGRSGWSHLLEHMVFKGAGQR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++IVE IE  GG INA T  E TS+    LK  + L +++I D+L   + +P+D+ RE
Sbjct: 61  SARDIVEVIESAGGSINAATGYERTSFQVRALKGGLDLGMDVIADLLRRPTLDPADLARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EI  + D   D++        W D  +GRPILG   T+ + T E +  + +  Y
Sbjct: 121 KQVVAQEIAEAADAPDDYVFDLIQRASWGDHPVGRPILGSDATVEAATVEALSDWRAALY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            ADR+ V   GAV+    ++  E  F        +     A +VGG   + R L + H++
Sbjct: 181 AADRLVVSATGAVEEAELMAAAERAFGDLPATPGEAVPAAAAFVGGPQAEARKLEQSHLV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
                C  + +D++   I A +LG GMSSRLFQE REKRGL Y+I A+ + ++D+G L I
Sbjct: 241 FMLPACGSRDQDYFALRIFAEVLGGGMSSRLFQEAREKRGLAYNIDAYADTYADHGALGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +  A  + +         V+ L+ +I+  E+ +  A++ A +  ++E+   RA + + Q
Sbjct: 301 YAGCAASDAVETAKVCAGEVEKLVAHIDDAELARAKAQLKAHMFMAREQPLSRAEQGAGQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILG 402
           V+    +    ++   + A+T +D+  + +++ +      A+LG
Sbjct: 361 VLLFDRLYAPRELAAEVDAVTAQDVARLGRRLLADGHAATAVLG 404


>gi|308232238|ref|ZP_07664036.1| zinc protease pepR [Mycobacterium tuberculosis SUMu001]
 gi|308369855|ref|ZP_07419302.2| zinc protease pepR [Mycobacterium tuberculosis SUMu002]
 gi|308371128|ref|ZP_07423915.2| zinc protease pepR [Mycobacterium tuberculosis SUMu003]
 gi|308372389|ref|ZP_07428510.2| zinc protease pepR [Mycobacterium tuberculosis SUMu004]
 gi|308373503|ref|ZP_07432574.2| zinc protease pepR [Mycobacterium tuberculosis SUMu005]
 gi|308374685|ref|ZP_07436992.2| zinc protease pepR [Mycobacterium tuberculosis SUMu006]
 gi|308378097|ref|ZP_07668667.1| zinc protease pepR [Mycobacterium tuberculosis SUMu009]
 gi|308379314|ref|ZP_07668941.1| zinc protease pepR [Mycobacterium tuberculosis SUMu010]
 gi|308380468|ref|ZP_07669199.1| zinc protease pepR [Mycobacterium tuberculosis SUMu011]
 gi|308214572|gb|EFO73971.1| zinc protease pepR [Mycobacterium tuberculosis SUMu001]
 gi|308326218|gb|EFP15069.1| zinc protease pepR [Mycobacterium tuberculosis SUMu002]
 gi|308329776|gb|EFP18627.1| zinc protease pepR [Mycobacterium tuberculosis SUMu003]
 gi|308333382|gb|EFP22233.1| zinc protease pepR [Mycobacterium tuberculosis SUMu004]
 gi|308337405|gb|EFP26256.1| zinc protease pepR [Mycobacterium tuberculosis SUMu005]
 gi|308341070|gb|EFP29921.1| zinc protease pepR [Mycobacterium tuberculosis SUMu006]
 gi|308353595|gb|EFP42446.1| zinc protease pepR [Mycobacterium tuberculosis SUMu009]
 gi|308357441|gb|EFP46292.1| zinc protease pepR [Mycobacterium tuberculosis SUMu010]
 gi|308361391|gb|EFP50242.1| zinc protease pepR [Mycobacterium tuberculosis SUMu011]
          Length = 413

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 137/405 (33%), Positives = 219/405 (54%), Gaps = 23/405 (5%)

Query: 14  VITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVG 72
           ++TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A +I + ++ VG
Sbjct: 1   MVTEFLPAVHSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSAVDIAQAMDAVG 60

Query: 73  GDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSED 132
           G++NA+T+ EHT Y+A VL   +PLA++++ D++ N      D+E ER+VVLEEI M +D
Sbjct: 61  GELNAFTAKEHTCYYAHVLGSDLPLAVDLVADVVLNGRCAADDVEVERDVVLEEIAMRDD 120

Query: 133 DSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAV 192
           D  D L   F   ++ D  +GRP++G  +++S  T  ++ SF  R YT +RM V   G V
Sbjct: 121 DPEDALADMFLAALFGDHPVGRPVIGSAQSVSVMTRAQLQSFHLRRYTPERMVVAAAGNV 180

Query: 193 DHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRDLAEEHMMLGFN 243
           DH+  V+ V  +F     +++    +P     G           +  RD  + H+ LG  
Sbjct: 181 DHDGLVALVREHFG----SRLVRGRRPVAPRKGTGRVNGSPRLTLVSRDAEQTHVSLGIR 236

Query: 244 --GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G  ++ R  +  ++L + LG G+SSRLFQEVRE RGL YS+ +  + F+D+G L + +
Sbjct: 237 TPGRGWEHR--WALSVLHTALGGGLSSRLFQEVRETRGLAYSVYSALDLFADSGALSVYA 294

Query: 302 ATAKE---NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           A   E   ++M +T+ ++E V    + I + E       +   L+   E S  R   + +
Sbjct: 295 ACLPERFADVMRVTADVLESVAR--DGITEAECGIAKGSLRGGLVLGLEDSSSRMSRLGR 352

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +  G     E  +  I  +T E++  VA+ + S     A+LGP
Sbjct: 353 SELNYGKHRSIEHTLRQIEQVTVEEVNAVARHLLSRRYGAAVLGP 397


>gi|188586079|ref|YP_001917624.1| peptidase M16 domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350766|gb|ACB85036.1| peptidase M16 domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 417

 Score =  226 bits (576), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 224/405 (55%), Gaps = 17/405 (4%)

Query: 10  SGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++ E M  + S  V + I++GSR E   + G++H LEHMLFKGT  RTA++I EEI
Sbjct: 9   NGLRIVAEPMESVRSVTVGIWIKSGSRFENLSQQGISHLLEHMLFKGTDSRTAQDIAEEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG INA+TS E+T  +  V+  H   AL I+ DM  NS F+  D+E+E+ V+ EE+ 
Sbjct: 69  DSIGGHINAFTSKEYTCIYIKVIDSHFETALAILADMFFNSKFDQEDLEKEKQVIFEELK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   +++     +  + +  +   ILG  E++S+ + E +I+   R +T ++  +  
Sbjct: 129 MYEDTPDEYVHDLLIQSCYGEHELAHNILGDRESVSNLSSEALINHHKRYFTPEKTVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKES----MKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
            G V  +  V     YF   S   I  +    ++   Y     ++ +D  + H  L F G
Sbjct: 189 SGNVSMDNVVETATKYFG--SFVNINNNDNHPLRGPSYYTDSIVKGKDTEQVHFCLAFPG 246

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
            + ++   Y   +L +ILG  MSS+ FQE+REKRGLCYS+ +++ NF+D+G+  I +  +
Sbjct: 247 LSVENSQLYHLGLLNNILGGSMSSKFFQEIREKRGLCYSVYSYYLNFTDSGLFVIYAGFS 306

Query: 305 KENIMALTSSIVEVVQSLLENIEQ-----REIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++N     +   +++ S+L+ I+Q      E+++   ++   ++   E +  R   + + 
Sbjct: 307 QDNF----NETYDLIWSILDEIKQGSITDEELNRSKEQVKGNILMGLESTSNRMARLGRD 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
            +  G IL  E+II+ I  IT ED++ +A+ +F     + A++GP
Sbjct: 363 ELLKGEILTYEQIIEKIENITKEDLLKLAQDLFQKNQMSSAVIGP 407


>gi|15827381|ref|NP_301644.1| zinc protease [Mycobacterium leprae TN]
 gi|221229858|ref|YP_002503274.1| putative zinc protease [Mycobacterium leprae Br4923]
 gi|13092931|emb|CAC31236.1| putative zinc protease [Mycobacterium leprae]
 gi|219932965|emb|CAR70950.1| putative zinc protease [Mycobacterium leprae Br4923]
          Length = 424

 Score =  226 bits (575), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 220/404 (54%), Gaps = 13/404 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T+ RTA +I + I
Sbjct: 8   GGLRVVTEHLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTSTRTAMDIAQAI 67

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+VVLEEI 
Sbjct: 68  DAVGGELNAFTAKEHTCYYAHVLDSDLELAVDLVADVVLNGRCAVDDVELERDVVLEEIA 127

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   ++ D  +GRP++G  E++S+ T  ++ SF  R YT +RM V  
Sbjct: 128 MRDDDPEDALGDMFLAALFGDHPVGRPVIGTMESVSAMTRTQLHSFHVRRYTPERMVVAV 187

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAEEHMMLGF 242
            G VDH+  V+ V  +F    + + ++S  P    G         + KRD  + H++LG 
Sbjct: 188 AGNVDHDEMVALVREHFG-SRLIRGRQSAPPRKSTGRINGGPALTLGKRDAEQTHVLLGV 246

Query: 243 N--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
              G +++ R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G L + 
Sbjct: 247 RTPGRSWEHR--WALSVLHTALGGGLSSRLFQEIRETRGLAYSVYSALDIFADSGALSVY 304

Query: 301 SATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +A        +   I EV+ S+  + I + E       +   +I   E S      + + 
Sbjct: 305 AACLPGRFADVMQVISEVLASVAGDGITEAECRIAKGSLRGGIILGLEDSNSWMSRLGRS 364

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +  G     E  +  I  +T E +  +A ++ +     A+LGP
Sbjct: 365 ELNYGKYRGIEHTLQQIDEVTVEQVNALAHQLLNKRYGAAVLGP 408


>gi|301063520|ref|ZP_07204052.1| peptidase M16 inactive domain protein [delta proteobacterium
           NaphS2]
 gi|300442459|gb|EFK06692.1| peptidase M16 inactive domain protein [delta proteobacterium
           NaphS2]
          Length = 420

 Score =  226 bits (575), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 127/408 (31%), Positives = 218/408 (53%), Gaps = 12/408 (2%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +  ++G+ +++E +P + S  + + +  GSR+E   E+G++HF+EHM FKGT  R+  
Sbjct: 3   RKTLLNNGVRIVSERLPHVRSVSLGIWVNTGSRDESPPENGVSHFIEHMSFKGTHNRSGF 62

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I ++++ +GG  NA+T  E T ++  VL  H P+  +I+ D+  + +F P D+ERER V
Sbjct: 63  QIAKDLDAIGGLSNAFTGKETTCFYGKVLDRHFPILADILSDIFIHPTFQPEDMEREREV 122

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + +EI M ED   D+L+  F  + W D  IGRPILG  ET++    + I  ++ ++Y  +
Sbjct: 123 IFQEISMVEDTPDDYLNVLFQSLFWPDHPIGRPILGSTETVARMDRQMIREYIKKHYIPE 182

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCS-VAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           R+ VV  G VDH+  V      F      +K K         GG  +  + L + H  LG
Sbjct: 183 RVLVVAAGHVDHDAMVDYFRPIFEAGGDFSKEKPERSLPSNSGGVMVMPKALEQVHFCLG 242

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
            +  ++     +   +  +ILG  MSSRLFQE+RE RGL YS+ +    ++D G+  + +
Sbjct: 243 SDAPSHVDASRFACALFNTILGGNMSSRLFQEIRENRGLAYSVYSFFSPYADAGLFGVYA 302

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQ-----REIDKECAKIHAKLIKSQERSYLRALEI 356
           AT   N+    +S++EV Q+ ++ I +      E+D     +   +  S E S  R +  
Sbjct: 303 ATDARNM----NSVLEVTQNEIKKISRGELTAGELDIAKENVIGGMYLSSESSDSRMMRA 358

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
           +K        +  E++  +I  ++ +D+V +A +IF +     A LGP
Sbjct: 359 AKNEFIFERYVDYEEVAKSIEGVSVDDVVEMANRIFGNEQIAFAALGP 406


>gi|253573575|ref|ZP_04850918.1| peptidase M16 domain-containing protein [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251847103|gb|EES75108.1| peptidase M16 domain-containing protein [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 417

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 131/404 (32%), Positives = 226/404 (55%), Gaps = 7/404 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ ++  +G+ V+ E +P   S    + ++ GSRNER E  G++HF+EHMLFKGT + +A
Sbjct: 1   MKRTQLKNGLRVVMEKIPTCRSVSFGIWVKTGSRNERPERGGISHFIEHMLFKGTERYSA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E+ + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM   S F+  ++ +E+N
Sbjct: 61  KDIAEQFDAIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFRSLFDKEELRKEKN 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M ED   D +    ++  + D  +  PILG  E + +   E +  ++  +YT 
Sbjct: 121 VIVEEISMYEDTPDDMVHDLVTQAAYGDHPLALPILGTEEKLRAMESEHLREYMREHYTI 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           +   +   G +D E  +  +E YF   S       +    ++GG    ++   + H+ L 
Sbjct: 181 ENTVISVAGNID-EQVIDLLEQYFGDFSNRGSSSPLAAPEFLGGLKFHRKKTEQNHICLS 239

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G        Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +++D+G+  + +
Sbjct: 240 FPGLPIGDEKQYAMVLLNNALGGGMSSRLFQEIREKRGLAYSVYSYHSSYADSGLFTVYA 299

Query: 302 ATAK---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            TA    + ++ LT  I+  V   +  I   E+ K   ++   LI S E +  R   + K
Sbjct: 300 GTAPRQTKEVLDLTKEILHDVS--VNGITPNELSKGKEQLKGSLILSLESTGSRMNRLGK 357

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             +  G     +++I  I A+T +D+  V K +FS   +LA++G
Sbjct: 358 NELMIGKHYSLDEMIARIEAVTMDDVNQVLKGMFSQPFSLAMVG 401


>gi|239908470|ref|YP_002955212.1| putative M16B family peptidase [Desulfovibrio magneticus RS-1]
 gi|239798337|dbj|BAH77326.1| putative M16B family peptidase [Desulfovibrio magneticus RS-1]
          Length = 419

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 128/406 (31%), Positives = 216/406 (53%), Gaps = 7/406 (1%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R  +  +G+ ++TE MP+  +A + + I AGSR+E   + GMAH +EHM FKGT +R A
Sbjct: 11  IRADRLPNGVRIVTEHMPVSKTASLGIWIEAGSRHEAPGQEGMAHLMEHMAFKGTARRDA 70

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I +E++ +GG  NA+TS E T +H  V+  H+  A +I+ D++     +P ++ RE+ 
Sbjct: 71  LAIAKELDTLGGLSNAFTSREATCFHVRVMDAHLARAFDILSDIVLRPLLDPEELAREQA 130

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EI M E+   + +   F    W D  +  PI G P+++ + T E +  +    Y  
Sbjct: 131 VILQEISMVEETPEEKIHEDFWAAAWADPGLAHPITGTPQSVGAVTAEALAQWRRAAYHP 190

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV--YVGGEYIQKRDLAEEHMM 239
           + + VV  GA+DH+      E+ F   S+ KI+ +  PA   Y      ++RD  + H++
Sbjct: 191 EAITVVAAGALDHDALAEMAEAAFG--SLRKIQTAPAPAAGAYTPPYLAERRDWEQNHVI 248

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L +      S D +   +LA++LG  MSSRLFQEVREKRGL YSI A     +D G+L I
Sbjct: 249 LSYPSVGNVSADRFAHTLLATLLGGNMSSRLFQEVREKRGLAYSIYAGVNGLADVGLLEI 308

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +A   +    L S +   + ++ +  +   E+D     +   L    E +  R + +++
Sbjct: 309 QAAVDPDRTAELLSVVNAELAAVADGAVTAEELDHTREHLKGLLYLGAESTENRMMRLAR 368

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
            ++     +  E+    + A+T +DI   AK  F+  +  LA++GP
Sbjct: 369 NILLFNRSIPLEETAACLDAVTPDDIARTAKAAFAPGSAGLAVMGP 414


>gi|297569829|ref|YP_003691173.1| processing peptidase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925744|gb|ADH86554.1| processing peptidase [Desulfurivibrio alkaliphilus AHT2]
          Length = 428

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 224/414 (54%), Gaps = 16/414 (3%)

Query: 3   LRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +R +  ++G+ ++TE  P     V + ++ G+R+E    +G +HF+EHMLFKGT +R+A+
Sbjct: 2   IRQTALANGVRIVTESTPSRVVSVGIWVQVGARDEHDLTNGCSHFVEHMLFKGTRRRSAQ 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I  E + +GG  NA+T+ E T YHA VL E +P  ++++ DM+ NS+F P ++E ER V
Sbjct: 62  QIAREFDVMGGTANAFTAAEATCYHATVLAERLPQLVDLLSDMVLNSAFVPEEVEHEREV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L+EI M ED   D +   F+   W    +G P+LG P  I +  P  +  F  R+Y   
Sbjct: 122 ILQEIAMVEDTPDDLVHDLFNRQFWGRHPMGNPVLGPPRVIGALLPGHVRDFHRRHYQPA 181

Query: 183 RMYVVCVGAVDH-EFCVSQVESYFNVCSVAK---IKES-----MKPAVYVGGEYIQKRDL 233
           R+ +   G V+H +FC    + +    +V K   ++ S       P        I  RDL
Sbjct: 182 RIIIAAAGQVEHRQFCDLCRQGWEQGPAVGKSGHLQASSDFSRRPPESSKFSRQIIPRDL 241

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + H++LG    A  + + Y  ++L ++LG  MSSRLFQE+REKRGL Y++ ++    SD
Sbjct: 242 EQTHLVLGVRAPAENAPERYALHLLNTVLGGNMSSRLFQEIREKRGLAYAVFSYVNAHSD 301

Query: 294 NGVLY----IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
            G L     I    A E +  +   +  + +  L + E  E  ++ A+  A ++ ++E  
Sbjct: 302 CGTLAVYLGIDPRAANEALAVVGQEVRRLGRQPLSDEELAEA-RDYAR--AVILLAEENM 358

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   +++ ++  G  L  E+I+ +++ +T EDI  +A  +F++  +   LGP
Sbjct: 359 ESRMHRLARNLITHGRPLPLEEILTSLAQVTAEDIRQLAATLFTAPLSATALGP 412


>gi|6686233|sp|O32965|Y855_MYCLE RecName: Full=Uncharacterized zinc protease ML0855
 gi|2342618|emb|CAB11391.1| protease/peptidase [Mycobacterium leprae]
          Length = 445

 Score =  225 bits (574), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 138/404 (34%), Positives = 220/404 (54%), Gaps = 13/404 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T+ RTA +I + I
Sbjct: 29  GGLRVVTEHLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTSTRTAMDIAQAI 88

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+VVLEEI 
Sbjct: 89  DAVGGELNAFTAKEHTCYYAHVLDSDLELAVDLVADVVLNGRCAVDDVELERDVVLEEIA 148

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   ++ D  +GRP++G  E++S+ T  ++ SF  R YT +RM V  
Sbjct: 149 MRDDDPEDALGDMFLAALFGDHPVGRPVIGTMESVSAMTRTQLHSFHVRRYTPERMVVAV 208

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG------GEYIQKRDLAEEHMMLGF 242
            G VDH+  V+ V  +F    + + ++S  P    G         + KRD  + H++LG 
Sbjct: 209 AGNVDHDEMVALVREHFG-SRLIRGRQSAPPRKSTGRINGGPALTLGKRDAEQTHVLLGV 267

Query: 243 N--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
              G +++ R  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G L + 
Sbjct: 268 RTPGRSWEHR--WALSVLHTALGGGLSSRLFQEIRETRGLAYSVYSALDIFADSGALSVY 325

Query: 301 SATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +A        +   I EV+ S+  + I + E       +   +I   E S      + + 
Sbjct: 326 AACLPGRFADVMQVISEVLASVAGDGITEAECRIAKGSLRGGIILGLEDSNSWMSRLGRS 385

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +  G     E  +  I  +T E +  +A ++ +     A+LGP
Sbjct: 386 ELNYGKYRGIEHTLQQIDEVTVEQVNALAHQLLNKRYGAAVLGP 429


>gi|268316874|ref|YP_003290593.1| peptidase M16 domain-containing protein [Rhodothermus marinus DSM
           4252]
 gi|262334408|gb|ACY48205.1| peptidase M16 domain protein [Rhodothermus marinus DSM 4252]
          Length = 418

 Score =  225 bits (574), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 215/391 (54%), Gaps = 6/391 (1%)

Query: 11  GITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           G+ V+TE +P + S  V + +  GSR+E +EE G+ HF+EHM+FKGT +R   +I + IE
Sbjct: 20  GLRVVTETIPSVRSVAVGLWVDVGSRDEAEEEAGITHFIEHMVFKGTERRRTHQIAQRIE 79

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGG +NA+T+ EHT Y+  VL E++  AL+ + D+     F   +IE+E+ V+LEE+ M
Sbjct: 80  YVGGYLNAFTTKEHTCYYVRVLDEYLDRALDTLIDLAFRPRFPEREIEKEKEVILEEMKM 139

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   +++   F E+V+    +GRPI+G+ ET+ SFT   ++ F++R+YT DRM +   
Sbjct: 140 YEDTPDEYIFDLFEELVYAGHPLGRPIVGREETVRSFTRAMLLDFMARHYTPDRMVLAAA 199

Query: 190 GAVDHEFCVSQVESYFNVCSVAKIKESMKPAV--YVGGEYIQKRDLAEEHMMLGFNGC-A 246
           G + HE  V+  E      +        +  V  Y  GE I++R + + H++LG  G   
Sbjct: 200 GRLRHERVVALTERLLRGVAPRPTNNRQRQPVPAYRPGERIERRSVQQAHLVLGGRGYDL 259

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
           +  R   LT +L ++LG GMSSRL Q +RE+ G CY+I +     +D G   +   T   
Sbjct: 260 HHPRRAALT-VLNTLLGGGMSSRLNQNIRERYGYCYNIYSFVNLHADVGDWGVYMGTDPR 318

Query: 307 NIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
            +      I   ++ L+ E + +R +     ++   L+  QE    R + + +Q ++ G 
Sbjct: 319 RVARAEQLIRRELERLVQEPVGRRVLTHAKNQVKGTLMLGQENMSSRMMRLGRQELYFGR 378

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSSTP 396
               ++ +     +T E++  VA+++F+  P
Sbjct: 379 YYSLDEALQEADRVTAEEVQAVARELFAEQP 409


>gi|54025856|ref|YP_120098.1| putative protease [Nocardia farcinica IFM 10152]
 gi|54017364|dbj|BAD58734.1| putative protease [Nocardia farcinica IFM 10152]
          Length = 456

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 131/418 (31%), Positives = 221/418 (52%), Gaps = 24/418 (5%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA + V +  GSR+E +   G AHFLEH+LFK T  R+
Sbjct: 31  GVRRTVLPGGLRVVTEHVPGVRSASIGVWVGVGSRDEGRTVAGAAHFLEHLLFKATPTRS 90

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+T+ E T Y+A VL E +PLA++++ D++ N     +D++ ER
Sbjct: 91  ALDIAQAMDAVGGELNAFTAKEQTCYYAHVLDEDLPLAVDMVSDVVLNGLCRSADVDVER 150

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M +DD  D +   F   ++ D  IGRP++G  E+I S T  ++  F  R Y 
Sbjct: 151 QVVLEEIAMRDDDPEDLVGDAFLTALFGDHPIGRPVIGSVESIESMTAAQLRGFHQRRYR 210

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK---------R 231
            DRM V   G V+HE  V  V   F      ++  + +PA    G +            R
Sbjct: 211 PDRMVVAVAGNVEHEHTVELVHRAFE----NRLDPAAQPAPRREGRFRPHGAPELQWSFR 266

Query: 232 DLAEEHMMLGFNGCA-YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHEN 290
           D  + H++ G      ++    +  ++L +++G G+SSRLFQ +RE+RGL YS+ +  + 
Sbjct: 267 DSEQAHLVFGVRAFGRHEGERRWPLSVLNTVVGGGLSSRLFQRIREERGLAYSVYSSVDT 326

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKECAK----IHAKLIKS 345
           F+D G   +      EN+      +  + + +LE + +  + D ECA+    +   L+  
Sbjct: 327 FADTGAFSVYIGCQPENL----GEVARLAKGVLEEVAEHGVTDAECARAKGSLRGGLVLG 382

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            E S  R   I +  +  G+     + +  I A+T E++  +A+ + S    +++ GP
Sbjct: 383 LEDSASRMNRIGRSELSYGNHRSVSETLARIDAVTTEEVAAIARTLLSRPFGVSVAGP 440


>gi|323705392|ref|ZP_08116967.1| peptidase M16 domain protein [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535294|gb|EGB25070.1| peptidase M16 domain protein [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 415

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 122/395 (30%), Positives = 217/395 (54%), Gaps = 7/395 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + I K  + + V+   MP ++S ++ + I+ GSR E +E +G++HF+EHM+FKG+  R+A
Sbjct: 1   MYIQKKINDVNVVAYKMPYVNSVYIGIWIKVGSRYENKENNGISHFIEHMVFKGSKNRSA 60

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I EEI+ +GG +N +T  E T ++  V   ++  A++++ DM+ N  F   DIE+E+N
Sbjct: 61  KDIAEEIDNIGGQLNGFTGKESTCFYVKVYNSYIEKAVDVLFDMVFNPLFKSEDIEKEKN 120

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M+ D   D      + + WK   +  P+LG  +T+ SF  + I+ F   NY  
Sbjct: 121 VVLEEINMNNDSPEDVAYDMLANLTWKGNPLSYPVLGYEDTVKSFDRDTIVKFYRENYFK 180

Query: 182 DRMYVVCVGAVDHEF--CVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           D + +   G  D      +S+   Y N C+ A    S+    +  G  ++ ++  + ++ 
Sbjct: 181 DNIVISIAGNFDDSIFDIISRKTLYINSCNNAI---SLDKPDWNKGIVLKSKEYEQVNIC 237

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +   G  Y     Y  +I+++  G GMSSRLFQ++RE+ GL YSI ++   + D G   I
Sbjct: 238 ISMPGINYSFDSIYTLSIVSNAFGGGMSSRLFQKIREEEGLVYSIYSYPSTYIDTGAFTI 297

Query: 300 ASATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            ++TA EN+ ++   I+ E+++   +   + E++K   ++   ++   +    R   I K
Sbjct: 298 FASTAPENLKSVYELIIEEILKVKNDGFSEFEVNKFREQLKISILMDMDSISSRMSSIGK 357

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
            ++F   +     I+D I +IT +D+  +AKKIF+
Sbjct: 358 SLLFLKKVYTVNDIVDKIDSITYDDVNNLAKKIFN 392


>gi|315444933|ref|YP_004077812.1| Zn-dependent peptidase [Mycobacterium sp. Spyr1]
 gi|315263236|gb|ADT99977.1| predicted Zn-dependent peptidase [Mycobacterium sp. Spyr1]
          Length = 449

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 217/412 (52%), Gaps = 17/412 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++   G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RTA
Sbjct: 26  VRRTRLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTA 85

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT Y+A VL   + LA++++ D++ N    P D+E ER+
Sbjct: 86  VQIAQAVDAVGGELNAFTSREHTCYYAHVLDSDLELAVDLVADVVLNGRCEPDDVEVERD 145

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +I+  T  ++ SF  R YT 
Sbjct: 146 VVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVVGSVASIAGMTRSQLHSFHVRRYTP 205

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP---AVYVGGEY---IQKRDLAE 235
           DRM V   G ++H+  V  V  +F    + + +  + P   A  V G     + KRD  +
Sbjct: 206 DRMVVAVAGNIEHDEVVRLVRRHFG-RHLVRGRSPVAPRKGAGRVAGRPTLELVKRDAEQ 264

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ LG           +  ++L + LG G+SSRLFQ++RE RGL YS+ +  + F+D G
Sbjct: 265 THLSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQQIRETRGLAYSVYSTVDTFADTG 324

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREID-KEC----AKIHAKLIKSQERSY 350
            L I +    E        +V V   +L ++ +  I   EC      +   L+   E S 
Sbjct: 325 ALSIYAGCQPERF----DEVVRVTTDILADVARDGITADECRIAKGSLRGGLVLGLEDSG 380

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            R   I +  +  G        +  I  +T +++  VA+++ +     A+LG
Sbjct: 381 SRMNRIGRSELNFGEHRTIADTLSKIDEVTIDEVNAVARQLLTRPFGAAVLG 432


>gi|302528524|ref|ZP_07280866.1| metalloendopeptidase [Streptomyces sp. AA4]
 gi|302437419|gb|EFL09235.1| metalloendopeptidase [Streptomyces sp. AA4]
          Length = 461

 Score =  225 bits (574), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 132/408 (32%), Positives = 208/408 (50%), Gaps = 18/408 (4%)

Query: 10  SGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ VITE +P   SA V + +  GSR+E     G AH+LEH+LFKGT  R A +I EEI
Sbjct: 41  GGLRVITEHVPASRSATVGLWVGVGSRDEPSPVAGAAHYLEHLLFKGTAHRDATQIAEEI 100

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG+ NA+T+ EHT Y+A VL   +PLAL+++ D++  +     D++ ER+VVLEEI 
Sbjct: 101 DAVGGEFNAFTAKEHTCYYAQVLDADLPLALDLVTDVVFEAQCTDRDMDMERSVVLEEIA 160

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   +  D  +GRP+LG  ++I+  +P  +  F  R YT  RM +  
Sbjct: 161 MRDDDPEDLLHEEFVSAILGDHPLGRPVLGTEKSITEMSPVALRGFYRRRYTLPRMVLAV 220

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRDLAEEHMM 239
            G V+H     QV          ++  +  P     G           +   D  + H+M
Sbjct: 221 AGNVEH----GQVLRLVKRALKDRLGGTATPVAPRSGRARLKTVPKLALHPDDTEQAHVM 276

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF          +  ++L + LG GMSSRLFQE+RE+RGL Y + +   +++D G + +
Sbjct: 277 LGFRALPRHDERRFTLSVLNAALGGGMSSRLFQEIRERRGLAYQVYSSVASYADLGHMSV 336

Query: 300 ASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +    E +  +   I EV+ S+  + +   E+ +   ++   L+   E +  R   I K
Sbjct: 337 YAGCQPERLGQVAGVIREVLDSVAADGLSDAEVARAKGQLRGGLVLGLEDTSSRMSRIGK 396

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF---SSTPTLAILGP 403
             +     L  +  I  I A+T ED+  +A+ +        + A++GP
Sbjct: 397 NELNYARYLGVDDTIARIDAVTTEDVCALARTLLRRPGGVSSAAVVGP 444


>gi|300788162|ref|YP_003768453.1| zinc protease [Amycolatopsis mediterranei U32]
 gi|299797676|gb|ADJ48051.1| putative zinc protease [Amycolatopsis mediterranei U32]
          Length = 454

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/404 (32%), Positives = 212/404 (52%), Gaps = 10/404 (2%)

Query: 10  SGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ VITE +P   SA V + +  GSR+E     G AH+LEH+LFKGT  R A +I EEI
Sbjct: 34  GGLRVITERVPASRSATVGLWVGIGSRDEPATVAGAAHYLEHLLFKGTKHRDATQIAEEI 93

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG+ NA+T+ EHT Y+A VL   +PLA++++ D++ ++     D++ ER+VVLEEI 
Sbjct: 94  DAVGGEFNAFTAKEHTCYYAQVLDADLPLAVDLVTDVVFDALCTDRDMDMERSVVLEEIS 153

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F   +  D  +GRP+LG  ++I   +P  + +F  R YT  RM +  
Sbjct: 154 MRDDDPEDLLHETFVTAILGDHALGRPVLGTEKSIVEMSPAALRNFYKRRYTLPRMVLSV 213

Query: 189 VGAVDHEFCVSQV-----ESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
            G +DH   +  V     E      +    +E       V    +   D  + H+MLG  
Sbjct: 214 AGNIDHNQVLRLVRKALGERLTGTATPIAPREGRARIKTVPKLALHTDDTEQAHVMLGLR 273

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
             +      +  ++L + LG GMSSRLFQE+RE+RGL Y + +   +++D G + + +  
Sbjct: 274 SLSRHDDRRFALSVLNAALGGGMSSRLFQEIREQRGLAYQVYSSVASYADTGHMAVYAGC 333

Query: 304 AKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
             E +  +   I EV+  + ++ + + E+ +   ++   ++   E +  R   I K  + 
Sbjct: 334 QPEKLGDVAGVIREVLDKVGVDGLTEAEVARAKGQLRGGIVLGLEDTSSRMSRIGKNELN 393

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFS---STPTLAILGP 403
            G  L  +  I  I A+T ED+  +A+ +F+        A++GP
Sbjct: 394 YGHYLGVDDTIARIDAVTTEDVCALARTLFARPGGVSAAAVVGP 437


>gi|31789376|gb|AAP58493.1| putative protease [uncultured Acidobacteria bacterium]
          Length = 444

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 127/397 (31%), Positives = 216/397 (54%), Gaps = 3/397 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +ITE MP + S  + V +  GSR+E  E  G+AHF+EHMLFKGT  R+A++I + I
Sbjct: 34  NGLRLITETMPHVRSVTIGVWLMRGSRHESDERSGIAHFVEHMLFKGTDTRSAEDIAQAI 93

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG ++A+T+ E+ SY+  VL EH+PLA++++ D++   +F+  +IERE+ V+LEEI 
Sbjct: 94  DSIGGQLDAFTAKEYASYYIKVLDEHLPLAVDLLSDIVLRPAFSAEEIEREKKVILEEIK 153

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +   F++  W+   +GRPILG  ET+ SFT   ++ +    Y A  M +  
Sbjct: 154 MVEDTPDDLVHELFTQHFWEGHPLGRPILGSKETVESFTATSLLDYFHGAYVARNMIISA 213

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G ++H      VE  F          S +    V     + ++L + H+ LG N     
Sbjct: 214 AGNLEHAHVRELVERAFGAVPSEGEPFSAEAPRVVPQVITRTKELEQSHICLGTNSYPQN 273

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D Y++ I+ ++LG  MSSRLFQ VREKRGL Y++ +    + D G + I +  + + +
Sbjct: 274 HDDRYVSYIMNTVLGGSMSSRLFQNVREKRGLAYAVFSGLSAYRDAGNITIYAGCSNQAV 333

Query: 309 MALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +    VE ++ +    +   E+ +    +   L+ S E +  R   +++Q ++     
Sbjct: 334 GEVIDLCVEELRGMKRAPVPDSELRRAKDHLKGSLMLSLENTASRMSHLARQEIYFDRHF 393

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLA-ILGP 403
             ++ +  +  +T  D+  VA+ +FS     A +LGP
Sbjct: 394 GLDETLAGVERVTDADVQRVAQDLFSDGSLAATVLGP 430


>gi|251772267|gb|EES52837.1| Processing peptidase [Leptospirillum ferrodiazotrophum]
          Length = 411

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 138/401 (34%), Positives = 227/401 (56%), Gaps = 7/401 (1%)

Query: 9   SSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           S+G+ V ++ V    SA + V +RAGSR E  +E GM HFLEHM FKGT  R A+EI  E
Sbjct: 9   SNGLAVYSDPVTSSRSAAIGVWVRAGSRYESPKEAGMTHFLEHMCFKGTPSRNAQEIANE 68

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           ++ +GG++NA+TS E T ++A +L E+V  A  ++GD+L+ S F+  +++RER VV+EEI
Sbjct: 69  MDFLGGEMNAFTSQEMTCFYAHLLTENVSRAALLLGDLLTRSVFDGEELDRERGVVIEEI 128

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
             S DD  D +     E  +    + RPILG  E++SSF+ E + S+  RNY +  M+V 
Sbjct: 129 AESRDDPDDLVTQNLYEAHFGSHPLSRPILGTEESLSSFSREDVQSYFRRNYHSGSMFVT 188

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG--GEYIQKRDLAEEHMMLGFNGC 245
             G          +E  F+    A  +     + ++   G+  +++ L + H+ +G  G 
Sbjct: 189 VSGRFSWPSLRESLEQAFSDLPQAPSQRMEDRSAFLPAYGKTQKEKKLEQVHVAIGMPGL 248

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
                D  L  +L   LG GMSSRLFQEVREKRGL YS+ +  ++F+D G++ I+++T  
Sbjct: 249 PVAHPDQTLLRLLNVHLGGGMSSRLFQEVREKRGLAYSVYSTGQSFADGGLVRISASTRP 308

Query: 306 ENIMALTSSIVEVVQSLLENIE--QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
                L   + E + + LE++     E+ +   ++ + L+   E    R  ++ + +++ 
Sbjct: 309 SKKRELLEILGEEI-ARLESVPLTDEELSRAKNQVKSSLLLGLESIGTRMNKMGRDILYW 367

Query: 364 GSILCSEKIIDTISAITCEDIVGVAK-KIFSSTPTLAILGP 403
           G  +  E I   I + T EDI+ +A+ + FS++ +L++LGP
Sbjct: 368 GEEVPVETIEARIDSATPEDILRLARAQGFSASRSLSVLGP 408


>gi|158313042|ref|YP_001505550.1| peptidase M16 domain-containing protein [Frankia sp. EAN1pec]
 gi|158108447|gb|ABW10644.1| peptidase M16 domain protein [Frankia sp. EAN1pec]
          Length = 477

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 217/412 (52%), Gaps = 7/412 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P + S  + + +  GSR+E     G +H+LEH+LFKGT  R A
Sbjct: 58  VRRTVLPGGLRVVTEKVPGVRSVAIGIWVGVGSRDETPLTGGCSHYLEHLLFKGTPSRDA 117

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I   IE VGGD+NA+T+ E+T Y+A VL   + LA++++ DM++NS     D+E ER 
Sbjct: 118 LSISASIEAVGGDLNAFTAKEYTCYYARVLDVDMDLAIDVVCDMVANSLVTADDVEAERG 177

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M EDD  D +   F++ V    ++GRP+LG  +TI +   E +  +    Y  
Sbjct: 178 VILEEIAMHEDDPGDVVHDVFADAVLGSSVLGRPVLGTVDTIEALGRETVFDYYRERYAP 237

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF--NVCSVAKIKESMK---PAVYVGGEYIQKRDLAEE 236
             + V   G ++H+  + +V + F   +   A+ +E  +   P     G  +  R   + 
Sbjct: 238 PALVVSIAGNIEHDHALDRVVAAFADRLTGPARHQEVRRGEYPFPPPPGIVVTNRPTEQA 297

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H++LG  G +      Y   +L++ LG GMSSRLFQEVREKRGL YS+ +    F+D G+
Sbjct: 298 HVVLGTAGLSRHDPRRYALGVLSTALGGGMSSRLFQEVREKRGLAYSVYSFDNQFADAGL 357

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +         +     E V  + E+ I   E+++   +    L+ + E +  R   
Sbjct: 358 FGVYAGCTPGRADEVLEICREQVHRIAEHGITAEELERARGQNRGGLVLNLEDTGSRMSR 417

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           + K  +  G +L  ++++  + A+T +D+  VA ++      L ++GP  DH
Sbjct: 418 LGKSELVHGELLSVDEVLARVEAVTLDDVRAVAGELVDQPWALGVIGPFEDH 469


>gi|332655168|ref|ZP_08420909.1| peptidase, M16 family [Ruminococcaceae bacterium D16]
 gi|332516028|gb|EGJ45637.1| peptidase, M16 family [Ruminococcaceae bacterium D16]
          Length = 419

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 127/387 (32%), Positives = 213/387 (55%), Gaps = 6/387 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G  ++T+ +P + SA +   + AGSR+E   E+G AHF+EHM FKGT  R+A ++  E+
Sbjct: 9   NGARILTQRIPGVRSAALGFFVGAGSRHELASENGAAHFIEHMSFKGTATRSAGDLAREM 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NAYT+ EHT Y+A  L  H+  A++++ DML  S F+  D+E ER V+LEEIG
Sbjct: 69  DAIGGQVNAYTTKEHTCYYARCLDSHLDRAVDLLCDMLFASRFDQRDVEVERGVILEEIG 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D    R S  V+K   +GRPILG+  T+   T E +  +   +Y    M V  
Sbjct: 129 MYEDTPEDLCAERLSMAVYKGDSLGRPILGRASTLEKMTGEWLRQWQQEHYRPQAMVVSL 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESM-KPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G+   +   + VE    + ++ +   S  + A Y     ++K+ + + H++L F G +Y
Sbjct: 189 AGSFTQQHVDALVE---RLSALPQGPTSPGRQAYYRSAVTVRKKAIEQNHLILAFPGLSY 245

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
                Y   +L SILG G SSRLFQ++RE+RGLCYS+ ++  + +D G L I +  ++E 
Sbjct: 246 LDERRYQLLLLNSILGGGCSSRLFQQLREQRGLCYSVYSYVSDHADTGFLGIYTGLSREQ 305

Query: 308 IMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
                 ++  +V  L  +   Q E+D+   +  A ++   E    R   +   ++  G +
Sbjct: 306 EEPALETVRAIVSQLADQGPSQEELDRAREQAKANILMGLESVQARMSHLGSSMLLYGRV 365

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFS 393
              E+++     +T ED+  ++++IF+
Sbjct: 366 REPEELLAAYDQVTREDLRTLSQEIFT 392


>gi|189424898|ref|YP_001952075.1| processing peptidase [Geobacter lovleyi SZ]
 gi|189421157|gb|ACD95555.1| processing peptidase [Geobacter lovleyi SZ]
          Length = 432

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 222/399 (55%), Gaps = 6/399 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+T+ +P + +  + V +  G+R E+  EHG AHF+EH+LFKGT +RTA++I  EI
Sbjct: 18  NGVRVVTQQVPGMHTVSIGVWVSNGARCEQPSEHGTAHFIEHLLFKGTHRRTARQITREI 77

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+  Y+A  L   +P  ++I+ DM  +S+F   +IE+ER VVL+EI 
Sbjct: 78  DSLGGVLNAFTSYEYVCYYAKALARTLPQVVDILSDMFLHSTFPADEIEKERKVVLQEIK 137

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +D   + +  R  +  WK   +G PILG  + I S T + I+ F +  Y    + +  
Sbjct: 138 MRDDAPEESIHDRLHQSFWKGHPLGHPILGTDQIIGSITRDTILEFRNHWYRPSEILIAA 197

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKP-AVYVGGEYIQ--KRDLAEEHMMLGFNGC 245
            G V+H   V  ++  F+     + + +++P      G  ++  +RDL +  + LG  G 
Sbjct: 198 AGGVEHHVLVELLQESFSCLQPGEPRRTLQPHGRLATGRVMELCERDLEQTLICLGTEGL 257

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              S + Y   +L +ILG GMSSRLF+E+REKRGL YS+ ++  +F+D G L I + + +
Sbjct: 258 PTSSPERYSLMVLNAILGGGMSSRLFEEIREKRGLAYSVYSYVSSFADAGTLSIYAGSER 317

Query: 306 ENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
           E      + I+E +  L  E + Q E++    +I  K++ S E S      +++  +  G
Sbjct: 318 ERSCEAVTIILEEMSRLRDEAVPQDELEAAREQIKGKILMSLESSDSYMSRLARSYLNFG 377

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
                ++I+    A+T  D+  ++ ++F   T  + ++G
Sbjct: 378 RYQPLDEIMAGFDAVTAGDLQQLSARLFRDETLNIQVMG 416


>gi|322435185|ref|YP_004217397.1| peptidase M16 domain protein [Acidobacterium sp. MP5ACTX9]
 gi|321162912|gb|ADW68617.1| peptidase M16 domain protein [Acidobacterium sp. MP5ACTX9]
          Length = 436

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 215/397 (54%), Gaps = 8/397 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+R +   +G+ V+TE M  + S  +   I+ GSR+E   E+G++HF+EHM+FKGT  R+
Sbjct: 17  NIRKTILPNGMLVLTESMAHMRSISMGAWIKQGSRDESAPENGISHFVEHMVFKGTPTRS 76

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I  E++ +GG+++A+T  E   ++  VL E++P A++++ D++ N  F+P D+ERE+
Sbjct: 77  AQDIAREVDSIGGNLDAFTGKETVCFNIKVLDENLPPAMDVLSDLVLNPKFSPEDLEREQ 136

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M ED     +   F++  WK+  +GRPILG  +T+SSF  + +I      +T
Sbjct: 137 GVILEEIKMDEDSPDSVVHEVFTQNFWKNHPLGRPILGTVKTVSSFNQQTVIDHHKHRFT 196

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK--PAVYVGGEYIQKRDLAEEHM 238
              +     G ++H+  V +VE  F     A     +   P +       +K+ L +  +
Sbjct: 197 PANIVFSAAGHLEHDAFVERVERAFGHLPAAPPSPQIDQHPTITPHITLKKKKSLEQVQL 256

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            LG      QS D +   IL +ILG GMSSRLFQ VRE++GL YSI +    F D G L 
Sbjct: 257 CLGMPAPPVQSTDRFALYILNTILGGGMSSRLFQSVREEQGLAYSIFSELSPFRDTGSLS 316

Query: 299 IASATA---KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           I +  +    E  + LT S +  ++   E +   E+ +   ++ + ++   E S  R   
Sbjct: 317 IYAGVSLDKTEKTLQLTLSELRRLKE--EIVPDAELKRAKDQMKSNIVLGLESSSSRMSN 374

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           +++Q M+       E I+  I A+   D+  +A  +F
Sbjct: 375 LARQQMYFSRFFTVEDIVQEIDAVNPADLQRIANDLF 411


>gi|313901842|ref|ZP_07835263.1| peptidase M16 domain protein [Thermaerobacter subterraneus DSM
           13965]
 gi|313467885|gb|EFR63378.1| peptidase M16 domain protein [Thermaerobacter subterraneus DSM
           13965]
          Length = 432

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 217/395 (54%), Gaps = 10/395 (2%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+   SG+ V+TE +P + S  + +  R GSR E +E+ G+AH LEHM FKGT  R+A+
Sbjct: 19  RITTLPSGLRVVTETVPGVRSVTLGIWFRTGSRFEPEEQAGIAHLLEHMAFKGTESRSAR 78

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ E +++VGG +NAYTS E TS++  VL EH  L +EI+ DML +S  +  ++E+E+ V
Sbjct: 79  ELAEAVDRVGGQMNAYTSKEDTSFYIKVLDEHFGLGMEILADMLLHSRLDGEELEKEKRV 138

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M EDD  D +       +W    +GRP++G   T+ +   E ++ F  R+Y   
Sbjct: 139 ILEEIKMYEDDPEDVVHDLAVRTLWPGHPLGRPVIGFESTVGAVDREALVDFWRRHYEPG 198

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           R  +   G + H+  + +V+ +F   +    +    P V    E  +++ + + H+ +  
Sbjct: 199 RTVIAAAGHISHQQVLEEVQRWFGSWARTGERARQTPPVPQAAEAWRQKPVEQVHLCVVA 258

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              AY S + Y   +L+SILG   SSRLFQ +RE  GL YS+  +H ++SD GV  + +A
Sbjct: 259 PAAAYGSDEIYPEMVLSSILGGASSSRLFQVIREDHGLAYSVYTYHVSYSDAGVFGLYAA 318

Query: 303 TAKENIMALTSSIVEVV-----QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           T+ +      + ++E+V     +   E +   E+ +   +I A L+   E +  R   + 
Sbjct: 319 TSPDT----AARVLELVGRECRKVRREGVTAAELARTRDQIKANLLMGLESTGSRMNRLG 374

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           + ++    ++  E+++  + A+T E +   A+++ 
Sbjct: 375 RTLLMLDRVVTVEEVVRRVEAVTAEQVAAAAERLL 409


>gi|150016093|ref|YP_001308347.1| peptidase M16 domain-containing protein [Clostridium beijerinckii
           NCIMB 8052]
 gi|149902558|gb|ABR33391.1| peptidase M16 domain protein [Clostridium beijerinckii NCIMB 8052]
          Length = 435

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 143/390 (36%), Positives = 215/390 (55%), Gaps = 11/390 (2%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE +  ++S  V V ++ GSRNE  E +G++HF+EHM FKGT KRT+KEI+E+I
Sbjct: 9   NGLRIVTEKIEHLNSISVGVMVQNGSRNESPEVNGISHFIEHMFFKGTDKRTSKEIMEDI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+TS E T Y+   L  H+ L L+++ D+L N+ F+P +IE+E+ VV+EEI 
Sbjct: 69  ENVGGQINAFTSKEATCYYIKALDTHLDLTLDVLSDILLNAKFDPEEIEKEKGVVIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MSED   D LD   S+  + ++ +G PILG    + SFT EKI++F+S  YT     +  
Sbjct: 129 MSEDSPEDVLDDVHSKACFGNESLGYPILGTIPLVKSFTREKILNFISEKYTPYNSVISV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAK--IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
            G  + +     +  YF           E  K  + V   Y  K+++ + H+ LG  G  
Sbjct: 189 CGKFNDKELDELINKYFGEWKSKGEYTPEYDKTIIQVDSAY-AKKEIEQLHISLGLEGLP 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
           Y   + Y   +L +I G G SS LFQ+VRE+ GLCYSI+++ + F   G L I +   + 
Sbjct: 248 YGDENNYALVLLNNIFGSGASSILFQKVREELGLCYSITSYLQPFQGVGTLNIYAGLNR- 306

Query: 307 NIMALTSSIVEVVQSLLENI----EQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           N       +VE   +L        +Q EI+KE  KI A  I   E +  R    +K  +F
Sbjct: 307 NYGEKALEVVEKEITLFSKNGITDKQLEINKE--KIKANYILGLESTSSRMFSNAKTFLF 364

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              I   E++I  I  I  ++I  V ++ F
Sbjct: 365 RNKIKTQEEVIKKIDNIRKDNIQYVLERCF 394


>gi|218782572|ref|YP_002433890.1| peptidase M16 domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218763956|gb|ACL06422.1| peptidase M16 domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 418

 Score =  223 bits (568), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 133/412 (32%), Positives = 219/412 (53%), Gaps = 14/412 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++  +GI ++T  MP + S  + V +  G+R+E  E +GM HF+EHM+FKGT KR A
Sbjct: 5   VRKTELHNGIRIVTNSMPHVRSVSMGVWVNVGARDEPLENNGMCHFIEHMVFKGTEKRDA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  E++ +GG+ NA+T +E T YH  VL  H+P   +I+ D+  NS F P +  RER 
Sbjct: 65  FQIAAEMDAIGGNANAFTGMEDTCYHGKVLDTHLPRLTDILSDIFLNSVFQPEEFVRERA 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIGM +D   D +    SE ++ +  +GR +LG P+ + SF    ++ ++   Y  
Sbjct: 125 VILQEIGMQDDSPDDRVHLMTSEALFGEHPLGRSVLGSPDNLLSFEAHSLLDYLKEWYQP 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVA-----KIKESMKPAVYVGGEYIQKRDLAEE 236
            R+ +   G +DH+  VS     F   S       ++    KP + V     + RDL + 
Sbjct: 185 SRIVITAAGHLDHDDFVSLTGPAFEQVSPGPELPQRVPPKNKPELRV-----EHRDLEQV 239

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ L  +G        Y  +++  ILG  MSSRLFQEVREKRGL YS+ +   +FSD G 
Sbjct: 240 HLCLAASGLGAVDPRRYAYSLMNIILGGNMSSRLFQEVREKRGLAYSVYSFAPSFSDTGA 299

Query: 297 LYIASATAKENIMALTSSIV--EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           + + +     N + LT  ++  E+ +   + + ++E+      +   LI S E +  + L
Sbjct: 300 IGVYAGVDPSN-LDLTLDLIYKELSRLKGDKVSEQELRGAKEYVLGSLIMSAESTDNQML 358

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
             ++  +  G      +    I A+T E+I+ +A ++  +   LA+LGP  D
Sbjct: 359 RAAQNEINFGRHKPISESAKNIEAVTREEILELANELLEAPMALAVLGPVQD 410


>gi|119717400|ref|YP_924365.1| peptidase M16 domain-containing protein [Nocardioides sp. JS614]
 gi|119538061|gb|ABL82678.1| peptidase M16 domain protein [Nocardioides sp. JS614]
          Length = 453

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 133/415 (32%), Positives = 225/415 (54%), Gaps = 20/415 (4%)

Query: 4   RISKT--SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           R+ +T   SG+ VI+E    + SA + V +  GSR+E    HG +HFLEH+LFKGTT+R+
Sbjct: 43  RVRRTVLPSGLRVISEHQAGVRSAAIGVWVGVGSRDESPSLHGCSHFLEHLLFKGTTERS 102

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG+ NA+T+ E+T +HA VL E +PLA++++GDM++ S+    D+E ER
Sbjct: 103 ALDISVALDAVGGEFNAFTAKEYTCFHARVLDEDLPLAVDVLGDMITASTLTAEDVEAER 162

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+EI M +DD  D +   F+E  W D  +GRPI G   +I S + +++  F  R+Y 
Sbjct: 163 DVILDEIAMHDDDPDDVVHNLFAEQAWGDTPLGRPIAGTVGSIRSLSRDQVRRFYRRHYR 222

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN-----------VCSVAKIKESMKPAVYVGGEYIQ 229
              + V   G VDH   V QV + F            V      ++ ++P V        
Sbjct: 223 PANVVVAAAGNVDHAQLVRQVRTAFARNGWLDGRDTPVVPRHGTRKRVRPGVLA-----T 277

Query: 230 KRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHE 289
            R   + +++LG  G        +   +L + LG G SSRLFQEVRE+RGL YS+ +   
Sbjct: 278 TRPFEQVNVVLGMEGLRRDDDRRFALGVLNTALGGGTSSRLFQEVRERRGLAYSVFSFAT 337

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQER 348
           + +D+G++ ++       +  + + + E +  + E+ I   E+ +   ++   L+   E 
Sbjct: 338 HHADSGLVGVSVGCLPNKLDDVLAVVREELAKVAESGITAEELARGKGQLRGGLVLGLED 397

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           S  R   I K  +    ++  +++I  I  +T E++  +A ++F+    LA++GP
Sbjct: 398 SASRMSRIGKAELVHDRLMSIDEVIARIDGVTLEEVQSIAAEVFARPEILAVVGP 452


>gi|126652560|ref|ZP_01724725.1| zinc protease [Bacillus sp. B14905]
 gi|126590688|gb|EAZ84804.1| zinc protease [Bacillus sp. B14905]
          Length = 407

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 225/405 (55%), Gaps = 5/405 (1%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++    +G+ +++E +  + S  + + + AGSR E  EE+G+ HF+EHMLFKGT  R+A
Sbjct: 2   VQVHTCQNGVRIVSEQINHVRSVALGIFVNAGSRYELPEENGITHFIEHMLFKGTPSRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE +++GG++NA+TS E+T Y+A VL  H  LA+ I+ DM  NS+F   ++E+ER 
Sbjct: 62  RQIAEEFDRIGGELNAFTSKENTCYYAKVLDHHAELAVSILADMFFNSTFAEEELEKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI MSED   D +  +   +++ +  +GRPILG   T+ +FT E I  +++++Y  
Sbjct: 122 VVLEEILMSEDAPDDDVHEKLWSVMYPNDALGRPILGSAATLKTFTAEAIRHYMAKHYGP 181

Query: 182 DRMYVVCVGAVDHEF--CVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + + +   G +  +    + Q+   +   +VA       P+ +  GE  + RD  + H+ 
Sbjct: 182 ESVVISIAGNISPQLMATIEQLFGQYQPSTVAIAPVLTNPSFH-PGEISKIRDTEQAHLA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + +     +  D Y    L +I+G  MSSRLFQEVRE+RGL YSI ++   ++D G   I
Sbjct: 241 ISYPAIGVKDPDMYSFIALNNIIGGNMSSRLFQEVREERGLAYSIFSYQSCYADVGAFTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
             +T+++ +  L  +I   +  ++   + + E+D    ++    +   E +  R      
Sbjct: 301 YGSTSRQQLSQLQHTIDATLLDIVAGGVTEEELDNAKEQLKGSFVLGLEGTGARMNRNGT 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +        ++++ +I A++ + +  +  KI  + P ++I+GP
Sbjct: 361 SELVHRKHRTVDEVLASIEAVSMDSVDRLIAKILKAEPAISIIGP 405


>gi|88855415|ref|ZP_01130079.1| zinc protease [marine actinobacterium PHSC20C1]
 gi|88815322|gb|EAR25180.1| zinc protease [marine actinobacterium PHSC20C1]
          Length = 456

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 134/415 (32%), Positives = 219/415 (52%), Gaps = 15/415 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +   SG+ +++E +P   SA V   + AGSR+E     G  HFLEH+LFKGT  R+A
Sbjct: 24  VRRTVLPSGVRILSEQVPGARSATVGYWVAAGSRDELTGTFGATHFLEHLLFKGTPSRSA 83

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I    + VGG+ NA T+ E+T Y+A V    +P+A+E+IGDML++S  +P++   ER 
Sbjct: 84  LDIAVSFDAVGGEHNAMTAKEYTCYYAKVQDIDLPMAIEVIGDMLTSSLIDPTEFSNERG 143

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D    RF E V+ D  +GRPI G PETI++ + + +++    NY  
Sbjct: 144 VILEELAMADDDPTDVASERFFEAVFGDHPLGRPIGGSPETINAISRDSVVAHYRGNYRP 203

Query: 182 DRMYVVCVGAVDHEFCVSQVES---------YFNVCSVAKIKESMKPAVYVGGE----YI 228
             + +   GAVDH+  V+ V +               VA+ + +      +G      ++
Sbjct: 204 QDLVITVAGAVDHDVLVAAVTACLVAAGWDLSLYAAPVARRERTAAVPSAIGSPVQSLHV 263

Query: 229 QKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHH 288
             R + + +++ G  G +          +L SILG GMSSRLFQEVREKRGL YS+ +  
Sbjct: 264 TPRPIEQANIIAGVEGLSATDERRATLTVLNSILGSGMSSRLFQEVREKRGLAYSVYSFA 323

Query: 289 ENFSDNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQE 347
            ++SD GV  I +  +      +T  ++E    L    +   EI +   ++      + E
Sbjct: 324 PSYSDAGVFGIYAGCSPAKSAQVTELMLEEFTKLGAAPVTDEEISRAVGQLRGASALALE 383

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            S  R   + +  +  G  +  +  I  ISA+T + I  +A+++ S   ++A +G
Sbjct: 384 DSDSRMSRLGRSELTLGEFVDLDTSIARISAVTADGIQELARELSSRPLSIAAVG 438


>gi|108799068|ref|YP_639265.1| peptidase M16-like protein [Mycobacterium sp. MCS]
 gi|119868183|ref|YP_938135.1| peptidase M16 domain-containing protein [Mycobacterium sp. KMS]
 gi|126434671|ref|YP_001070362.1| peptidase M16 domain-containing protein [Mycobacterium sp. JLS]
 gi|108769487|gb|ABG08209.1| peptidase M16-like protein [Mycobacterium sp. MCS]
 gi|119694272|gb|ABL91345.1| peptidase M16 domain protein [Mycobacterium sp. KMS]
 gi|126234471|gb|ABN97871.1| peptidase M16 domain protein [Mycobacterium sp. JLS]
          Length = 429

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 134/413 (32%), Positives = 217/413 (52%), Gaps = 15/413 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RT
Sbjct: 5   TVRRTTLPGGLRVVTERIPSVRSASVGVWVNVGSRDEGPTVAGAAHFLEHLLFKSTPTRT 64

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++        D+E ER
Sbjct: 65  AVDIAQAVDAVGGELNAFTAREHTCYYAHVLDADLELAVDLVADVVLRGRCAVEDVEVER 124

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +VVLEEI M +DD  D L   F   ++    +GRP++G  E+I + T  ++ SF  R Y 
Sbjct: 125 DVVLEEIAMRDDDPEDTLGDVFLSAMFGSHPVGRPVIGSVESIEAMTRNQLHSFHVRRYV 184

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN---VCSVAKIKESMKPAVYVGGEYIQ--KRDLAE 235
            +RM +   G ++H+  V+    YF    +   + +          G   +Q   RD  +
Sbjct: 185 PERMVLAVAGNIEHDDVVAMARKYFGPRLIRGQSAVPPRKGTGRVPGRPTLQLINRDAEQ 244

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ +G           +   +L + LG G+SSRLFQE+RE RGL YS+ +  + FSD+G
Sbjct: 245 THLSMGVRTPGRHWDHRWALAVLNTALGGGLSSRLFQEIRETRGLAYSVYSTVDTFSDSG 304

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKEC----AKIHAKLIKSQERSY 350
            L I +A   E        +V V  ++LEN+ +  I + EC      +   L+   E S 
Sbjct: 305 ALSIYAACQPERF----DEVVRVTTAVLENVARDGITESECRIAKGSLRGGLVLGLEDSG 360

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   I +  +  G     +  ++ I A+T +++  VA+++ + +   A+LGP
Sbjct: 361 SRMHRIGRSELNYGKHRSIDHTLEQIGAVTRDEVNAVARQLLTRSFGAAVLGP 413


>gi|330466374|ref|YP_004404117.1| peptidase M16 domain-containing protein [Verrucosispora maris
           AB-18-032]
 gi|328809345|gb|AEB43517.1| peptidase M16 domain-containing protein [Verrucosispora maris
           AB-18-032]
          Length = 468

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 124/414 (29%), Positives = 222/414 (53%), Gaps = 14/414 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P + S    + +  GSR+E     G AHFLEH+LFKGT KR 
Sbjct: 51  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVAVGSRDETGPTAGAAHFLEHLLFKGTHKRG 110

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S   P+D+E ER
Sbjct: 111 ALEISSSIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLEPADVETER 170

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  +T++  T  +I +F  R Y 
Sbjct: 171 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTSDTVTPMTRRQIQTFYRRRYV 230

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSV--------AKIKESMKPAVYVGGEYIQKRD 232
           A ++ +   G +DH   V  V        +             +           +Q ++
Sbjct: 231 APQIVIAAAGNLDHAAVVRLVRQALRGTPLDTEPASPAPHRPAAPAVRTRAASTVVQVKE 290

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG           +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++   ++
Sbjct: 291 TEQAHVVLGCPAIDRLDERRFALGVLNNVLGGGMSSRLFQEIREQRGLAYSVYSYASQYA 350

Query: 293 DNGVLYIASATAK---ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D+G+  + +  A    + ++ LT +  E+ ++  + I + E+ +         +   E +
Sbjct: 351 DSGLFGVYAGCAPGRVDEVLELTRT--ELARTAEQGITEAELARGKGMSKGSFVLGLEDT 408

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   ++K  +  G+++   +++D + ++T +D+  +A  + +   +LA++GP
Sbjct: 409 GSRMSRLAKGELLYGNLMPVNELLDRVDSVTLDDVNTLAADLLARPMSLAVVGP 462


>gi|331698424|ref|YP_004334663.1| processing peptidase [Pseudonocardia dioxanivorans CB1190]
 gi|326953113|gb|AEA26810.1| processing peptidase [Pseudonocardia dioxanivorans CB1190]
          Length = 446

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 132/411 (32%), Positives = 218/411 (53%), Gaps = 15/411 (3%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           S+   GI ++TE +P + S  + + I  GSR+E  E+ G AHFLEH+LFKGT +R+A  I
Sbjct: 22  SELPGGIRLVTETVPGVRSVSLGIWIGIGSRDETPEQAGAAHFLEHLLFKGTQRRSASGI 81

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            EEI+ VGG++NA+T+ EHT Y+A VL   V LA++++ D+++++    +D E ER VVL
Sbjct: 82  AEEIDAVGGELNAFTAKEHTCYYAQVLDTDVALAVDLLADVVTDARLAHADTELERGVVL 141

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           EEI M +DD  D L   F   ++ D  +G PI+G  E+I + + E + +F    YT  RM
Sbjct: 142 EEIAMRDDDPEDLLGELFDAALFGDHPLGLPIVGSEESIRAMSRETLHAFWRSEYTTPRM 201

Query: 185 YVVCVGAVDHEFCVSQV---------ESYFNVCSVAKIKESMKPAVYVGGE--YIQKRDL 233
            V   G +DH                 +   V  V   +    PA   GG+   +   D 
Sbjct: 202 VVAAAGNLDHAHLAELAGAALAAAAERTGPGVVPVPPRRGGAHPA--GGGDRLVLHSDDT 259

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + H++LG  G            +L + LG G+SSRLFQ+VRE+RGL YS+ +   +++D
Sbjct: 260 EQAHLLLGVPGVDRHDPRRQALAVLNTALGGGLSSRLFQQVREQRGLAYSVYSAAASYAD 319

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLR 352
            G L + +  A E +  +   + +V+  +  N +   E+ +    +   L+ + E +  R
Sbjct: 320 AGSLSVYAGCAPERLGEVVGVVRDVLSDVAANGLTTAELVRAQGSLRGGLVLASEDTASR 379

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              I +  +  G      + +D I+ +T +++  VA+++ +   T A++GP
Sbjct: 380 MNRIGRSELDHGRQRSLSESLDRIAGVTADEVSAVARELLARPLTAAVVGP 430


>gi|225871754|ref|YP_002753208.1| insulinase family protein [Acidobacterium capsulatum ATCC 51196]
 gi|225791408|gb|ACO31498.1| insulinase family protein [Acidobacterium capsulatum ATCC 51196]
          Length = 424

 Score =  222 bits (566), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 127/394 (32%), Positives = 215/394 (54%), Gaps = 3/394 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R +   +G+T++TE M  + S  + V I  GSR+E  E +G++HF+EHM+FKGT  R+
Sbjct: 6   DIRRTVLPNGLTILTERMEHVRSVAMGVWINTGSRHELPEVNGISHFVEHMVFKGTRNRS 65

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I  E++ +GG+++A+T  E   ++  VL EHVP A E++ D++ N  F+  +I RER
Sbjct: 66  AQRIAREVDAIGGNMDAFTGKETICFNMKVLDEHVPTATEVLSDLVLNPVFSHEEITRER 125

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI + ED+    +   F +  WKD  +G+PILG  ET+  F  + +  +    + 
Sbjct: 126 GVVLEEIKIDEDNPDYLVHELFVQSFWKDHPLGKPILGTRETVKRFEQDTLFGYYGDRFL 185

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGG-EYIQKRDLAEEHMM 239
              M     G ++H+  V Q+   F      + + S  P       +   K+ L +  + 
Sbjct: 186 GGNMTFSAAGHLEHDAFVEQIRRRFESLPAGRSELSQTPPTTTARIQMRNKKSLEQVQLC 245

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG       S D Y+T +L +ILG GMSSRLFQ VRE+ GL YSI +    + D G L +
Sbjct: 246 LGVPAPHVSSEDRYITLMLNTILGGGMSSRLFQTVREEHGLAYSIYSDLAPYRDTGSLCV 305

Query: 300 ASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T+  N+  + + ++  +Q +  E +   E+ +   ++   L+ S E S  R   +++
Sbjct: 306 YAGTSAANVERMITLVMAELQRMKQEPVTADELRRAKDQLKGNLLLSLESSMSRMSNLAR 365

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           Q M+ G     + I+  + A+T E I+ +A+++F
Sbjct: 366 QEMYFGHFFSFDDILTQVEAVTVEQIMQLAQRLF 399


>gi|299534732|ref|ZP_07048062.1| zinc protease [Lysinibacillus fusiformis ZC1]
 gi|298729820|gb|EFI70365.1| zinc protease [Lysinibacillus fusiformis ZC1]
          Length = 407

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 222/405 (54%), Gaps = 5/405 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++    +G+ +++E +  + S  + + + AGSR E  EE+G+ HF+EHMLFKGTT R+A
Sbjct: 2   VQVHTCQNGVRIVSEQIDHVRSVALGIFVNAGSRYELPEENGITHFIEHMLFKGTTTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE +++GG++NA+TS E+T Y+A VL  H  LA+ I+ DM  NS+F   ++E+ER 
Sbjct: 62  RQIAEEFDRIGGELNAFTSKENTCYYAKVLDHHAELAVTILADMFFNSTFAEEELEKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI MSED   D +  +   +++ +  +GRPILG   T+ +FT   I  ++ ++Y  
Sbjct: 122 VVLEEILMSEDAPDDDVHEKLWGVMYPNDALGRPILGTAATLKTFTAAAIRQYMDKHYGP 181

Query: 182 DRMYVVCVGAVDHEF--CVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + + +   G +  +    +  +  ++     A       P+ Y  GE  + RD  + H+ 
Sbjct: 182 ESVVISIAGNISSQLMQTIEDLFGHYQPSPHAMAPVLTNPSFY-PGEITKIRDTEQAHVA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + +     +  D Y    L +I+G  MSSRLFQEVRE+RGL YSI ++   ++D G   I
Sbjct: 241 ISYPAIGVKDPDMYSFIALNNIIGGNMSSRLFQEVREERGLAYSIFSYQSCYADVGAFTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
             +T+++ +  L  +I   +  ++   + + E+D    ++    +   E +  R      
Sbjct: 301 YGSTSRQQLAQLQHTIDATLLDIVAGGVTEEELDNAKEQLKGSFVLGLEGTGARMNRNGT 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +        ++++ +I A++ E +  +  KI  + P ++I+GP
Sbjct: 361 SELVHRKHRTVDEVLKSIDAVSMESVDRLIAKILKAEPAISIIGP 405


>gi|283853299|ref|ZP_06370549.1| peptidase M16 domain protein [Desulfovibrio sp. FW1012B]
 gi|283571339|gb|EFC19349.1| peptidase M16 domain protein [Desulfovibrio sp. FW1012B]
          Length = 419

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 134/403 (33%), Positives = 210/403 (52%), Gaps = 3/403 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI++  +G+ V+TE MP + +A + V I AGSR+E   + GMAH  EHM FKGTT R A 
Sbjct: 12  RITRLPNGVRVVTEAMPLVKTASLGVWIEAGSRHEGPGQEGMAHLWEHMAFKGTTHRDAL 71

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I +E++ +GG  NA+TS E T +H  V+  H   A +I+ D+  N + +P ++ RE+ V
Sbjct: 72  AIAKELDILGGLANAFTSREATCFHIRVMDAHFDRAFDIVSDIALNPALDPEELGREQAV 131

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L+EI M E+   D +   F    WK+  I  PI G PE++++ TP+ ++ +   +Y  +
Sbjct: 132 ILQEISMVEETPEDKVHEDFWAAAWKNPAIAHPITGTPESVTAATPKTLLDWRHAHYRPE 191

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            + VV  GAV HE  ++  E+ F     A          Y       +R+  + H++L F
Sbjct: 192 AIVVVAAGAVSHEALLALAEATFGRLPAAPAPAKAPAGPYTPPRLAVRRESEQNHVILAF 251

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              A  S D +   +LA++LG  MSSRLFQEVREKRGL YSI A     SD G+  I +A
Sbjct: 252 PSVANTSPDRFAHTLLATLLGGNMSSRLFQEVREKRGLAYSIYASLNGLSDTGLFEIQAA 311

Query: 303 TAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
              E    L + +  E+       +   E+D     +   L    E +  R + +++ ++
Sbjct: 312 VEPERTEELLAVVRAELAAVAGGAVTAEELDHTREHLKGLLYLGAESTENRMMRLARNIL 371

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
                +  E+    +  +T  D+  +A+  F+   T L ILGP
Sbjct: 372 LFDRHIPIEETAAELDKVTLSDLAAIARAAFTPELTGLCILGP 414


>gi|302874670|ref|YP_003843303.1| peptidase M16 domain-containing protein [Clostridium cellulovorans
           743B]
 gi|307690716|ref|ZP_07633162.1| peptidase M16 domain-containing protein [Clostridium cellulovorans
           743B]
 gi|302577527|gb|ADL51539.1| peptidase M16 domain protein [Clostridium cellulovorans 743B]
          Length = 416

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 212/391 (54%), Gaps = 11/391 (2%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + +  GSRNE  E +G++HF+EHMLFKGT  R AKEIVE I
Sbjct: 9   NGLRVVLENIDHVSSVSVGLWVENGSRNETAESNGISHFIEHMLFKGTYNRNAKEIVEAI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E  GG INA+T  E T Y+   L  H+  +  ++ DM+ NS F+P DIERE+ VV+EEI 
Sbjct: 69  EDYGGQINAFTGKEATCYYTKTLDSHMERSFGVLSDMIFNSKFDPVDIEREKKVVIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MSED   D L    S  +W D  I  PILG  ET+ SFT E+++ ++   Y  +   +  
Sbjct: 129 MSEDSPEDVLSDLHSIAIWGDDPIALPILGTEETVKSFTREQLLEYIECRYIPENCVLSI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPA--VYVGGEYIQKRDLAEEHMMLGFNGCA 246
            G +D +     V  YF   S +K K+  K +  ++     ++++ + + H+ LG  G  
Sbjct: 189 CGNIDFDVTTKLVNKYFGSWS-SKNKKVTKHSTPIFQNKFLVKQKPIEQVHLSLGIKGIE 247

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA---- 302
             +RD Y  +++ ++ G   SS LFQ++RE+RG+CYSI +++  + + G++ + +     
Sbjct: 248 TGNRDNYPLHVINNVFGGTASSILFQKLREERGMCYSIYSYNSPYMNTGIMNVYAGLNPK 307

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
             KE I+ + + +  +V+   + I +  ++K   ++    +   E +  +     K  +F
Sbjct: 308 DTKEAIIQIKNELSILVE---KGISKETLNKTKEQLKGNYMLGLESTSNKMFANGKNALF 364

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
              I   + I+  I+ IT EDI  V K  F 
Sbjct: 365 LNRINTPKDIMKKINDITLEDINRVMKNTFG 395


>gi|221633484|ref|YP_002522709.1| processing protease [Thermomicrobium roseum DSM 5159]
 gi|221156418|gb|ACM05545.1| processing protease [Thermomicrobium roseum DSM 5159]
          Length = 421

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 133/415 (32%), Positives = 221/415 (53%), Gaps = 6/415 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ + +   +GI ++T  MP + SA V V +  GSR E     G++HFLEHMLFKGT +R
Sbjct: 1   MDYQKTCLPNGIRIVTSRMPHVRSATVIVYVGVGSRYESDRLAGISHFLEHMLFKGTERR 60

Query: 60  TAKEIVEE-IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
               ++ E IE VGG +NA T  EHT Y   V   H+ LA +++ DML +S F+P ++E+
Sbjct: 61  PDPVLISEAIEGVGGMMNASTGREHTDYWVKVPSRHLELAFDVLADMLRHSLFDPGELEK 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           ER+V++EEI    D   D++       +W    +GRPI+G  ET+ + T +++I+++ ++
Sbjct: 121 ERHVIVEEIHGIRDTPDDYVHDLVDRALWNGHPLGRPIIGSEETVEAITRDELIAYLEQH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--KRDLAEE 236
           Y ADR+ V   G + HE  +  V+ YF         +     +      I+  +R   + 
Sbjct: 181 YRADRLVVAAAGDLTHEQVIELVQRYFGDLEPGTPADPHPARLSDARPTIELLERPTEQA 240

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ L      Y+    ++  +L S+L  GMSSRLF+E+RE++GL Y +  +   ++D G 
Sbjct: 241 HLCLALPALPYRDERRFVQGMLDSVLSSGMSSRLFKEIRERQGLAYEVYGYLREYADVGQ 300

Query: 297 LYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             I + T  E    AL +   E+ + + E +   E+++       +++   E S   A  
Sbjct: 301 AVIYTGTDVERAERALRAVRGELEKLVREPVPDDELERTKELRVGRIVMGLEDSRAVASW 360

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVP 409
           I  Q +  G +L  E++I  I A+T E+I  +A+++F      LA++GP  D  P
Sbjct: 361 IGGQELVFGEVLTPEEVIARIRAVTSEEIQALAQELFQPERFALAVIGPFADVEP 415


>gi|320106613|ref|YP_004182203.1| peptidase M16 domain-containing protein [Terriglobus saanensis
           SP1PR4]
 gi|319925134|gb|ADV82209.1| peptidase M16 domain protein [Terriglobus saanensis SP1PR4]
          Length = 442

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 222/407 (54%), Gaps = 6/407 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+R +  S+G+ V+TE MP + S  +   +R GSR+E +E +G++HF+EHM+FKGTT R+
Sbjct: 22  NIRTTTLSNGLLVLTESMPHMRSVSMGCWVRTGSRDEPKELNGISHFVEHMVFKGTTTRS 81

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
            +++  E++ +GG+++A+T  E   ++  VL  ++  ALE++ D++ N +FN  D+ RE+
Sbjct: 82  QQQLSREVDAIGGNLDAFTGKETVCFNIKVLDTNLDTALELLSDLVLNPTFNAEDLAREQ 141

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+LEEI M ED+    +   +++ +W    +GRPILG  ET+SSF  E + +F    ++
Sbjct: 142 SVILEEIKMDEDNPDYLVHEIYTQKLWPSDSLGRPILGTVETVSSFNREIVAAFHHERFS 201

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
              M     G + HE  ++++E+ F      +   +     P +        K+ L +  
Sbjct: 202 PRNMVFSAAGHLSHEDLLAKIEARFGSLEDIAAEDLLHRHAPPMTPHITLHDKKSLEQVQ 261

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LG       S D Y   +L +ILG GMSSRLFQ VRE+ GL YSI +    F D G L
Sbjct: 262 LVLGVPAPPVNSPDRYALYLLNTILGGGMSSRLFQSVREEAGLAYSIYSEMNPFRDTGSL 321

Query: 298 YIASATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + + T+ E    +   I+ E  +   E I   E+ +   ++   ++   E S  R   +
Sbjct: 322 AVYAGTSIEKTPEMLRRILAEFTRLKNEPIPDDELLRAQTQLKGNIVLGLESSNARMSNL 381

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILG 402
           ++Q M  G     +++++ I A+T  D+  +A ++      +L +LG
Sbjct: 382 ARQQMNFGRFASVDEVVEQIDAVTPADMQRIANELLHQDKLSLTLLG 428


>gi|124515693|gb|EAY57202.1| Processing peptidase [Leptospirillum rubarum]
          Length = 411

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 134/399 (33%), Positives = 224/399 (56%), Gaps = 4/399 (1%)

Query: 9   SSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           ++G+ V  + MP   +A + V +R GSR E  EE G+ HFLEHM FKGTT R+A++I  E
Sbjct: 9   ANGVRVYWDPMPESRAASIGVWVRTGSRFEAAEEGGVTHFLEHMCFKGTTTRSAEDIANE 68

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           ++ +GG++NA+TS E TS++A VL E+   A  ++GD+L+NS F+P ++ERER VVLEE+
Sbjct: 69  MDFLGGEMNAFTSQEVTSFYATVLTENSRQAGNLLGDILTNSVFDPVELERERGVVLEEL 128

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
             S+DD  D +      + + D   G PILG  E+I+ F+   +  +  ++Y    ++V 
Sbjct: 129 AESKDDPEDRVMENLFRIYFGDHPFGAPILGTEESITRFSRLSVREYFKKHYHPGNLFVT 188

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKES-MKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
             G V  +  +  +E+ F   SV  +  S +   V       ++ D  + H+ LG  G  
Sbjct: 189 IAGNVHWDEVIDALENAFQNISVRNLSSSPLTTPVPTFSRMEEEDDYEQVHLCLGLRGLP 248

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
                     +L + LG GMSSRLFQEVREKRGL YS+ +   +FSD G++ I+++T   
Sbjct: 249 QPHPRQTALRVLTTHLGGGMSSRLFQEVREKRGLAYSVFSSPLSFSDGGIVRISASTRPS 308

Query: 307 NIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
               L S +VE ++ L +  +   E+ +   ++ + L+   E +  R  ++ + ++  G 
Sbjct: 309 RREELASVLVEELRRLEKIPLTSSELTRSKNQLKSSLLLGLESAGGRMSKMGRDLLNWGR 368

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGP 403
            +   +I   I  +T EDI+ +A+++ +     +++LGP
Sbjct: 369 EIAVTEIEQWIDQVTAEDILHLAQELKWGEEQAISVLGP 407


>gi|302871784|ref|YP_003840420.1| processing peptidase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574643|gb|ADL42434.1| processing peptidase [Caldicellulosiruptor obsidiansis OB47]
          Length = 422

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 129/405 (31%), Positives = 219/405 (54%), Gaps = 5/405 (1%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GI ++ E +  + +  + + + AGSR E +  +G++HF+EH+LFKGT  R++
Sbjct: 2   IKLYSLSNGIRLVYEKIDTVKTVSIGIWVLAGSRYETKMINGISHFIEHILFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEIV EIE +GG INA+T+ E+T ++  VL E +    +I+ D++ N      +IE+E+ 
Sbjct: 62  KEIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLQKGFDILSDLILNPVIAAEEIEKEKT 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M++DD  + L    ++++WK Q +  PI+GK  T+      KI S++   Y  
Sbjct: 122 VIIEEINMTKDDPEEMLYQSLNDLIWKSQALSYPIIGKESTVKKIDKTKIESYIKERYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN--VCS-VAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             + +   G    E  +  VE YF    CS    +   +   V+  G  I+ +   + H+
Sbjct: 182 QNIVISVAGNFAEEKLIEFVEIYFGDWKCSNKTDMSYCISKPVFNRGAVIKNKKSDQAHL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            + F G   +    Y   +L+SILG GMSSRLFQ +RE+ GL YSIS+    F D GVL 
Sbjct: 242 AVTFEGFGQEDEKVYELLVLSSILGGGMSSRLFQRIREELGLVYSISSFVSTFKDAGVLI 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T  +NI A+   I+  +   L+  I   E++    +I   +I   E +  R   I 
Sbjct: 302 IYAGTNPKNIAAVYKEIMNQLNLFLKGEILPDEVEVAKQQIKGSIIFGLENTSSRMSNIG 361

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           K ++    I+  E I   I +I   +++  A+++ S   ++A++G
Sbjct: 362 KNMLLLNKIMEIEHITKIIDSIKYANVIDTAREVLSKEFSVAVVG 406


>gi|254519177|ref|ZP_05131233.1| peptidase M16 domain-containing protein [Clostridium sp. 7_2_43FAA]
 gi|226912926|gb|EEH98127.1| peptidase M16 domain-containing protein [Clostridium sp. 7_2_43FAA]
          Length = 435

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/385 (35%), Positives = 207/385 (53%), Gaps = 17/385 (4%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+TE +  ++S  V V ++ GSRNE  E +G++HF+EHM FKGT KRT+KEIV++I
Sbjct: 9   NGLRVVTEYIDHVNSISVGVMVQNGSRNEDLELNGISHFIEHMFFKGTEKRTSKEIVQQI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INAYTS E T Y+   L  H+ L++EI+ DML NS F+  +IE+E+ VV+EEI 
Sbjct: 69  ENVGGQINAYTSKEATCYYIKALNTHLDLSIEILADMLLNSKFDDEEIEKEKGVVIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           MSED   D LD   S+ ++ D  +  PILG  + I SF  +KI  FV  +Y      V  
Sbjct: 129 MSEDTPEDVLDNDSSKAIFGDNSLSYPILGTIDNIKSFNSKKIKKFVKSHYAPHNSVVSV 188

Query: 189 VGAVDHEFCVSQVESYFNVC-SVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G  D +  +  +E  F         K   K  + +       + + + H+ L F G  Y
Sbjct: 189 CGKFDEKELMKMLEENFGSWEGEGDYKPEYKTPILLPQSKYTNKPIEQLHINLSFKGLPY 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
                Y   +L ++ G G SS LFQ VRE+ GLCY+I ++ + +   G+  I +  +K++
Sbjct: 249 AHEKAYSLVLLNNVFGGGASSILFQNVREELGLCYTIYSYGQPYLGVGINNIYTGVSKQS 308

Query: 308 IMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS-- 365
                   ++V+   LE   +  I  E  +I+ + IK+   SY+  LE +   MF  +  
Sbjct: 309 ----ADKALDVINQELEKFAKEGISNEVLEINKEKIKA---SYILGLESTSSRMFSNAKS 361

Query: 366 ------ILCSEKIIDTISAITCEDI 384
                 I   E++I  I+ I  +DI
Sbjct: 362 MLLQNKIKTQEEVIKRINNINADDI 386


>gi|255524221|ref|ZP_05391180.1| peptidase M16 domain protein [Clostridium carboxidivorans P7]
 gi|296185342|ref|ZP_06853752.1| peptidase, M16 (pitrilysin) family protein [Clostridium
           carboxidivorans P7]
 gi|255512046|gb|EET88327.1| peptidase M16 domain protein [Clostridium carboxidivorans P7]
 gi|296050176|gb|EFG89600.1| peptidase, M16 (pitrilysin) family protein [Clostridium
           carboxidivorans P7]
          Length = 432

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 211/390 (54%), Gaps = 5/390 (1%)

Query: 7   KTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           K ++G+ V+ E +  ++S  V + +  GSRNE +   G++HF+EHM FKGT KRTA EI 
Sbjct: 6   KLNNGLRVVVENIDYVNSVSVGLWVENGSRNEDKTNSGISHFIEHMFFKGTKKRTALEIA 65

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           E IE VGG INA+T  E T ++   L  H+ L+L++I DML NS F+  DIE+E+ VV+E
Sbjct: 66  ECIEDVGGQINAFTGKEATCFYIKALDSHLELSLDVISDMLFNSKFSTEDIEKEKGVVIE 125

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M+ED   D L    SE +W +  I  PILG  +T+ SFT ++I  ++S  Y  +   
Sbjct: 126 EINMNEDSPEDVLSDLHSEAIWGEDPISLPILGDIDTVKSFTKDQIEKYISSYYIPENSI 185

Query: 186 VVCVGAVDHEFCVSQVESYFN--VCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           +   G  D       VE YF     +  KI    KP +       +K+ + + H+ LG  
Sbjct: 186 ISIAGKFDMSNIEKLVEKYFGHWNSNNKKITIYSKPELQ-QNHLFKKKSIEQLHLSLGIP 244

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G    + + Y   +L++I G G SS LFQ++RE++G CYSI ++   F++ GVL I ++ 
Sbjct: 245 GIETGNDNIYTLLLLSNIFGGGASSILFQKIREEKGFCYSIYSYVSAFNNTGVLNIYTSL 304

Query: 304 AKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
             +    +  +I E V+   +  + + ++ K   ++    I   E +  R     K V+F
Sbjct: 305 NPKYAADVVFTIKEEVEKFTKTGVSKEKLAKAKEQLKGSYILGLESTSSRMFNNGKSVLF 364

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              I   E+II+ I+ I  E +  + KK F
Sbjct: 365 LNRINTPEQIIEKINKIDEESLNFIMKKSF 394


>gi|229820963|ref|YP_002882489.1| peptidase M16 domain protein [Beutenbergia cavernae DSM 12333]
 gi|229566876|gb|ACQ80727.1| peptidase M16 domain protein [Beutenbergia cavernae DSM 12333]
          Length = 445

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 127/419 (30%), Positives = 218/419 (52%), Gaps = 17/419 (4%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    GI V+TE MP   S  +   I  GSR+E    HG  HFLEH+LFKGT +R A
Sbjct: 21  VRRSVLPGGIRVLTESMPGQRSVSMGAWIAVGSRDEHDGHHGSTHFLEHLLFKGTARRDA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    + VGG+ NA T  E+T Y+A VL   +P+A+++I DM+++++ +  + E ER 
Sbjct: 81  MEIATAFDAVGGEANASTGKEYTCYYARVLDADLPMAVDVITDMVTSATLDAGEFETERG 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D    +F+  V+    +GRPI G P +I S   + +     R Y  
Sbjct: 141 VILEELAMNDDDPSDVAHEQFAAAVFGAHPLGRPIGGTPGSIRSVPRDAVWEHYRRTYAP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP-AVYVGGEYIQ----------- 229
             + V   G+VDHE   +Q+     V     + ++  P +  V G  +            
Sbjct: 201 PELVVTAAGSVDHEALCAQIAD--GVAGPWTLDDAAAPVSRRVAGGTVAGLPDAGTAITV 258

Query: 230 KRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHE 289
           +R   + +++LG  G        +  ++L ++LG GMSSRLFQEVRE+RGL YS+ +   
Sbjct: 259 RRSTEQANVVLGAPGLVATDPRRFTMSVLNAVLGGGMSSRLFQEVRERRGLAYSVYSFAT 318

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQER 348
            +++ G   + +  A   +  +T  + E  + L  + I   E+++   ++   L+   E 
Sbjct: 319 GYAEAGAFGVYAGCAPSKVADVTRILGEQWEQLAADGITAEELERGVGQLSGSLVLGLED 378

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           S  R   + +  +  G ++  ++ ++ + A+T +D+  +A ++ +   +L ++G P DH
Sbjct: 379 SGSRMSRLGRSEIVFGELVSVDETLERLRAVTADDVRELAAELAAGPRSLVVVG-PFDH 436


>gi|328953965|ref|YP_004371299.1| processing peptidase [Desulfobacca acetoxidans DSM 11109]
 gi|328454289|gb|AEB10118.1| processing peptidase [Desulfobacca acetoxidans DSM 11109]
          Length = 414

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/399 (32%), Positives = 220/399 (55%), Gaps = 9/399 (2%)

Query: 11  GITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           G+ V+TE +P   S  + + +  GSR+E   E+GMAHFLEHM FKGT +R+A E+  +I+
Sbjct: 10  GVRVVTEALPHFHSVSLGIWLNTGSRDETAGENGMAHFLEHMAFKGTGRRSASELACQID 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
           ++GG  NA+T+ E+T +H  VL   +P   +++ D+L N  ++ +++E+ER V+L+EI  
Sbjct: 70  QLGGTANAFTTQENTCFHGKVLAAELPRLFDLLSDILLNPVYDTAELEKERQVILQEIDE 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   +++   F+   + D   GRPI+G  +T+ +FT   ++ +   +Y    + +   
Sbjct: 130 LEDTPDEYVHVLFNRHFYGDSAFGRPIMGSADTVCNFTRLLLLDYRQSHYHPQDIVIAAA 189

Query: 190 GAVDHEFCVSQVESY---FNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
           G ++HE  V+   +    F+ C  ++ ++  K A Y G     K DL + H++ G    A
Sbjct: 190 GRLEHEALVNLAAAAFGDFHNCRCSRPRQ--KVATYPGAHNFLK-DLEQVHLVAGGKAPA 246

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
                 Y+  +L  ILG  MSSRLFQE+RE++GLCYSI +    FSD G+L I+++ + E
Sbjct: 247 AGEDSRYMAILLNLILGGNMSSRLFQEIRERQGLCYSIYSFLHCFSDAGLLAISASVSPE 306

Query: 307 NIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
           N   L  +I   +++L    +  +E+        A L  S E S  R + +++  +  G 
Sbjct: 307 NFEQLLDTIRREIEALKTTGVSPQELQAAVDYSRASLYLSAEDSDNRMMRLARNELSFGH 366

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
            L  E+IID ++++T   ++  A+      +  +  LGP
Sbjct: 367 YLSYEEIIDHLASVTPHQVIEKAQDWLDLGSWQIVCLGP 405


>gi|78222802|ref|YP_384549.1| peptidase M16-like [Geobacter metallireducens GS-15]
 gi|78194057|gb|ABB31824.1| Peptidase M16-like protein [Geobacter metallireducens GS-15]
          Length = 418

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 132/418 (31%), Positives = 230/418 (55%), Gaps = 9/418 (2%)

Query: 5   ISKT--SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +SKT   +G+ VI+E MP   S  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R+A
Sbjct: 2   VSKTILDNGVRVISEYMPHAHSVSIGIWVANGSRHERREHNGVAHFIEHLLFKGTVRRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL +++P A++++ D+  NS+F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKNLPQAVDLLTDIFLNSTFDPEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D++   F    W+   +G  ILG  E++S+ + + I++     Y +
Sbjct: 122 VVLQEISMLEDSPDDYVHDLFHRSFWRGHPLGMSILGSAESVSNLSRDAIVAHRDAMYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G V H+  +  +   F+       +      VY     I ++DL + H+ LG
Sbjct: 182 EDIIVAVAGNVRHDELLKLISGSFDSVPEGTGRNCCHLPVYDQKLEIVEKDLEQLHICLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
                +     +   ++ +ILG  MSSRLFQE+RE  GL Y++ ++  + +D G L + +
Sbjct: 242 TKSLPHNHPRRFEAYLMNTILGGSMSSRLFQEIREHLGLAYTVYSYVVSHTDAGSLVVYA 301

Query: 302 ATAKE---NIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            T+ E   +++ +T S  E+ +   E +   E++    ++   ++ S E S  R  +++K
Sbjct: 302 GTSPEKLSDVLEITCS--ELRRLKFEPVPATELEAAREQLKGNILLSLESSDNRMTKLAK 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELI 415
             ++ G  L   ++     + T + I  +A   FS    TLA+ G     +P  S L+
Sbjct: 360 NEIYFGRYLSLAELTGGFDSATADGIAELANDFFSGDYVTLALTGKISGQIPDLSHLV 417


>gi|16127628|ref|NP_422192.1| M16 family peptidase [Caulobacter crescentus CB15]
 gi|221236445|ref|YP_002518882.1| zinc protease [Caulobacter crescentus NA1000]
 gi|13425108|gb|AAK25360.1| peptidase, M16 family [Caulobacter crescentus CB15]
 gi|220965618|gb|ACL96974.1| zinc protease [Caulobacter crescentus NA1000]
          Length = 423

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 211/404 (52%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   +    +G+ V+ + MP +++  + V    G+  E     G +H LEHM+FKG   R
Sbjct: 1   MTASLRTLKNGVRVVCDPMPGLETLALSVVAGRGAAYEDPARSGWSHLLEHMVFKGAGSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++IVE IE  GG INA T  E TS+    LK  + L +++I D++   + +P+D+ RE
Sbjct: 61  SARDIVEVIENQGGSINAATGYERTSFQVRALKGGLDLGMDVIADLVRRPTLDPADLTRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EI  + D   D++        W D  +GRPILG  ET+++ + E +  +    Y
Sbjct: 121 KQVVAQEIAEAADAPDDYVFDLIQRASWGDHPVGRPILGSDETVNAASVEALSDWRGDLY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            ADR+ +   GAV+    ++  E  F            + A +VGG   + R L + H++
Sbjct: 181 AADRLVIAATGAVEEAELMAAAERAFGDLPATPGVGLAQSAAFVGGPQAEARKLEQAHLV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
                C  +  D++   I A  LG GMSSRLFQE REKRGL Y+I A+ + ++D+G L I
Sbjct: 241 FMLPACGAREDDYFALRIFAECLGGGMSSRLFQEAREKRGLAYNIDAYADTYADHGALGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +  A  + +       + +  L + IE+ E+ +  A++ A +  ++E+   RA + + Q
Sbjct: 301 YAGCAASDAVETAKVCADELIKLADRIEEAELARAKAQLKAHMFMAREQPLSRAEQGAGQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILG 402
           V+    +    ++   + A+T +D+  + +++ ++     A+LG
Sbjct: 361 VLLFDRLYPPAELAREVDAVTPQDVARLGQRLLAAGRAATAVLG 404


>gi|310641604|ref|YP_003946362.1| peptidase m16 domain-containing protein [Paenibacillus polymyxa
           SC2]
 gi|309246554|gb|ADO56121.1| Peptidase M16 domain-containing protein [Paenibacillus polymyxa
           SC2]
          Length = 419

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 122/395 (30%), Positives = 216/395 (54%), Gaps = 3/395 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P + S    + ++ GSRNE  +  G++HF+EHMLFKGT + +AKEI E+ 
Sbjct: 8   NGLRVVIEKIPTVRSVSFGIWVKTGSRNETSDNSGISHFIEHMLFKGTERFSAKEIAEQF 67

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM  NS  +  ++ RE+NV+LEEI 
Sbjct: 68  DAIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFNSKLDQEELAREKNVILEEIS 127

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S   + +  +  PILG  + + +     +  ++  +YT D   +  
Sbjct: 128 MYEDTPDDMVHDLVSRAAYGEHPLAYPILGTEDHLLAMDSSHLSHYMKEHYTIDNTVISV 187

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD +  +  +E +F           +    + G     ++   + H+ L   G A  
Sbjct: 188 AGNVD-DRLLELLEQHFGHFDNHGTVSPLTVPAFNGQLLYHEKATEQNHICLSLPGFAIG 246

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +D+G+  I + TA +  
Sbjct: 247 DDLQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADSGMFTIYAGTAPKQT 306

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +    +E+++ +  N ++  E+ K   ++   LI S E +  R   + K  +  G   
Sbjct: 307 KDVLDLTLELLRDVAVNGLDANELRKGKEQLKGSLILSLESTGSRMNRLGKNELMLGQHY 366

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             +++I+ I  +T +D+  V  ++FS    L+++G
Sbjct: 367 TLDQMIEHIEQVTADDVNKVLDRMFSEPFALSMVG 401


>gi|169827177|ref|YP_001697335.1| zinc protease [Lysinibacillus sphaericus C3-41]
 gi|168991665|gb|ACA39205.1| zinc protease [Lysinibacillus sphaericus C3-41]
          Length = 394

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 121/386 (31%), Positives = 213/386 (55%), Gaps = 4/386 (1%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + + AGSR E  EE+G+ HF+EHMLFKGT  R+A++I EE +++GG++NA+TS
Sbjct: 8   VRSVALGIFVNAGSRYELPEENGITHFIEHMLFKGTATRSARQIAEEFDRIGGELNAFTS 67

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL  H  LA+ I+ DM  NS+F   ++E+ER VVLEEI MSED   D +  
Sbjct: 68  KENTCYYAKVLDHHAELAVSILADMFFNSTFAEEELEKERQVVLEEILMSEDAPDDDVHE 127

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEF--CV 198
           +   +++ +  +GRPILG   T+ +FT E I  +++++Y  + + +   G +  +    +
Sbjct: 128 KLWSVMYPNDALGRPILGSAATLKTFTAEAIRHYMAKHYGPESVVISIAGNISPQLMATI 187

Query: 199 SQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNIL 258
            ++   +   SVA       P+ +  GE  + RD  + H+ + +     +  D Y    L
Sbjct: 188 ERLFGQYQPSSVAIAPVLTNPSFHP-GEISKIRDTEQAHLAISYPAIGVKDPDMYSFIAL 246

Query: 259 ASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEV 318
            +I+G  MSSRLFQEVRE+RGL YSI ++   ++D G   I  +T+++ +  L  +I   
Sbjct: 247 NNIIGGNMSSRLFQEVREERGLAYSIFSYQSCYADVGAFTIYGSTSRQQLAQLQHTIDAT 306

Query: 319 VQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTIS 377
           +  ++   + + E+D    ++    +   E +  R        +        ++++ +I 
Sbjct: 307 LLDIVAGGVTEEELDNAKEQLKGSFVLGLEGTGARMNRNGTSELVHRKHRTVDEVLASID 366

Query: 378 AITCEDIVGVAKKIFSSTPTLAILGP 403
           A++   +  +  KI  + P ++I+GP
Sbjct: 367 AVSMASVDRLIAKILKAEPAISIIGP 392


>gi|312793596|ref|YP_004026519.1| processing peptidase [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180736|gb|ADQ40906.1| processing peptidase [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 424

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 129/408 (31%), Positives = 227/408 (55%), Gaps = 10/408 (2%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GI ++ E +  + +  + + + AGSR E ++ +G++HF+EH+LFKGT  R++
Sbjct: 2   IKLYTLSNGIRLVYEKIDTVKTVSIGIWVLAGSRYETKKINGISHFIEHILFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEIV EIE +GG INA+T+ E+T ++  VL E +    +I+ D++ N      ++E+E+ 
Sbjct: 62  KEIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLQKGFDILSDLILNPVIAIDEVEKEKT 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M++DD  + L    ++++WK+Q +  PI+GK  T+      KI  ++ + Y  
Sbjct: 122 VIIEEINMTKDDPEEILYQSLNDLIWKNQTLSYPIIGKESTVKKIDRTKIEDYMRKRYMP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN--VCSVAKIKESM----KPAVYVGGEYIQKRDLAE 235
             + +   G  + E  V  VE YF    CS  K K+ +    KP V+  G  I+ + + +
Sbjct: 182 QNIVISVAGNFEEEKLVEFVEMYFGDWKCSNNK-KDGVNFISKP-VFNRGAVIKNKKIDQ 239

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ + F G   +    Y   +L++ILG GMSSRLFQ +RE+ GL YSI++    F D G
Sbjct: 240 AHLAITFEGFGQEDEKVYELLVLSNILGGGMSSRLFQRIREELGLVYSITSFVSTFKDAG 299

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRAL 354
           VL I + T  +NI A+   I+  ++  L+  I   E++    +I   +I   E +  R  
Sbjct: 300 VLIIYAGTNPKNISAVYKEIMSQLRLFLKGEILLDEVEVAKQQIKGSIIFGLENTSSRMS 359

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            + K ++    I+  E I   I +I    ++  A+++ S   ++A++G
Sbjct: 360 NMGKNMLLLNKIMELEHITRIIDSIDHTKVIDTAREVLSKEFSVAVVG 407


>gi|94968596|ref|YP_590644.1| peptidase M16-like [Candidatus Koribacter versatilis Ellin345]
 gi|94550646|gb|ABF40570.1| peptidase M16-like protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 425

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 223/401 (55%), Gaps = 13/401 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+R     +G+TV+TE M  I S  + + ++ GSR+E  + +G++HF+EHM+FKGTT R 
Sbjct: 7   NVRKEVLPNGLTVLTEEMDHIRSVSIGIWVKNGSRHEDPQVNGISHFIEHMVFKGTTTRN 66

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I  E++ +GG+++A+T  E   ++  +L EHVP+A++++ DM+ N  F+ ++I+RE+
Sbjct: 67  AEAIAREVDSIGGNMDAFTGKEMVCFNVKILDEHVPVAMDVLSDMVLNPVFDGAEIDREK 126

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+ EEI M ED+    +   F++  +KD  +G+PILG  ET+  F  + ++    R + 
Sbjct: 127 GVIQEEIKMDEDNPDYLVHEIFTQNFYKDHPLGKPILGTKETVKGFDRDIVLGNYGRKFA 186

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK------PAVYVGGEYIQKRDLA 234
              + V   G ++H+  V +V   F       +K S+       P  +       K+ L 
Sbjct: 187 PGNLIVAAAGNINHKSFVDEVRRRFE-----HLKPSLNGFHQEPPKTHARIIMRNKKSLE 241

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           +  + LG    +   +  Y+  IL ++LG GMSSRLFQ++REK+GL YSI +    F D+
Sbjct: 242 QVQICLGVPAYSISDKRRYVCYILNTLLGGGMSSRLFQDIREKQGLVYSIFSELNPFQDS 301

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G L + + T++E+   + + +V+   +   E +   E+ +  A++   L+   E S  R 
Sbjct: 302 GSLAVYAGTSRESAPKVVTQVVKEFGNFKREMVSVEELQRAKAQLKGSLMLGLESSTARM 361

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
             +++Q M+       ++II  I  +T E++  +A +IF +
Sbjct: 362 SNLARQEMYYDHFHTMDEIIAKIEVVTREEVCEMANEIFRA 402


>gi|271963664|ref|YP_003337860.1| peptidase M16 domain-containing protein [Streptosporangium roseum
           DSM 43021]
 gi|270506839|gb|ACZ85117.1| peptidase M16 domain protein [Streptosporangium roseum DSM 43021]
          Length = 436

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 136/405 (33%), Positives = 223/405 (55%), Gaps = 13/405 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE MP + S  V + +  GSR+E  E  G +HFLEH+LFKGT  R A EI   I
Sbjct: 22  GGLRVVTESMPTVRSVAVGMWVGIGSRDEAPEHMGSSHFLEHLLFKGTPTRDALEISAAI 81

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E +GG+INA+T+ E+T Y+A VL E + +A++++ D++++S   P D+E ER V+LEEI 
Sbjct: 82  EGIGGEINAFTAKEYTCYYARVLDEDLRVAIDVLADVVTSSLITPEDVEAERGVILEEIA 141

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D +  +FS  ++ D  IGRPILG  ++I++ + ++I  +  R Y      V  
Sbjct: 142 MHDDDPSDMVHEQFSAEMYGDTPIGRPILGTVDSINAASRDRIAEYYRRYYLPTHTVVSV 201

Query: 189 VGAVDHEFCVSQV-ESYFNVCSVAKIKESMKPAVYVGGE------YIQKRDLAEEHMMLG 241
            G V+HE  V+ V  +Y    ++      + P V   G        +  R   + +++LG
Sbjct: 202 AGNVNHEQVVALVAAAYERAGALGGDASPIAPRVSGPGAEARPGVRVVHRPTEQANLVLG 261

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV--LYI 299
             G        +   +  + LG GMSSRLFQE+REKRGL YS  ++  +++D G   +Y+
Sbjct: 262 TTGLTRTDERRFALGVFNAALGGGMSSRLFQEIREKRGLAYSAYSYTSSYADTGQFGIYV 321

Query: 300 ASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
               +K ++++ +     EV++ + E I + EI +   ++   L+   E +  R   I K
Sbjct: 322 GCLPSKIDDVLKICRE--EVLRVVAEGITEEEIVRGKGQMRGGLVLGLEDTGSRMSRIGK 379

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +    +L  + ++  I A+T E I  VA+ + +   TLA++GP
Sbjct: 380 GELVYDELLSVDDVLARIEAVTPEQISEVARDVLTRPMTLAVIGP 424


>gi|308068708|ref|YP_003870313.1| zinc protease [Paenibacillus polymyxa E681]
 gi|305857987|gb|ADM69775.1| Hypothetical zinc protease [Paenibacillus polymyxa E681]
          Length = 421

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 123/395 (31%), Positives = 215/395 (54%), Gaps = 3/395 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P + S    + ++ GSRNE  +  G++HF+EHMLFKGT +  AKEI E+ 
Sbjct: 8   NGLRVVIEKIPTVRSVSFGIWVKTGSRNETPDNSGISHFIEHMLFKGTERFNAKEIAEQF 67

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM  NS  +  ++ +E+NV+LEEI 
Sbjct: 68  DAIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFNSKLDQEELAKEKNVILEEIS 127

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S   + +  +  PILG  + + +     +  ++  +YT D   +  
Sbjct: 128 MYEDTPDDMVHDLVSRAAYGEHPLAYPILGTEDHLLAMNSSHLSHYMREHYTIDNTVISV 187

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G VD +  V  +E +F           +   V+ G     ++   + H+ L   G A  
Sbjct: 188 AGNVD-DRLVELLERHFGHFDNHGTVSPLTVPVFNGELLYHEKATEQNHICLSLPGFAVG 246

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +D+G+  I + TA +  
Sbjct: 247 DELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADSGMFTIYAGTAPKQT 306

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +    +E+++ +  N ++  E+ K   ++   LI S E +  R   + K  +  G   
Sbjct: 307 KDVLDLTLELLRDVAVNGLDANELRKGKEQLKGSLILSLESTGSRMNRLGKNELMLGQHY 366

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             +++I+ I  +T  D+  V  ++FS    L+++G
Sbjct: 367 TLDQMIEHIEQVTANDVNKVLDRMFSEPFALSMVG 401


>gi|326333596|ref|ZP_08199835.1| peptidase, M16 family [Nocardioidaceae bacterium Broad-1]
 gi|325948612|gb|EGD40713.1| peptidase, M16 family [Nocardioidaceae bacterium Broad-1]
          Length = 442

 Score =  219 bits (557), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 136/407 (33%), Positives = 218/407 (53%), Gaps = 17/407 (4%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           SG+ ++TE M  + SA + V I  GSR+E   +HG +HFLEH+LFKGT  RTA EI   +
Sbjct: 39  SGLRIVTEQMAGVRSAAIGVFIGVGSRDETARQHGCSHFLEHLLFKGTPSRTALEISSSM 98

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           ++VGG+ NAYT+ E+T +HA VL   +PLA++++GDML++S     D+E ER+V+L+EI 
Sbjct: 99  DRVGGEFNAYTAKEYTCFHARVLDVDLPLAIDVVGDMLTSSLITAEDVEAERDVILDEIA 158

Query: 129 MSEDDSWDFLDARFSEMVWKDQI-IGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
           M +DD  D +    +   W  +  +GR I G   +I++ T  +I  F   +Y A RM V 
Sbjct: 159 MHDDDPDDVIHNLVAAQAWGAETPLGRGIAGTEASITALTRAEIDGFYREHYAAPRMVVS 218

Query: 188 CVGAVDHEFCVSQVESYFN-----VCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             G V+H+  V+ VE  F+       + A +      P   V GE   +R L + +++L 
Sbjct: 219 VAGNVEHDEVVAMVEKAFSGSGFLTGAAAPVPPREGSPLEVVAGEISAQRPLEQVNVILA 278

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        +   ++ + +G   SSRLFQEVRE RGL YS+ ++  + ++ G+  +  
Sbjct: 279 REGLQRGDDRRFAFEVVNTAVGGATSSRLFQEVREHRGLAYSVYSYAYSHAETGLFGVQV 338

Query: 302 ATAKENIMALTSSIVEVVQSLL-----ENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
                 + A    ++EVV+S L     + I   E++    ++   L+   E S  R   I
Sbjct: 339 GC----LPAKLDEVLEVVRSELAAVARDGITAEELELGKGQLRGGLVLGLEDSASRMSRI 394

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +  +    +   ++++  I A+T ED   VA +I S    LA++GP
Sbjct: 395 GRAELVHRELYSIDEVLARIDAVTLEDCREVAAEILSRPEILAVVGP 441


>gi|269956018|ref|YP_003325807.1| peptidase M16 domain-containing protein [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269304699|gb|ACZ30249.1| peptidase M16 domain protein [Xylanimonas cellulosilytica DSM
           15894]
          Length = 442

 Score =  219 bits (557), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 143/427 (33%), Positives = 222/427 (51%), Gaps = 37/427 (8%)

Query: 2   NLRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R S    G+ V+TE MP   SA V   +  GSR+E     G  HFLEH+LFKGT +R+
Sbjct: 25  TIRRSVLPGGVRVLTEHMPGQRSATVGAWVGVGSRDESDGHFGSTHFLEHLLFKGTARRS 84

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I E  + VGG+ NA T  EHT Y+A VL   +P+A+++I DM++++  +  ++E ER
Sbjct: 85  AMDIAEAFDAVGGEANAATGKEHTCYYARVLDSDLPMAIDVISDMVTSARLDTDELETER 144

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M++DD  D +   FS+ V     +GRPI G P+TI +   + +      +Y 
Sbjct: 145 GVILEELAMNDDDPSDVVHEEFSQAVLGTHPLGRPIGGTPDTIRAVPRDAVWEHYRWHYR 204

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVC------SVAKIKESMKPAVYVG--GEYIQ--- 229
            + + V   G VDH+  V QV             +VA  +  +  AV  G   E I    
Sbjct: 205 PETLVVAAAGGVDHDTVVGQVVDALAHGGWSLEEAVAPRERRVADAVTDGVPTEGIALSI 264

Query: 230 KRDLAEEHMMLGFNG-CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLC---YSIS 285
           +R + + ++++G  G  A   R F L+ +L+++LG GMSSRLFQE+REKRGL    YS +
Sbjct: 265 RRTVEQANVIVGSTGLSATDDRRFALS-VLSAVLGGGMSSRLFQEIREKRGLAYSTYSFA 323

Query: 286 AHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLL---------ENIEQREIDKECA 336
           A H      G LY   A  K          V++V+ LL         + I   E+++   
Sbjct: 324 AGHGGLGTFG-LYAGCAPGK----------VDIVEKLLHEELDRLAADGITTAELERSVG 372

Query: 337 KIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP 396
           ++   L+   E S  R   + K  +  G IL   + +D I A+T +D+  +A+ + S   
Sbjct: 373 QLSGGLVLGLEDSGSRMSRLGKAELVFGEILSLSESLDRIRAVTADDVRELAQDLASRPR 432

Query: 397 TLAILGP 403
           ++  +GP
Sbjct: 433 SVVRVGP 439


>gi|332670054|ref|YP_004453062.1| peptidase M16 domain-containing protein [Cellulomonas fimi ATCC
           484]
 gi|332339092|gb|AEE45675.1| peptidase M16 domain protein [Cellulomonas fimi ATCC 484]
          Length = 448

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/420 (31%), Positives = 218/420 (51%), Gaps = 20/420 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP + SA V   +  GSR+E    +G  HFLEH+LFKGT +R+A
Sbjct: 27  VRRSVLPGGVRVLTEQMPGLRSATVGAWVGVGSRDETSGHYGSTHFLEHLLFKGTARRSA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E  + VGG+ NA T  EHT Y+A VL + +P+A+++I DM++++  +  ++E ER 
Sbjct: 87  MDIAEAFDAVGGEANAATGKEHTCYYARVLDDDLPMAVDVIADMVTSARLDTDELETERG 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D +  +F+  V  +  +GRPI G P+TI +   + +      +YT 
Sbjct: 147 VILEELAMNDDDPSDVVHEQFAAAVLGEHPLGRPIGGTPDTIRAVPRDAVWEHYRWHYTP 206

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVA----KIKESMKP------AVYVGG------ 225
             + V   G VDH+    QV         A          +P      A  V G      
Sbjct: 207 ATLVVTAAGGVDHDTLCGQVADALAAGGWALDGDDAPTGRRPLTASSVAAGVDGIPADGV 266

Query: 226 EYIQKRDLAEEHMMLGFNG-CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSI 284
           E   +R   + ++++G     A   R F L+ +L ++LG GMSSRLFQE+REKRGL YS 
Sbjct: 267 ELTIQRHTEQANVIVGGTALTATDPRRFTLS-VLNAVLGGGMSSRLFQEIREKRGLAYST 325

Query: 285 SAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLI 343
            +     +D GV  + +  A   +  +   +V   + L +  I   E+++   ++   L+
Sbjct: 326 YSFASGHADTGVFGLYAGCAPGKVDEVVELMVAEWERLADGGITPAELERSLGQLAGGLV 385

Query: 344 KSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              E +  R   + K  +  G +L  ++ +D I A+T  D+  +A ++ S   ++  +GP
Sbjct: 386 LGMEDTGSRMSRLGKAELVHGELLSIDESLDRIRAVTAADVQELAAELASRPRSVVRVGP 445


>gi|296129366|ref|YP_003636616.1| peptidase M16 domain protein [Cellulomonas flavigena DSM 20109]
 gi|296021181|gb|ADG74417.1| peptidase M16 domain protein [Cellulomonas flavigena DSM 20109]
          Length = 441

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/395 (32%), Positives = 209/395 (52%), Gaps = 15/395 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE MP + SA V   +  GSR+E     G  HFLEH+LFKGT +R+A
Sbjct: 27  VRRTVLPGGVRVLTEHMPGLRSATVGAWVGVGSRDEMSGHFGSTHFLEHLLFKGTARRSA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E  + VGG+ NA T  EHT Y+A VL   VP+A+++I DM++++  +P ++E ER 
Sbjct: 87  MDIAEAFDAVGGEANAATGKEHTCYYARVLDTDVPIAVDVIADMVTSARLDPDELETERG 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D    +F+  V+ D  +GRPI G P  I S   + +      +Y  
Sbjct: 147 VILEELAMNDDDPSDVAHEQFATAVFGDTPLGRPIGGTPHAIRSVPRDAVWEHYREHYRP 206

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF---------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
           D + V   G VDH+   +QV                   +     + AV VG E   +R 
Sbjct: 207 DTLVVTAAGGVDHDALCAQVADALAAGGWDLAAGAVPAPRRAVGERGAVSVGVELTVRRP 266

Query: 233 LAEEHMMLGFNGC--AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHEN 290
             + ++++G   C  A   R F L+ +L++ LG GMSSRLFQE+REKRGL YS  ++   
Sbjct: 267 TEQANVIVGGT-CLNATDGRRFVLS-VLSAALGGGMSSRLFQEIREKRGLAYSTYSYASG 324

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERS 349
            ++ G+  + +  A   +  +T  +V  ++ +  E +   E+++   ++   L+   E S
Sbjct: 325 HAETGLFGLYAGCAPAKVDEVTELMVAELERMASEAMGAAELERSIGQLCGGLVLGMEDS 384

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDI 384
             R   + K  +  G +L  ++ +  I A+T  ++
Sbjct: 385 GSRMSRLGKAELVHGELLDVDESLARIRAVTAREV 419


>gi|324998721|ref|ZP_08119833.1| putative zinc protease [Pseudonocardia sp. P1]
          Length = 435

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/416 (30%), Positives = 216/416 (51%), Gaps = 20/416 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S+   G+ ++TE +P + S  V + I  GS +E  E+ G AHFLEH+LFKGT +RTA
Sbjct: 11  VRRSELPGGVRLVTETVPGVRSVAVGIWIGIGSVDETGEQAGAAHFLEHLLFKGTRRRTA 70

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I EE++ VGG++NA+T+ EHT Y+A VL   V LA++++ D+++++    +D+E ER 
Sbjct: 71  AGIAEEMDAVGGELNAFTAKEHTCYYAHVLDTDVALAVDLLADVVTDAELARTDVELERG 130

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F E ++    +GRP++G  E++ + + E + +F    YT 
Sbjct: 131 VVLEEISMRDDDPEDLLGDLFDETLFGSHPLGRPVIGSEESVRAMSRETLHAFWRGEYTT 190

Query: 182 DRMYVVCVGAVDHE--------FCVSQVESYFNVCSV-AKIKESMKPAVYVGGEYIQKRD 232
            RM V   G ++H+                + +  +V  +    ++PA   G   +Q  D
Sbjct: 191 PRMVVAAAGNLEHDRLAELVAAALAPAANGHADAVAVPPRAATGVRPA-RSGALGLQPDD 249

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H+MLG            +  +L + LG G+SSRLFQ+VRE+RGL Y + +    ++
Sbjct: 250 SEQAHVMLGVPAAGRHVPGLPVLAVLNNALGGGLSSRLFQQVREQRGLAYQVYSSVARYA 309

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIE-----QREIDKECAKIHAKLIKSQE 347
           D G L + +  A E +      +V VV+ +L  +      + E+ +    +   L+   E
Sbjct: 310 DAGALSVYAGCAPERL----GEVVAVVRDVLAEVAGGGLTEAEVTRAKGALRGGLVLGCE 365

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +  R   + +  +  G        +  I A+T  ++  +A  +     T A++GP
Sbjct: 366 DTASRMNRLGRAELDHGRQRSLTDSLARIEAVTPAEVAALAAGLLDQPLTAAVVGP 421


>gi|257462590|ref|ZP_05627000.1| Zinc protease [Fusobacterium sp. D12]
 gi|317060241|ref|ZP_07924726.1| zinc protease [Fusobacterium sp. D12]
 gi|313685917|gb|EFS22752.1| zinc protease [Fusobacterium sp. D12]
          Length = 416

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 134/394 (34%), Positives = 215/394 (54%), Gaps = 6/394 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GITV+ E +P + S  +   +R G+RNER+EE G++HF+EHM+FKGT  RTA
Sbjct: 5   VQVKTLSNGITVLAEKVPELQSFSLGFFVRTGARNERKEESGISHFIEHMMFKGTETRTA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KE+ E I+  GG +NAYTS E T Y+  +L   + +A++++ DM+ +S+F   +IE+ERN
Sbjct: 65  KELSEIIDNEGGMMNAYTSRETTVYYVQLLSSKLEIAIDVLSDMMLHSTFTEENIEKERN 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M ED   D +         +  I    I G PE +   T E  + ++   Y A
Sbjct: 125 VIIEEIKMYEDSPEDTVHDENISFALRG-IQSNSISGTPEGLKKITREHFMKYLRDQYVA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNV--CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             + +V  G  D E  ++Q+E   +    S  K     +  +Y G + I  RD  + H+ 
Sbjct: 184 SNLTIVISGNFDEELLMTQLEEKMSAFPSSTEKRDYDNRYEIYSGTQII-TRDTQQVHIC 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G        Y   IL S LG GMS+RLFQ++RE+RGL YS+ ++   + D G+   
Sbjct: 243 FNTRGIDIHHPKKYAVAILTSALGGGMSARLFQKIREERGLAYSVYSYQSVYEDCGLFTT 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T +E    + + I E  Q +LE+ I ++E+ +   +  + L+   E S  R   I+ 
Sbjct: 303 YAGTTREAYRDVIAMIREEYQEILEHGITEQELRRCKNQFTSALMFHLESSKGRMSSIAA 362

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             M  G +   E++I  I+A++ EDI  VA+ +F
Sbjct: 363 SYMNNGRVETKEEVIQNINAVSLEDIQEVARYLF 396


>gi|142824|gb|AAA22379.1| processing protease [Bacillus subtilis]
          Length = 380

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/375 (32%), Positives = 214/375 (57%), Gaps = 2/375 (0%)

Query: 30  IRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAW 89
           I  GSR+E  E +G++HFLEHM FKGT+ ++A+EI E  +++GG +NA+TS E+T Y+A 
Sbjct: 1   IGTGSRHETPEINGISHFLEHMFFKGTSTKSAREIAESFDRIGGQVNAFTSKEYTCYYAK 60

Query: 90  VLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKD 149
           VL EH   AL+++ DM  +S+F+ +++++E+NVV EEI M ED   D +    S+  + +
Sbjct: 61  VLDEHANYALDVLADMFFHSTFDENELKKEKNVVYEEIKMYEDAPDDIVHDLLSKATYGN 120

Query: 150 QIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCS 209
             +G PILG  ET++SF  + +  ++   YT DR+ +   G +   F +  VE +F    
Sbjct: 121 HSLGYPILGTEETLASFNGDSLRQYMHDYYTPDRVVISVAGNISDSF-IKDVEKWFGSYE 179

Query: 210 VAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSR 269
                  ++   +   +  +K++  + H+ LGF G        Y   +L ++LG  MSSR
Sbjct: 180 AKGKATGLEKPEFHTEKLTRKKETEQAHLCLGFKGLEVGHERIYDLIVLNNVLGGSMSSR 239

Query: 270 LFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQ 328
           L ++VRE +GL YS+ ++H ++ D+G+L I   T    +  L+ +I E + +L  + I  
Sbjct: 240 LLEDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTGANQLQQLSETIQETLATLKRDGITS 299

Query: 329 REIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVA 388
           +E++    ++   L+ S E +  +     K  +  G     ++II+ ++A+  E + G+A
Sbjct: 300 KELENSKEQMKGSLMLSLESTNSKMSRNGKNQLLLGKHKTLDEIINELNAVNLERVNGLA 359

Query: 389 KKIFSSTPTLAILGP 403
           +++F+    LA++ P
Sbjct: 360 RQLFTEDYALALISP 374


>gi|168180710|ref|ZP_02615374.1| peptidase, M16 family [Clostridium botulinum NCTC 2916]
 gi|170755324|ref|YP_001781954.1| M16 family peptidase [Clostridium botulinum B1 str. Okra]
 gi|226949764|ref|YP_002804855.1| peptidase, M16 family [Clostridium botulinum A2 str. Kyoto]
 gi|169120536|gb|ACA44372.1| peptidase, M16 family [Clostridium botulinum B1 str. Okra]
 gi|182668390|gb|EDT80369.1| peptidase, M16 family [Clostridium botulinum NCTC 2916]
 gi|226842519|gb|ACO85185.1| peptidase, M16 family [Clostridium botulinum A2 str. Kyoto]
          Length = 433

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 136/400 (34%), Positives = 214/400 (53%), Gaps = 26/400 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNENLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHIELALEVLSDMLFNSKFKEEDIEKEKGVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF  + I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTVETVKSFKRKDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   N      I    KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINELEKLINKYFGNWNSGENKNITVYSKPKIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDAYPLILLSNVLGGGASSILFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
               A T   + +++ ++ +  +  I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----AYTEDTITLIKKVVNDFSKEGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
              K V+F   I   E I+  I  IT + +  +  K F +
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEIMDKTFGA 397


>gi|222529408|ref|YP_002573290.1| processing peptidase [Caldicellulosiruptor bescii DSM 6725]
 gi|222456255|gb|ACM60517.1| processing peptidase [Caldicellulosiruptor bescii DSM 6725]
          Length = 424

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/408 (31%), Positives = 227/408 (55%), Gaps = 10/408 (2%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GI ++ E +  + +A + + + AGSR E ++ +G++HF+EH+LFKGT  R++
Sbjct: 2   IKLYTLSNGIRLVYEKIDTVKTASIGIWVLAGSRYETKKINGISHFIEHILFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EIV EIE +GG INA+T+ E+T ++  VL E +    +I+ D++ N      ++E+E+ 
Sbjct: 62  REIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLQKGFDILSDLILNPVIALEEMEKEKT 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M+++D  + L    ++++WK+Q +  PI+GK  T+      KI +++   Y  
Sbjct: 122 VIIEEINMTKEDPEEILYQSLNDLIWKNQTLSYPIIGKESTVKKIDRNKIENYMRERYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN--VCSVAKIKESM----KPAVYVGGEYIQKRDLAE 235
             + +   G  + E  V  VE YF    CS  K K+ +    KP V+  G  I+ + + +
Sbjct: 182 QNIVISVAGNFEEEKLVEFVEMYFGDWKCSNNK-KDGVNFISKP-VFNRGAVIKNKKVDQ 239

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            HM + F G   +    Y   +L++ILG GMSSRLFQ +RE+ GL YSI++    F D G
Sbjct: 240 AHMAITFEGFGQEDEKVYELLVLSNILGGGMSSRLFQRIREELGLVYSITSFVSTFKDAG 299

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRAL 354
           VL I + T  +NI A+   I+  ++  L   I   E++    +I   +I   E +  R  
Sbjct: 300 VLIIYAGTNPKNISAVYKEIMSQLRLFLRGEILLDEVEVAKQQIKGSIIFGLENTSSRMS 359

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            + K ++    I+  E I   I +I    ++  A+++ S   ++A++G
Sbjct: 360 NMGKNMLLLNKIMELEHITKIIDSIDYTKVIDTAREVLSKEFSVAVVG 407


>gi|187778996|ref|ZP_02995469.1| hypothetical protein CLOSPO_02591 [Clostridium sporogenes ATCC
           15579]
 gi|187772621|gb|EDU36423.1| hypothetical protein CLOSPO_02591 [Clostridium sporogenes ATCC
           15579]
          Length = 433

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 136/400 (34%), Positives = 214/400 (53%), Gaps = 26/400 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNEDLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ VV+EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHMELALEVLSDMLFNSKFKEEDIEKEKGVVIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF    I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTLETVKSFKRSDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKE---SMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   S  + K      KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINKLEKLINKYFGNWSSGENKNITCYSKPKIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDMYPLVLLSNVLGGGASSVLFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
                 T   + +++ ++ +  ++ I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----TYTEDTITLIKQVVNDFSKKGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
              K V+F   I   E I+  I  IT + +  V  + F +
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEVMARTFGA 397


>gi|197104016|ref|YP_002129393.1| peptidase, M16 family [Phenylobacterium zucineum HLK1]
 gi|196477436|gb|ACG76964.1| peptidase, M16 family [Phenylobacterium zucineum HLK1]
          Length = 431

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 208/402 (51%), Gaps = 2/402 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R+ + ++G+ V+ + +P   +  + V    G+R E +   G +H LEHM+FKG   R+A+
Sbjct: 14  RVHRLANGVRVVCDPIPGWQTVALSVVAGRGARFEDEARSGWSHLLEHMVFKGAGGRSAR 73

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EIVE IE  GG INA T  E TSY    LK  + L   +I D+L   + +  D+ RE+ V
Sbjct: 74  EIVEVIEAEGGHINAATGYERTSYQVRALKGGLDLGSSVIADLLLRPTMDARDLAREKQV 133

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           V +EI  + D   D +     E  +    +GR ILG   +I+  TPE + ++    Y A 
Sbjct: 134 VGQEIAEAADTPDDLVFELAQEAAFAGHPLGRSILGTTGSIAVATPETLSAWRGALYAAP 193

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            + +   GAVD +  +   E  F       +  + +PA + GG     + L + +++L  
Sbjct: 194 SLVISAAGAVDEDELLRLAERDFGAADGGGLAATPEPAAFTGGVRTIAKPLEQANVVLLL 253

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
                   D++   +LA ILG GM+SRLFQE REKRGL Y+I A+ E ++D GVL + + 
Sbjct: 254 PAVGVHDPDYFTLRLLAEILGGGMASRLFQEAREKRGLAYTIDAYSETYADTGVLGVFAG 313

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
            A E+   L    V+ +++L E + + E+ +  A++   +   +E +  RA + + QV+ 
Sbjct: 314 CAAEDAAELAQVTVDEIRNLAEPVPEAELARAKAQLKGSMFMGREAALARAEQAAGQVLL 373

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGP 403
            G  L  E I   + A++ E +  + ++I       +A+LGP
Sbjct: 374 FGRPLDPEVIAAEVDAVSAEQLAALTRRILEPRKAAVAVLGP 415


>gi|322806677|emb|CBZ04246.1| peptidase, M16 family [Clostridium botulinum H04402 065]
          Length = 433

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 137/413 (33%), Positives = 219/413 (53%), Gaps = 27/413 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNENLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHIELALEVLSDMLFNSKFKEEDIEKEKGVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF  + I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTVETVKSFKRKDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   N      I    KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINELEKLINKYFGNWNSSENKNITVYSKPKIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDAYPLILLSNVLGGGASSILFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
               A T   + +++ ++ +  +  I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----AYTEDTITLIKQVVNDFSKEGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMD 406
              K V+F   I   E I+  I  IT + +  +  + F +     A +G  ++
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEIMDRTFRAGIKNSAFVGEKLN 410


>gi|117928714|ref|YP_873265.1| peptidase M16 domain-containing protein [Acidothermus
           cellulolyticus 11B]
 gi|117649177|gb|ABK53279.1| peptidase M16 domain protein [Acidothermus cellulolyticus 11B]
          Length = 451

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 130/416 (31%), Positives = 222/416 (53%), Gaps = 20/416 (4%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ VITE MP + S    + +  GSR+E  +  G +H+LEH+LFKGT +R+A
Sbjct: 30  VRRTVLPGGLRVITEAMPTVRSVAFGIWVGVGSRDETPDIAGSSHYLEHLLFKGTQRRSA 89

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I   ++ VGG++NA+T+ E+T ++A VL   +PLA++++ DM+++S      +E ER 
Sbjct: 90  LDISAALDAVGGELNAFTTKEYTCFYARVLDRDLPLAVDVLADMVTSSLLRSEHVEAERG 149

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   F+E ++ D  +GRP+LG  ++IS+   + I +   R Y  
Sbjct: 150 VILEEIAMRDDDPGDAVHDMFAETLFGDTPLGRPVLGTVQSISAVQRDAIDAHYRRWYRP 209

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQ---------KR 231
           + M V   G + H+  V+ V + F   +V +      PA   +GG   Q          R
Sbjct: 210 EFMVVAAAGNLVHDEVVALVRNAF--AAVLEENSGRTPAPPRIGGVPPQSRAGVVNVVSR 267

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
              + H +LG    A   +      +L   LG GMSSRLFQEVREKRGL YS+ ++  + 
Sbjct: 268 PTEQAHFVLGMPALARTDKGRVALGVLNGALGGGMSSRLFQEVREKRGLAYSVYSYAAHH 327

Query: 292 SDNGVLYIAS----ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
           ++ G+  + +      A+E +      +  VV+   + +   E+ +   ++    +   E
Sbjct: 328 AETGIFGVYAGCQPGRAREVLDICREQLHAVVR---DGLTDDELARGKGQLAGSFVLGLE 384

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +  R   + K  +  G +   ++++  I A+T +DI  VA ++ +  PTLA++GP
Sbjct: 385 DTGSRMSRLGKAELVYGELPTVDELLARIEAVTHDDIRAVAARVLAVPPTLALIGP 440


>gi|148380366|ref|YP_001254907.1| peptidase, M16 family [Clostridium botulinum A str. ATCC 3502]
 gi|153934191|ref|YP_001384586.1| M16 family peptidase [Clostridium botulinum A str. ATCC 19397]
 gi|153937094|ref|YP_001388102.1| M16 family peptidase [Clostridium botulinum A str. Hall]
 gi|148289850|emb|CAL83958.1| putative peptidase [Clostridium botulinum A str. ATCC 3502]
 gi|152930235|gb|ABS35735.1| peptidase, M16 family [Clostridium botulinum A str. ATCC 19397]
 gi|152933008|gb|ABS38507.1| peptidase, M16 family [Clostridium botulinum A str. Hall]
          Length = 433

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 214/400 (53%), Gaps = 26/400 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNENLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHIELALEVLSDMLFNSKFKEEDIEKEKGVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF  + I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTVETVKSFKRKDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   N      I    KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINELEKLINKYFGNWNSGENKNITVYSKPKIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDAYPLILLSNVLGGGASSILFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
               A T   + +++ ++ +  +  I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----AYTEDTITLIKKVVNDFSKEGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
              K V+F   I   E I+  I  IT + +  +  + F +
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEIMDRTFGA 397


>gi|77919162|ref|YP_356977.1| Zn-dependent peptidase [Pelobacter carbinolicus DSM 2380]
 gi|77545245|gb|ABA88807.1| predicted Zn-dependent peptidase [Pelobacter carbinolicus DSM 2380]
          Length = 419

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/401 (30%), Positives = 216/401 (53%), Gaps = 11/401 (2%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI +ITE +P   SA V   +  GSR+E  E+ G++HFLEHMLFKGT  R+A  I +EI
Sbjct: 9   NGIRIITERVPGAYSATVGFWVECGSRHESSEQSGVSHFLEHMLFKGTVTRSAPSIAKEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG +NA+TS E++ Y+A V   H+ +A++++ D++ NS F+  ++E+ER V+L+EI 
Sbjct: 69  DAVGGALNAFTSCEYSCYYAKVAGRHLSMAVDLLADIILNSVFDFDELEKERRVILQEIH 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +   F+   W++  +GRPI G  +++ S     +++++ + Y    + +  
Sbjct: 129 MLEDSPEECIHEMFTHSFWQEHPLGRPIAGSVQSVQSLERRDLLAYLEKFYCGSNLIICV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G V HE  V Q+        V     +  P +      +  +D+ + H  LG      +
Sbjct: 189 AGDVQHEDLVEQISRLAGDLPVGCKSAAGSPPLTHSTIQVAHKDIEQVHFCLGTRAPDQR 248

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               +  NIL ++LG  MSSRLFQ +RE+RG+ YS+ ++  + SD+G L + + T+   +
Sbjct: 249 HGQRFTGNILNTMLGGSMSSRLFQTLREERGMAYSVYSYLTSHSDSGALVVYAGTSASEV 308

Query: 309 MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQ-----ERSYLRALEISKQVMFC 363
                  + +V   L   +  E++ E  +   +LIK Q     E +  R   ++K  ++ 
Sbjct: 309 ----QHAINIVLRELSRFQHHEVNPEELQAAKELIKGQFMLSLESTENRMTRLAKNEIYL 364

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
           G +   ++I++ +  +T EDI+ +  K        L ++GP
Sbjct: 365 GHVQTPDEIVEHVQQVTGEDILQLTGKYLRDEHLNLQMVGP 405


>gi|170761462|ref|YP_001787722.1| M16 family peptidase [Clostridium botulinum A3 str. Loch Maree]
 gi|169408451|gb|ACA56862.1| peptidase, M16 family [Clostridium botulinum A3 str. Loch Maree]
          Length = 433

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 214/400 (53%), Gaps = 26/400 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNENLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHIELALEVLSDMLFNSKFKEEDIEKEKGVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF  + I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTVETVKSFKRKDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   N      I    KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINELEKLINKYFGNWNSGENKNITVYSKPKIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDAYPLILLSNVLGGGASSILFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
               A T   + +++ ++ +  +  I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----AYTEDTITLIKQVVNDFSKEGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
              K V+F   I   E I+  I  IT + +  +  + F +
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEIMDRTFGA 397


>gi|153940329|ref|YP_001391709.1| M16 family peptidase [Clostridium botulinum F str. Langeland]
 gi|152936225|gb|ABS41723.1| peptidase, M16 family [Clostridium botulinum F str. Langeland]
 gi|295319737|gb|ADG00115.1| peptidase, M16 family [Clostridium botulinum F str. 230613]
          Length = 433

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 213/400 (53%), Gaps = 26/400 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNENLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHIELALEVLSDMLFNSKFKEEDIEKEKGVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF  + I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTVETVKSFKRKDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   N      I    KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINELEKLINKYFGNWNSGENKNITVYSKPKIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDAYPLILLSNVLGGGASSILFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
                 T   + +++ ++ +  +  I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----TYTEDTITLIKKVVNDFSKEGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
              K V+F   I   E I+  I  IT + +  +  K F +
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEIMDKTFGA 397


>gi|168184617|ref|ZP_02619281.1| peptidase, M16 family [Clostridium botulinum Bf]
 gi|237795847|ref|YP_002863399.1| peptidase, M16 family [Clostridium botulinum Ba4 str. 657]
 gi|182672286|gb|EDT84247.1| peptidase, M16 family [Clostridium botulinum Bf]
 gi|229262539|gb|ACQ53572.1| peptidase, M16 family [Clostridium botulinum Ba4 str. 657]
          Length = 433

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 214/400 (53%), Gaps = 26/400 (6%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +  + S  V + I  GSRNE  + +G++HF+EHM+FKGT  R+A +I E I
Sbjct: 9   NGLRVVLENIDYVKSVSVGLWIENGSRNENLKNNGISHFIEHMMFKGTENRSALQIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T Y+  +L  H+ LALE++ DML NS F   DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCYYIKILNSHIELALEVLSDMLFNSKFKEEDIEKEKGVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M+ED   D L     + +W D  I  PILG  ET+ SF  + I+ ++++ Y  +   +  
Sbjct: 129 MTEDSPEDVLSDLHCKAIWGDDSISYPILGTVETVKSFKRKDIVDYINKYYIPENSVISI 188

Query: 189 VGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
            G  D       +  YF   N      I    KP +       + +++ + H+ LGF G 
Sbjct: 189 CGNFDINELEKLINKYFGNWNSGENKNITVYSKPRIE-NNHLFKNKNIEQLHISLGFEGL 247

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              + D Y   +L+++LG G SS LFQ++RE++GLCYSI ++  +F+  G + I +    
Sbjct: 248 ELGNDDAYPLILLSNVLGGGASSILFQKIREEKGLCYSIYSYMSSFNKTGAVSIYTGLNP 307

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER---SYLRALEIS----- 357
               A T   + +++ ++ +  +  I+KE      KLIKS+E+   SY+  LE +     
Sbjct: 308 ----AYTEDTITLIKKVVNDFSKEGINKE------KLIKSKEQLKGSYILGLESTSTRMF 357

Query: 358 ---KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
              K V+F   I   E I+  I  IT + +  +  + F +
Sbjct: 358 NNGKSVLFLNRINDPEIIMKKIDKITEDKLQEIMDRTFGA 397


>gi|312622358|ref|YP_004023971.1| processing peptidase [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202825|gb|ADQ46152.1| processing peptidase [Caldicellulosiruptor kronotskyensis 2002]
          Length = 424

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 226/408 (55%), Gaps = 10/408 (2%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GI ++ E +  + +  + + + AGSR E ++ +G++HF+EH+LFKGT  R+A
Sbjct: 2   IKLHTLSNGIRLVYEKIDTVKTVSIGIWVLAGSRYETKKINGISHFIEHILFKGTKNRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEIV EIE +GG INA+T+ E+T ++  VL E +    +I+ D++ N      ++E+E+ 
Sbjct: 62  KEIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLQKGFDILSDLILNPVIALEEMEKEKT 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M+++D  + L    + ++WK+Q +  PI+GK  T+      KI +++   Y  
Sbjct: 122 VIIEEINMTKEDPEEILYQSLNNLIWKNQTLSYPIIGKESTVKKIDRNKIENYMRERYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN--VCSVAKIKESM----KPAVYVGGEYIQKRDLAE 235
             + +   G  + E  +   E YF    CS +K K+S     KPA +  G  I+ + + +
Sbjct: 182 QNIVISVAGNFEEEKLIEFAEMYFGDWKCSNSK-KDSFDFISKPA-FNRGAVIKNKKVDQ 239

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ + F G   +    Y   +L++ILG GMSSRLFQ +RE+ GL YSI++    F D G
Sbjct: 240 AHLAITFEGFGQEDEKVYELLVLSNILGGGMSSRLFQRIREELGLVYSITSFVSTFKDAG 299

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRAL 354
           VL I + T  +NI A+   I+  ++  L+  I   E++    +I   +I   E +  R  
Sbjct: 300 VLIIYAGTNPKNISAVYKEIMSQLRLFLKGEILLDEVEVAKQQIKGSIIFGLENTSSRMS 359

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            + K ++    I+  E I   I +I    ++  A+++ S   ++A++G
Sbjct: 360 NMGKNMLLLNKIMELEHITKIIDSIDYIKVIDTAREVLSKEFSVAVVG 407


>gi|125972940|ref|YP_001036850.1| peptidase M16-like protein [Clostridium thermocellum ATCC 27405]
 gi|256005695|ref|ZP_05430651.1| peptidase M16 domain protein [Clostridium thermocellum DSM 2360]
 gi|281417151|ref|ZP_06248171.1| peptidase M16 domain protein [Clostridium thermocellum JW20]
 gi|125713165|gb|ABN51657.1| peptidase M16-like protein [Clostridium thermocellum ATCC 27405]
 gi|255990326|gb|EEU00452.1| peptidase M16 domain protein [Clostridium thermocellum DSM 2360]
 gi|281408553|gb|EFB38811.1| peptidase M16 domain protein [Clostridium thermocellum JW20]
 gi|316940824|gb|ADU74858.1| peptidase M16 domain protein [Clostridium thermocellum DSM 1313]
          Length = 419

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 127/400 (31%), Positives = 223/400 (55%), Gaps = 4/400 (1%)

Query: 7   KTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           K  +G+ V+ E +P + S  + + +  GSRNE Q  +G++HF+EHMLFKGT  R+A+EI 
Sbjct: 6   KLENGVRVVCEKIPYLRSVSIGIWVGTGSRNESQSNNGISHFIEHMLFKGTDNRSAREIA 65

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           + I+ +GG +NA+T  E T Y+   L  H  +AL+++ DM  NS F   DIE E+ V+LE
Sbjct: 66  DSIDSIGGQLNAFTGKECTCYYTKTLDSHADIALDVLSDMFFNSRFEEKDIEVEKKVILE 125

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EIGM ED   + +    SE VW+D  +G PILG  ET+ +   +KI ++++  Y      
Sbjct: 126 EIGMYEDSPEELVHDILSETVWEDNSLGLPILGTRETLLNINKDKIKAYINERYLPQNTV 185

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVA-KIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
           +   G  + +  +  ++  F   + + K  ++++ A +     I+ +D  + H+ +GF G
Sbjct: 186 IAVAGNFEEDRIIDVIKEKFGGWNASGKDSKTIEDAKFKVNSKIKVKDTEQIHICMGFEG 245

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
            A+ S + Y    + ++LG GMSSR+FQ++RE++GL YSI ++  ++ + G+  I +   
Sbjct: 246 VAHGSDELYPLLAVNNVLGGGMSSRMFQKIREEKGLVYSIYSYPSSYKNAGLFTIYAGMN 305

Query: 305 KENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            E++  +   I++ ++ LL E + + E++K   ++    I   E +  R   + K  +  
Sbjct: 306 AEHLEKVVELIIKEIKILLKEGLSKDELEKSKEQLKGSYILGLESTSSRMNSMGKSEVLM 365

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
             I   ++I+  I A+  E +  V K+IF     + AI+G
Sbjct: 366 DRIYTPDEILKKIDAVNQESVERVIKQIFCLDKISFAIVG 405


>gi|269795631|ref|YP_003315086.1| Zn-dependent peptidase [Sanguibacter keddieii DSM 10542]
 gi|269097816|gb|ACZ22252.1| predicted Zn-dependent peptidase [Sanguibacter keddieii DSM 10542]
          Length = 441

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 125/414 (30%), Positives = 217/414 (52%), Gaps = 12/414 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R S    G+ V+TE MP + SA +   +  GSR+E     G  HFLEH+LFKGT +RT
Sbjct: 25  TIRRSVLPGGVRVLTEHMPGLRSATLGAWVGVGSRDETSGHFGSTHFLEHLLFKGTQRRT 84

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I E  + VGG+ NA T  EHT Y+A VL   +P+A+++I DM++++  + +++E ER
Sbjct: 85  AMDIAEAFDAVGGEANAATGKEHTCYYARVLDSDLPMAVDVITDMVTSARLDEAELETER 144

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M++DD  D +   F+  V     +GRPI G P+TI +     +      +Y 
Sbjct: 145 GVILEELAMNDDDPADVVHEEFAAAVLAGHALGRPIGGTPDTIRAVPRAAVWEHYQWHYR 204

Query: 181 ADRMYVVCVGAVDHEFCVSQV-----ESYFNVCSVAKIKESMKPA-----VYVGGEYIQK 230
            + + +   G VDH+   +QV     +  +++ + A  +     A       VG E   +
Sbjct: 205 PETLVISAAGGVDHDALCAQVAQALTDGGWDLAAGASPRARRDSADITGVGEVGTELTVR 264

Query: 231 RDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHEN 290
           R + + ++++G  G +      ++ ++L+++LG GMSSRLFQE+REKRGL YS  +    
Sbjct: 265 RSVEQGNVIIGSTGLSATDDRRFVMSVLSAVLGGGMSSRLFQEIREKRGLAYSTYSFASG 324

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERS 349
               G   + +  A   I  ++  +V  ++ L +  I   E+ +   ++   L+   E S
Sbjct: 325 HGGIGTFGLYAGCAPAKIDEVSELMVVELEKLADSGITTSELARSIGQLSGGLVLGLEDS 384

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   + K  +  G +L   + ++ I ++T E++  +AK +     +   +GP
Sbjct: 385 GSRMSRLGKADLVTGELLSVAESLERIRSVTAEEVQALAKDLADRPRSTVRVGP 438


>gi|218290097|ref|ZP_03494259.1| processing peptide [Alicyclobacillus acidocaldarius LAA1]
 gi|218239806|gb|EED06995.1| processing peptide [Alicyclobacillus acidocaldarius LAA1]
          Length = 422

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 139/410 (33%), Positives = 227/410 (55%), Gaps = 15/410 (3%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M LR     +GI V+ E M  I S  + + +  GSR E Q E+G++HFLEHM FKGT++ 
Sbjct: 5   MTLR-----NGIRVVGEEMSSIRSVSLGIWVETGSRYESQNENGISHFLEHMFFKGTSRH 59

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +AKE+    + +GG +NA+T+ E T ++A VL EH  +ALE + +ML++S F P ++E+E
Sbjct: 60  SAKELAHLFDDLGGQVNAFTAKEFTCFYARVLDEHFSIALETLAEMLTDSRFAPEEMEKE 119

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV+EEI M ED   + +    +  V+ +  +G  ILG+ E +  F+ + ++ +V R+Y
Sbjct: 120 KRVVIEEIRMYEDSPDELVMDLIARGVYGEHPLGYNILGRDENLLRFSRDDLVRYVDRHY 179

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY-----IQKRDLA 234
             +RM V   G V  +  + +VE  F    +AK  +S  P V V   +      +++D+ 
Sbjct: 180 RPERMVVSVAGHVPEDVVIREVERVFG--GLAKGADSAAP-VLVPPPFHKTVTTEEKDIE 236

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + H+ L   G    SR+ Y   +L ++LG   SSRLFQE+RE+RG+ YS+ + H  + D 
Sbjct: 237 QVHICLAAPGYPAGSRELYPLLLLNNVLGGTQSSRLFQEIREERGMAYSVYSFHTGYRDA 296

Query: 295 GVLYIASATAKENIMALTSSIVEV-VQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G+  I   T+ E    + + + +V V+   E I + E++K   ++   L+   E S  R 
Sbjct: 297 GMFGIYVGTSPETAEEVLNLVQQVTVRMWQEPISRDELEKAKRQVKGALMLGLESSGSRM 356

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++K  +     +  E+ I  I A+T EDI  VA+ + S    LA +GP
Sbjct: 357 SRLAKNEILLRRDVPLEETIAGIDAVTPEDIQRVAEDVLSHGFALAAVGP 406


>gi|258511424|ref|YP_003184858.1| processing peptidase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478150|gb|ACV58469.1| processing peptidase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 421

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/397 (32%), Positives = 220/397 (55%), Gaps = 3/397 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI V+ E M  I S  + + +  GSR E Q E+G++HFLEHM FKGT++ +AKE+    
Sbjct: 9   NGIRVVGEEMSSIRSVSLGIWVETGSRYEAQSENGISHFLEHMFFKGTSRHSAKELAHLF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+T+ E T ++A VL EH  +ALE + +ML++S F P ++E+E+ VV+EEI 
Sbjct: 69  DDLGGQVNAFTAKEFTCFYARVLDEHFSIALETLAEMLTDSRFAPEEMEKEKRVVIEEIR 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   + +    +  V+ +  +G  ILG+ E +  F+ E ++ +V+R+Y  +RM V  
Sbjct: 129 MYEDTPDELVMDLIARGVYGEHPLGYTILGRDENLLRFSREDLVRYVNRHYRPERMVVSV 188

Query: 189 VGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G V  +  + +VE  F  +   A    ++ P  +      +++D+ + H+ L   G   
Sbjct: 189 AGHVPEDVVIREVERVFGGLTKGADGAPALVPPPFHKTVTTEEKDIEQVHICLAAPGYPA 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
            SR+ Y   +L ++LG   SSRLFQE+RE+RG+ YS+ + H  F D G+  I   T+ E 
Sbjct: 249 GSRELYPLLLLNNVLGGTQSSRLFQEIREERGMAYSVYSFHTGFRDAGMFGIYVGTSPET 308

Query: 308 IMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
              + + + +V   +  E I + +++K   ++   L+   E S  R   ++K  +  G  
Sbjct: 309 AEEVLALVQQVTARMWQEPISRDQLEKAKRQVKGALMLGLESSGSRMSRLAKNEILLGRE 368

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  E+ +  I A+   DI  VA+ + S    LA +GP
Sbjct: 369 VPLEETLAGIDAVAPADIQRVAEDVLSHGFALAAVGP 405


>gi|206602198|gb|EDZ38680.1| Processing peptidase [Leptospirillum sp. Group II '5-way CG']
          Length = 411

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 131/399 (32%), Positives = 221/399 (55%), Gaps = 4/399 (1%)

Query: 9   SSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEE 67
           +SG+ V  + MP   +A + V +R GSR E  EE G+ HFLEHM FKGTT R+A++I  E
Sbjct: 9   ASGVRVYWDPMPESRAASIGVWVRTGSRFEATEEGGVTHFLEHMCFKGTTTRSAEDIANE 68

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           ++ +GG++NA+TS E TS++A VL E+   A  ++GD+L+NS F+P ++ERER VVLEE+
Sbjct: 69  MDFLGGEMNAFTSQEVTSFYATVLTENSRQAGNLLGDILTNSVFDPVELERERGVVLEEL 128

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
             S+DD  D +      + + D   G PILG  E+I+ F+   +  +   +Y    +++ 
Sbjct: 129 AESKDDPEDRVMENLFRIYFGDHPFGAPILGTEESITRFSRASVREYFKTHYHPGNLFIT 188

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMMLGFNGCA 246
             G V  +  +  +E+ F   SV     S+          +++ D  E+ H+ +G  G  
Sbjct: 189 IAGNVHWDEVIDALENAFQNISVRNPSSSLLTTPVPSFSRMEEEDDYEQVHLCIGLRGLP 248

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
                     +L + LG GMSSRLFQEVREKRGL YS+ +   +FSD G++ I+++T   
Sbjct: 249 QPHPHQTALRVLTTHLGGGMSSRLFQEVREKRGLAYSVFSSPLSFSDGGIVRISASTRPS 308

Query: 307 NIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
               L + +VE ++ L +  +   E+ +   ++ + L+   E +  R  ++ + ++  G 
Sbjct: 309 RREELATVLVEELRRLEKIPLTVSELTRSKNQLKSSLLLGLESAGGRMSKMGRDLLNWGR 368

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGP 403
            +   +I   I  +T EDI+ + +++ +      ++LGP
Sbjct: 369 EIAVTEIEQWIDQVTSEDILHLVQELKWGEEQAFSVLGP 407


>gi|56552786|ref|YP_163625.1| Mitochondrial processing peptidase-like protein [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56544360|gb|AAV90514.1| Mitochondrial processing peptidase-like protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 408

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 218/403 (54%), Gaps = 2/403 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ R+ + S+G+ +  + M  +++  V +    G+R+E     G+AH +EHM+FKG   R
Sbjct: 1   MSPRLHRLSNGLAIALQPMSGVETMAVGLYSNVGARSEPNHYSGLAHMVEHMVFKGAAGR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A+ I E  E  GG +NA+T+ +HT + A +L E+  L LE++ D++ + + +  ++ERE
Sbjct: 61  NARMIAEAAENCGGQLNAWTARDHTVFQARMLSEYWDLGLELVADLVRSPTLDGEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL E+G S D   D +      + +KDQ +GRP+LG   +I +     +  +V + Y
Sbjct: 121 KGVVLSELGESYDTPDDIIHDYLQSVAFKDQALGRPVLGNETSIKAIDRPALSQWVKQYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             +   +   G +D +  +   ES F+     +   +++ A +  G Y   RD  + H+ 
Sbjct: 181 QPEGFVLAAAGKIDEDAFLKMAESRFSDWGKGQ-PLAVEKAKFTTGRYDDHRDSDQTHIA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG+ G +YQ    + + +LASILG GMSSRLFQ +RE+ GL YS+ +  +++ + G+  I
Sbjct: 240 LGYRGFSYQDIRSHASALLASILGGGMSSRLFQILREEEGLVYSVYSWSQSWIETGIFGI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
             A  K++     + I +++   +E++ + E+ +  A+  A L+ + E    R   + +Q
Sbjct: 300 YCAADKKDASKALTLIRQIMADTVESVSEEELQRAKAQARAGLLMNLEGVAARCDHLGRQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           +     I+   ++++ I A++ +DI  V +   S    LA +G
Sbjct: 360 IQIHNRIVNPSEVVEWIDAVSLDDIRSVGQYSLSQGEALASVG 402


>gi|51892670|ref|YP_075361.1| processing protease [Symbiobacterium thermophilum IAM 14863]
 gi|51856359|dbj|BAD40517.1| processing protease [Symbiobacterium thermophilum IAM 14863]
          Length = 426

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 215/394 (54%), Gaps = 5/394 (1%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +   +G+ V+TE +  + SA V V +  GS  E   E G++H +EHMLFKGT +R+A 
Sbjct: 5   RKTTLPNGLRVVTEAIGHVRSAAVGVYVGTGSLYEAPAEMGVSHLIEHMLFKGTERRSAL 64

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI   I+  GG +NAYT+ E+T Y+A VL EH+PLAL+++ DM+ NS F+P D+ RE++V
Sbjct: 65  EIARAIDGRGGALNAYTAKEYTCYYARVLDEHLPLALDVLADMILNSRFDPDDLAREKDV 124

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + EEI M +D   D +   F+  +W+   +GRPI+G  E + + +   I+++ +R+Y   
Sbjct: 125 ICEEIRMYDDVPDDLVHDLFAGALWRGHALGRPIVGTVERVQAMSRADILAYKNRHYVPA 184

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            M V   G ++HE  V  V   F   +     +      P        ++++++ + H++
Sbjct: 185 NMVVAAAGHLEHERVVEWVAELFGAAAAEADGRPAPDAPPVPRTPAIAVRQKEIEQAHLV 244

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG    +    + Y  ++L +I+G   SSRLFQEVREKRGL YS+ ++H ++   G   +
Sbjct: 245 LGTTALSLDDPNIYALHVLNAIVGGSSSSRLFQEVREKRGLAYSVYSYHSSYRSAGAFGV 304

Query: 300 ASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  +   + A    +  V+  L    + + E+ +   ++  +L+   E +  R   + +
Sbjct: 305 YAGVSPRMVGATLDVVTGVLSELGRRGVTEEELAEAREQLKGQLMLGLESTSSRMSRLGR 364

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G +   +++I  + A+T E +  +A ++F
Sbjct: 365 GELIRGFVHSPDEVIARVEAVTLEQVNELAHRLF 398


>gi|284992337|ref|YP_003410891.1| peptidase M16 domain-containing protein [Geodermatophilus obscurus
           DSM 43160]
 gi|284065582|gb|ADB76520.1| peptidase M16 domain protein [Geodermatophilus obscurus DSM 43160]
          Length = 459

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/415 (29%), Positives = 216/415 (52%), Gaps = 19/415 (4%)

Query: 4   RISKT--SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           R+ +T    G+ V+TE MP + SA V + +  GSR+E     G +HFLEH+LFKGT  R+
Sbjct: 40  RVERTELPGGLRVLTETMPGVLSATVGIWVGVGSRDETDAVAGSSHFLEHLLFKGTGSRS 99

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   ++ VGG++NA+T+ EHT Y+A VL   +PLA+ ++GD+++++    +D+E ER
Sbjct: 100 ALEIATAMDAVGGEMNAFTAKEHTCYYANVLASDLPLAVTLLGDLVTDALNTAADLESER 159

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M +D+  D +   F+E ++    +GR +LG  E+I   T E +  +  R YT
Sbjct: 160 TVVLEEIAMRDDEPSDLVHDLFAETLFGGTALGRSVLGTVESIEGLTREDVDGWYRRRYT 219

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----------YIQ 229
              + V   G V+H+  +  V + F      ++    +PA    GE            + 
Sbjct: 220 VPSIVVTAAGRVEHQQVLDLVTAAFG----DRLSGPGRPAALRRGEEGAATSPARPTGLV 275

Query: 230 KRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHE 289
           +R   + H++LG  G        Y   ++ + +G GMSSRLFQE+REKRGL YS+ +   
Sbjct: 276 RRRTEQTHVLLGSVGLGRLDERRYAAAVMETAVGGGMSSRLFQEIREKRGLVYSVGSALS 335

Query: 290 NFSDNGVLYIASATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
           +++  G   + +  + + +  +   +  E+ +   + +   E+ +   ++   L+   E 
Sbjct: 336 HYAGTGSFSVYAGCSPKRVPEVLRLVREELARVAADGLTSEEVARGRGQLKGGLVLGLED 395

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  R   + K  +  G  L   +++  +  +  E +  VA  + +    LA++GP
Sbjct: 396 TGSRMSRLGKSELSYGEYLPVREVLARLDGVEEEQVRAVAADLLARDTCLAVVGP 450


>gi|302039397|ref|YP_003799719.1| putative M16 family Zn-dependent peptidase [Candidatus Nitrospira
           defluvii]
 gi|300607461|emb|CBK43794.1| putative Zn-dependent peptidase, M16 family [Candidatus Nitrospira
           defluvii]
          Length = 417

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 217/405 (53%), Gaps = 8/405 (1%)

Query: 12  ITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEK 70
           + ++ E++P + S  + + +  GSR+E+  E G++HFLEHM FKGT  RTA +I  EI+ 
Sbjct: 11  LRIVAELLPTLKSVTIGIWVNVGSRDEQPGEEGLSHFLEHMFFKGTRSRTATQISREIDA 70

Query: 71  VGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMS 130
           +GG++NA+T+ E T+++  VL + +  ALE++ D+   S F   ++E+E+ VVLEEI M 
Sbjct: 71  LGGEMNAFTTRETTTFYVKVLDQQLEAALELLSDLFYRSRFESKEVEKEKQVVLEEIRMV 130

Query: 131 EDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVG 190
           +DD  D +     +       +GRPILG+   I +     ++S+V  +Y  +R  V   G
Sbjct: 131 QDDPEDLVQELHMKHTLGSHPLGRPILGQAPRIQALGRNDLVSYVGSHYDPERTVVAVAG 190

Query: 191 AVDHEFCVSQVESYFNVCSVA-KIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQS 249
                     +  YF+        + S +P    GG  ++++ L + H+ LG  G +   
Sbjct: 191 NFTWRRLEQLLARYFSDSHKGVAARPSRRPPEVKGGVLVKRKALEQVHLCLGLQGLSAGH 250

Query: 250 RDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIM 309
           +D Y  + L  +LG  +SSRLFQEVREKRGL YSI +    +SD G+  + + T  + + 
Sbjct: 251 KDRYAAHALNGVLGGSVSSRLFQEVREKRGLVYSIYSFLSTYSDGGMTTVYAGTRPKEVE 310

Query: 310 ALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILC 368
            +   +   ++ L    I+ +++ +   ++   L+ S E S+ R  +++K  +  G+ + 
Sbjct: 311 RVVEVVCRELKKLRTHGIDAKDLARVKNQMKGSLMLSLESSHSRMSKLAKDELTQGNHVS 370

Query: 369 SEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTS 412
            E++I  I  +T + +  VA+ +      ++  LGP    +PT S
Sbjct: 371 LEQMIAEIDRVTTDQVYRVAQTLLDQRCLSITALGP----IPTKS 411


>gi|226313010|ref|YP_002772904.1| zinc protease [Brevibacillus brevis NBRC 100599]
 gi|226095958|dbj|BAH44400.1| probable zinc protease [Brevibacillus brevis NBRC 100599]
          Length = 417

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 227/402 (56%), Gaps = 4/402 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE +P + S  + + +  GS+ E ++ +G++HFLEHM FKGT  R+AKEI E  
Sbjct: 9   NGLRIVTERIPSVRSVALGIWVGTGSKYENEKNNGISHFLEHMFFKGTKTRSAKEIAETF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG++NA+TS E+T Y+A VL +H P+AL+++ DM  NS F+  ++E+E+NVV+EEI 
Sbjct: 69  DEIGGNVNAFTSKEYTCYYARVLDQHAPIALDVLSDMYFNSVFDADELEKEKNVVIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    +   +    +G  ILG  + + S   + +++++ ++Y      +  
Sbjct: 129 MYEDTPDDLVHDLIARASYSTHPLGYSILGTEDVLRSLKRDDLLAYIDQHYLPTNTVITV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G  + +  +  ++  F   S + I  ++    + G      +   + H+ L   G    
Sbjct: 189 AGNFE-DSLIEDIQKRFQAFSRSGIMPTLSTPDFAGNVIAHHKATEQAHLCLSLPGFKVG 247

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             + Y   +L ++LG  MSSRLFQE+RE+RGL YS+ ++H ++ + G  ++ + TA E +
Sbjct: 248 HPEVYSLILLNNVLGGSMSSRLFQEIREERGLAYSVYSYHSSYKEAGTFHVYTGTAPEQV 307

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   +  V++ + ++ I  +E++K   ++   L+ S E +  R   + K  +  G  L
Sbjct: 308 GQVFDIVSRVLRDVADHGITDKELNKGKEQLKGSLMLSLESTNSRMSRLGKNELLLGRHL 367

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
             ++II  I  ++ E ++ VA+++F S  ++A++  P+D  P
Sbjct: 368 SLDEIIAKIDRVSHESVLAVAQQLFRSKMSMAMVS-PLDGFP 408


>gi|153954063|ref|YP_001394828.1| zinc protease [Clostridium kluyveri DSM 555]
 gi|219854676|ref|YP_002471798.1| hypothetical protein CKR_1333 [Clostridium kluyveri NBRC 12016]
 gi|146346944|gb|EDK33480.1| Predicted zinc protease [Clostridium kluyveri DSM 555]
 gi|219568400|dbj|BAH06384.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 432

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/327 (36%), Positives = 187/327 (57%), Gaps = 15/327 (4%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            + K  +G+ ++ E +  ++S  V + ++ GSRNE  + +G++HF+EHM FKGTT RTA 
Sbjct: 3   NVFKLDNGLRIVVEDIDYVNSVSVGLWVKNGSRNENDKNNGISHFIEHMFFKGTTNRTAL 62

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI E IE VGG INA+T  E T ++  VL  H+ LA+++I DML NS F P DIE+E+ V
Sbjct: 63  EIAECIEDVGGQINAFTGKEATCFYVKVLNSHLDLAIDVISDMLFNSRFLPEDIEKEKGV 122

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           ++EEI MSED   D L    S+ +W    I  PILG  +T+ SFT E +I ++S  Y  +
Sbjct: 123 IIEEINMSEDSPEDVLSDLHSKAMWGKDSISFPILGSIDTVKSFTREHLIEYISSYYIPE 182

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSV--AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
              +   G V+       +E YF   ++   K+    KP  ++   + +K+++ + H+ L
Sbjct: 183 NSVISIAGNVELSKVEKLIEKYFGTWAILNKKVTHYSKPE-FLNNHFFKKKNIEQLHLSL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL--- 297
           G  G    S D Y   IL ++ G   SS LFQ++RE+RGLCYSI ++  +F++ G +   
Sbjct: 242 GIPGVENGSDDLYTLLILNNMYGGMASSILFQKIREERGLCYSIYSYITSFNNVGAVTVY 301

Query: 298 --------YIASATAKENIMALTSSIV 316
                   Y   A  K+ ++  ++SI+
Sbjct: 302 VGLNAKYAYDVIARIKDEMIKFSTSII 328


>gi|119964387|ref|YP_947338.1| Zn-dependent peptidase [Arthrobacter aurescens TC1]
 gi|119951246|gb|ABM10157.1| putative Zn-dependent peptidases, family M16 [Arthrobacter
           aurescens TC1]
          Length = 448

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 217/412 (52%), Gaps = 11/412 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA +   +  GSR+E   +HG  HFLEH+LFKGT +RTA
Sbjct: 28  VRRSVLPGGVRVLTEAMPGQRSATIGFWVAVGSRDEADGQHGSTHFLEHLLFKGTKRRTA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    ++VGG+ NA T+ E T Y A VL   +P+A+++I DM++ +  +P+++E+ER+
Sbjct: 88  LEIASAFDEVGGESNAATAKESTCYFARVLDTDLPMAIDVIADMITGAVLDPAELEQERD 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M  DD  D    +F   V     + RPI G P+ I +   + + +   R Y  
Sbjct: 148 VILEEIAMDSDDPTDVAHEKFVAAVLGHHPLARPIGGTPDAIKAVARDSVWAHYQRYYRP 207

Query: 182 DRMYVVCVGAVDH----EFCVSQVES---YFNVCSVAKIKESMKPAVYVG--GEYIQKRD 232
           + + +   G +DH    E  +  +++     N  +    +     AV  G  G ++ KR 
Sbjct: 208 EELVITAAGGLDHDVVCELVLDALKAAGWQLNADAAPVNRRGTDRAVITGTSGLHVVKRP 267

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           + + ++++G           ++ ++L ++LG GMSSRLFQE+REKRGL YS  +    ++
Sbjct: 268 VEQANIIMGCPTIVATDDRRFVMSVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFTAAYA 327

Query: 293 DNGVLYI-ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + A  T  +    L    +E+ +   E I   E+ K   ++   ++ + E +  
Sbjct: 328 DAGYFGMYAGCTPSKVRQVLELLGLELDKLAKEGITDEELRKAVGQLSGGIVLALEDTGS 387

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   + +  +  G     ++ +  I A+T ED+  +A+++ ++  T+ ++GP
Sbjct: 388 RMSRLGRAELVSGEFQDIDETLARIKAVTVEDVQELARELAAAPRTITVVGP 439


>gi|312127531|ref|YP_003992405.1| processing peptidase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777550|gb|ADQ07036.1| processing peptidase [Caldicellulosiruptor hydrothermalis 108]
          Length = 422

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 219/405 (54%), Gaps = 5/405 (1%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GI ++ E +  + +  + + + AGSR E ++ +G++HF+EH+LFKGT  R++
Sbjct: 2   IKLHTLSNGIRLVYEKIDTVKTVSIGIWVLAGSRYETKKINGISHFIEHILFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EIV EIE +GG INA+T+ E+T ++  VL E +    +I+ D++ N      +IE+E+ 
Sbjct: 62  REIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLQKGFDILSDLILNPVIAAEEIEKEKT 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M++DD  + L    ++++WK Q +  PI+GK  T+      KI  ++   Y  
Sbjct: 122 VIIEEINMTKDDPEEMLYQSLNDLIWKSQALSYPIIGKESTVKKIDKIKIECYMKERYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN--VCS-VAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             + +   G    E  +  V+ YF    CS    +   +   V+  G  I+ +   + H+
Sbjct: 182 QNIVISVAGNFAEEKLIEFVKMYFGDWKCSNKTDVSYCISKPVFNRGVVIKNKKSDQAHL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            + F G   +    Y   +L++ILG GMSSRLFQ +RE+ GL YSIS+    F D GVL 
Sbjct: 242 AVTFEGFGQEDEKVYELLVLSNILGGGMSSRLFQRIREELGLVYSISSFVSTFKDAGVLI 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T  +NI A+   I+  +   L+  I   E++    +I   +I   E +  R   I 
Sbjct: 302 IYAGTNPKNIAAVYKEIMNQLNLFLKGEILPDEVEVAKQQIKGSIIFGLENTSSRMSNIG 361

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           K ++    I+  E I   I +I   +++  A+++ S   ++A++G
Sbjct: 362 KNMLLLNKIMEIEHITKIIDSIDYTNVIDTAREVLSKEFSVAVVG 406


>gi|118580533|ref|YP_901783.1| processing peptidase [Pelobacter propionicus DSM 2379]
 gi|118503243|gb|ABK99725.1| processing peptidase [Pelobacter propionicus DSM 2379]
          Length = 429

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/410 (32%), Positives = 227/410 (55%), Gaps = 5/410 (1%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI V+T+ V  + +  + + +  G+R+E    +G+AHF+EH+LFKGT +R+A++I  EI
Sbjct: 19  NGIRVVTQRVKYMHTVSMGIWVANGTRHEAPHLNGIAHFIEHLLFKGTARRSARQIAMEI 78

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E+  Y+A VL + +P   +++ D+   SSF   +IERER V+L+EI 
Sbjct: 79  DSMGGILNAFTSHEYVCYYAKVLAKFLPRITDLLCDIFLCSSFPSEEIERERRVILQEIK 138

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +D    F+  +F +  W+   +G  I G  ET+SS + E+II +    Y    + +  
Sbjct: 139 MRDDTPDVFIHDQFHQNFWQGDSLGLTIPGSHETVSSLSREQIIDYKQSRYRPRDIVISA 198

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ-KRDLAEEHMMLGFNGCAY 247
            G V HE  +S +E  F+  +  +   +  P  +VG    Q +RDL +  + +G NG + 
Sbjct: 199 AGNVRHEELLSLMEGAFSGMTSDQRSRTEAPVAHVGPRINQCERDLEQTLLCMGTNGLSQ 258

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
              D +  ++L ++LG GMSSRLFQEVRE RGL YSI ++  + +D G L I + T +E 
Sbjct: 259 DHPDRFALHLLNTVLGGGMSSRLFQEVRENRGLAYSIYSYVISHADCGALVIHAGTEQEQ 318

Query: 308 IMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
              +   ++ ++ Q   E + Q E+D    ++   L+ S E S      ++K  ++    
Sbjct: 319 CREVIEIALRQMGQLKREMVPQDELDSAREQLKGNLLMSLESSDNLMTRLAKNDIYLHRN 378

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGPPMDHVPTTSELI 415
              E+++    A+T EDI+ +  ++F  +   L ++G    H   T +L+
Sbjct: 379 QTVEEVLAAFDAVTGEDILRLGNQLFDGSRIHLEVMGKTW-HTGLTEDLL 427


>gi|121535272|ref|ZP_01667086.1| peptidase M16 domain protein [Thermosinus carboxydivorans Nor1]
 gi|121306157|gb|EAX47085.1| peptidase M16 domain protein [Thermosinus carboxydivorans Nor1]
          Length = 339

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 182/323 (56%), Gaps = 1/323 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +   +GI VI+E +P + S  + + +  GSRNE+ + HG++HF+EH++FKGT +R+AK
Sbjct: 3   RKTLLDNGIRVISETIPYVKSVTLGIWVGTGSRNEQDDNHGISHFIEHLMFKGTHQRSAK 62

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI E ++ VGG +NA+T+ E+T Y+  V+  H+ LA++I+ DML  S F+P DI+RER V
Sbjct: 63  EIAEMVDAVGGQLNAFTAKEYTCYYIKVIDSHLDLAIDILSDMLLASKFDPEDIKREREV 122

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEE+ M ED   + +     + VW    +GR ILG   +IS F   +++ +    Y  D
Sbjct: 123 VLEEVKMYEDSPDELVHDLHLDHVWPGHPLGRNILGTLSSISRFDQRRVLDYYDDFYRPD 182

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            + V   G + H   V   E Y    +  K +  +    +     +  ++  + H+ L  
Sbjct: 183 NIVVTAAGNLSHNELVELAERYLGHLTGTKRQLILDKPTFTPVSKVCPKETEQVHLCLSA 242

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
                 + + Y  ++L +ILG G+SSRLFQ +RE+RGL YS+ ++  N+SD G+  + + 
Sbjct: 243 ASVPQDAPEIYAVHVLNNILGGGISSRLFQTIREERGLAYSVYSYQTNYSDAGLFTVYAG 302

Query: 303 TAKENIMALTSSIVEVVQSLLEN 325
           T   N   +   I++ +  L  N
Sbjct: 303 TRPANAPQVLELILQNLADLKAN 325


>gi|116748675|ref|YP_845362.1| processing peptidase [Syntrophobacter fumaroxidans MPOB]
 gi|116697739|gb|ABK16927.1| processing peptidase [Syntrophobacter fumaroxidans MPOB]
          Length = 418

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 215/407 (52%), Gaps = 23/407 (5%)

Query: 10  SGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI V+TE +P   S    + +  GSR+E ++E G+ HF+EHMLFKGT +R+A +I +E 
Sbjct: 9   NGIRVLTEKIPFAHSVSTGIWVGVGSRDEEEDERGITHFIEHMLFKGTQRRSALDIAKEF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG  NA+TS EH   HA VL  H+PL ++++ D+  NS F+ ++IERE+ V+L+EI 
Sbjct: 69  DSVGGFANAFTSKEHVCVHAKVLASHLPLVVDVLSDIFLNSVFSDNEIEREQQVILQEIR 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   +++   F EM WKD  +G PI G  + + S    K++ ++SR++ +D++ +  
Sbjct: 129 MIEDTPDEYVHILFQEMFWKDNPLGLPIYGSAQALESLDRTKVLRYLSRHFHSDKIVISA 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK---------RDLAEEHMM 239
            G +DH+  +           +    E +      G   + K         +DL   H+ 
Sbjct: 189 AGNLDHDRFLEL---------IGPPMEGLNHPALPGRRVVPKNHPLVRIIPKDLELVHVC 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG  G +    + + +++L  +LG  MSSRLFQE+REKRGL YS+ +   +  D G+L I
Sbjct: 240 LGMRGNSQVDENRFASHLLNVVLGSSMSSRLFQEIREKRGLAYSVYSFSHSHVDAGILGI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLL--ENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            +     N+      I E + SLL  E I   E++     +   +  + E +  R   ++
Sbjct: 300 YAGVGARNVQETLELIREQL-SLLADELISDEELNAAKEYLRGSMYLNAESTDSRMNRMA 358

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
           K     G  +   +I + I  +  E I    +++++    T+ ++GP
Sbjct: 359 KNEFLFGRFVDFSEIEEKIVGVRAEQIRDWFREVYTPQELTVLLMGP 405


>gi|297584088|ref|YP_003699868.1| processing peptidase [Bacillus selenitireducens MLS10]
 gi|297142545|gb|ADH99302.1| processing peptidase [Bacillus selenitireducens MLS10]
          Length = 409

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 213/386 (55%), Gaps = 11/386 (2%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + S  + + I  GSR E ++E G++HF+EHMLFKGT  R+ ++I    + +GG +NA TS
Sbjct: 21  VRSVSMGIWIGTGSRYEEEDEKGISHFIEHMLFKGTKTRSPQQIAASFDAIGGHVNAMTS 80

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E+T Y+A VL  H   A++++ D+  +S     DI++E+ V+ EEI M ED   D +  
Sbjct: 81  KEYTCYYAKVLDSHADFAMDVLADIFFHSRLAAEDIKKEQAVIQEEINMYEDTPDDLVFE 140

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
           + SE+ +    +  PILG   TI SFT E++  ++ + YTA+ + +   G V+  F    
Sbjct: 141 QLSEITYGGHPLAGPILGYKSTIDSFTTEQLNDYMKKTYTAENVVISICGHVNERFIEGI 200

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
           +  + ++ S  +     KPA +  GE  +K++  + H+ LGF G A  S   Y   +L +
Sbjct: 201 INRFSDMPS-HQPGLIEKPAFFP-GEKGRKKETDQAHLALGFEGVAADSSQMYPLVLLNN 258

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
            +G  MSSRLFQEVRE+RGL Y++ + HE + D G+L + +  A + +      + EV+ 
Sbjct: 259 AIGGSMSSRLFQEVREERGLAYAVYSFHEAYRDTGLLSVYAGCAIDRL----DHVYEVIM 314

Query: 321 SLLENIEQREI-DKECA----KIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDT 375
           S L+ +++  + D E      ++   L+   E +  R     +  +  G     + +++ 
Sbjct: 315 SNLQKVKESGLTDTEWQNGKEQLKGSLMLGLEGTSSRMQRNGRNELILGRHRTLDDVLER 374

Query: 376 ISAITCEDIVGVAKKIFSSTPTLAIL 401
           I+AI+ EDI  VA  +F  TP+++++
Sbjct: 375 INAISREDIQDVASNLFEQTPSISVV 400


>gi|148273223|ref|YP_001222784.1| M16 family metallopeptidase [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831153|emb|CAN02105.1| putative metallopeptidase, M16 family [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 451

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 129/412 (31%), Positives = 221/412 (53%), Gaps = 11/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R S  +SG+ +++E +P   SA + + +  GSR+E+  + G  HFLEH+LFKGT  RT
Sbjct: 23  RVRRSVLASGVRILSEDVPGSRSATIGMWVAVGSRDEQPGDLGSTHFLEHLLFKGTPSRT 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I    + VGG+ NA T+ E+T Y+A V    + +A++++ DM+++S  +  + E ER
Sbjct: 83  ALDIAVSFDAVGGEHNAVTAKEYTCYYAKVQDRDLGMAVDVLADMVTSSLIDAEEFETER 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M++DD  D +  RF E V  D  +GRPI G P  I +   + +++   RNY 
Sbjct: 143 GVILEELAMADDDPGDVVSERFFEAVLGDHPLGRPIGGSPADIEAAERDAVVAHYRRNYR 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVC----SVAKI----KESMKPAVYVG-GEYIQKR 231
              + +   G+VDH+  V++V +         SVA      +    P +  G G  +  R
Sbjct: 203 PQDLVITAAGSVDHDALVARVTTGLERAGWDLSVAAPPVARRTGSTPVITRGSGLVVVDR 262

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
            + + +++LG  G A          +L S+LG GMSSRLFQEVREKRGL YS+ +   ++
Sbjct: 263 PIEQTNILLGVPGLAASDDRRPALAMLNSVLGGGMSSRLFQEVREKRGLAYSVYSFGASY 322

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSY 350
           SD GV  + +         ++  +VE  + L  EN+ + E+ +   ++  +   + E S 
Sbjct: 323 SDAGVFGLYAGCTAAKTEQVSRLMVEEFRKLAEENVTEEELARAFGQLSGQSALALEDSD 382

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            R   + +  +  G  +  ++ +  +S +T ED+  +A  + S   ++A +G
Sbjct: 383 TRMSRLGRSEITTGEYVDLDETLVRLSRVTAEDVRVLAADLISRPLSIAAVG 434


>gi|295696177|ref|YP_003589415.1| peptidase M16 domain protein [Bacillus tusciae DSM 2912]
 gi|295411779|gb|ADG06271.1| peptidase M16 domain protein [Bacillus tusciae DSM 2912]
          Length = 415

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 216/405 (53%), Gaps = 12/405 (2%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
            + S+G+TV+ E +P I S  V + +  GSR+E  E +G++H +EHMLFKGT  R+AKE+
Sbjct: 5   QQLSNGLTVVVEEIPGIRSISVGIWVGTGSRHETPEINGISHLIEHMLFKGTETRSAKEL 64

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            E  + VGG +NA+T+ E+T ++A VL  H   A+E + DM  +S F P ++ +ER V++
Sbjct: 65  AEVFDHVGGQVNAFTAKEYTCFYAKVLDLHFRRAMETLADMFFHSRFAPEELAKERKVIV 124

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           EEI M ED   + +    + +VW D  +G  ILG  +T+ +F  + ++ ++S+ Y     
Sbjct: 125 EEIRMYEDTPDELVHDLLASVVWGDHPLGFNILGTEQTLQTFERQNLVDYLSQRYVETNT 184

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-KPAVYVGGEYIQKRDLAEEHMMLGFN 243
            +   G V  +  ++ VE  F      + +  + +P  +      + +   +EH  L   
Sbjct: 185 VITVAGHVRTDEVMAIVEELFGGPWNRRAERVITEPPTFTPERGTRVKQTEQEHFCLAVP 244

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G      D +   +L + LG  MSSRLFQ +RE++G+ YSI ++H  + D G+L I +  
Sbjct: 245 GLPVDHEDLHAMILLNNTLGGTMSSRLFQSIREEKGMAYSIYSYHTAYRDTGLLGIYAGM 304

Query: 304 AKENIMALTSSIVEVVQSLLEN-----IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           A E     T  +V  V+ + E+     I + E+++   ++   L+ S E +  R   + K
Sbjct: 305 APE----YTGEVVREVRRIFEDVAESGITEGELERGKEQVKGSLMLSLESTTSRMTRLGK 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             +  G     ++ ++ I A+T ED+  VA +   + P +A +GP
Sbjct: 361 NELLLGRHYTLDETLERIDAVTLEDVRRVA-QCLRNVPAVAAVGP 404


>gi|302381923|ref|YP_003817746.1| peptidase M16 domain protein [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192551|gb|ADL00123.1| peptidase M16 domain protein [Brevundimonas subvibrioides ATCC
           15264]
          Length = 421

 Score =  213 bits (541), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 125/406 (30%), Positives = 207/406 (50%), Gaps = 4/406 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   I   S+G+ V+ + MP + +  + V +R G+R E +   G +H LEH++FKG    
Sbjct: 1   MTATIHTLSNGVRVVCDPMPGLRTLALTVAVRGGTRWESESRSGWSHLLEHLVFKGAGDM 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A+EIVE IE  GG INA T  E TS+    L   + LA++++ D++   + +P++IERE
Sbjct: 61  GAREIVERIEAEGGSINAATGYERTSFEVRALDGSLGLAMQVLSDLVFRPALDPAEIERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++VV +EI  + D   D +      M +  Q +GRPILG  +++       I ++ +R Y
Sbjct: 121 KDVVAQEIAEAFDTPDDHVFEMAQTMAFAGQPMGRPILGSVDSLKPVDRASIEAWRARLY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + DRM V   GAVD    ++  E +F   +VA   ++ +PA + GG     R + + +++
Sbjct: 181 SPDRMVVAVSGAVDETELLALAERWFG-DAVAMPADAPEPARFTGGVATLGRKIEQANLV 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
                            + + ILG GM+SRLFQ  RE RGL Y+I A+HE + D GVL I
Sbjct: 240 FQLPAIPVHDAAMPAMRLFSEILGGGMASRLFQSAREDRGLAYAIDAYHEPYDDTGVLGI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  A +  + L     + V+ L +      E+ +  A +   +  S E    RA   + 
Sbjct: 300 YAGAAADRSVELAEVCADEVRDLTDKGPTDAELSRAKAVLRGGVWMSDESPASRAGRNAA 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP 403
           Q +  G  + S+  +  + A++  D+  V  ++ +S     A+LGP
Sbjct: 360 QTLMFGRPVASDDTVTRLEAVSAGDLRAVGARVLASGLAATAVLGP 405


>gi|170781598|ref|YP_001709930.1| putative protease [Clavibacter michiganensis subsp. sepedonicus]
 gi|169156166|emb|CAQ01307.1| putative protease [Clavibacter michiganensis subsp. sepedonicus]
          Length = 454

 Score =  212 bits (540), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 126/412 (30%), Positives = 220/412 (53%), Gaps = 11/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R S   SG+ +++E +P   SA + + +  GSR+E+  + G  HFLEH+LFKGT  RT
Sbjct: 26  RVRRSVLPSGVRILSEDVPGSRSATIGMWVAVGSRDEQPGDLGSTHFLEHLLFKGTPSRT 85

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I    + VGG+ NA T+ E+T Y+A V    + +A++++ DM+++S  +  + E ER
Sbjct: 86  ALDIAVSFDAVGGEHNAVTAKEYTCYYAKVQDRDLSMAVDVLADMVTSSLIDAEEFETER 145

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M++DD  D +  RF E V  D  +GRPI G P  I +   + +++   RNY 
Sbjct: 146 GVILEELAMADDDPGDIVSERFFEAVLGDHPLGRPIGGSPADIEAAERDAVVAHYRRNYR 205

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVC----SVAKI----KESMKPAVYVGGEY-IQKR 231
              + +   GAVDH+  V++V +         S+A +    +    P +    +  +  R
Sbjct: 206 PQDLVITAAGAVDHDALVARVTAGLERAGWDLSIAAVPVARRTGAAPMITRRSDLVVVDR 265

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
            + + +++LG  G A          +L S+LG GMSSRLFQEVREKRGL YS+ +   ++
Sbjct: 266 PIEQTNILLGVPGLAASDDRRPALAMLNSVLGGGMSSRLFQEVREKRGLAYSVYSFSASY 325

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSY 350
           SD GV  + +         ++  +V+  Q L E ++ + E+ +   ++  +   + E S 
Sbjct: 326 SDAGVFGLYAGCTAAKTAQVSRLMVDEFQKLAEQHVTEEELSRAFGQLSGQSALALEDSD 385

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            R   + +  +  G  +  ++ +  +S +T ED+  +A  + S   ++A +G
Sbjct: 386 TRMSRLGRSEITTGEYVDLDETLVRLSRVTAEDVRALASDLISRPLSIAAVG 437


>gi|312135217|ref|YP_004002555.1| processing peptidase [Caldicellulosiruptor owensensis OL]
 gi|311775268|gb|ADQ04755.1| processing peptidase [Caldicellulosiruptor owensensis OL]
          Length = 422

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 218/405 (53%), Gaps = 5/405 (1%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+G+ ++ E +  + +  + + + AGSR E +  +G++HF+EH+LFKGT  R++
Sbjct: 2   IKLYTLSNGMRLVYEKIDTVKTVSIGIWVLAGSRYETKMINGISHFIEHILFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EIV EIE +GG INA+T+ E+T ++  VL E +    +I+ D++ N      +IE+E+ 
Sbjct: 62  REIVYEIESIGGQINAFTAKEYTCFYVRVLDEFLQKGFDILSDLILNPVIASEEIEKEKM 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M++DD  + L    ++++W+ Q +  PI+GK  T+      KI  ++   Y  
Sbjct: 122 VIIEEINMTKDDPEEMLYQSLNDLIWRSQALSYPIIGKESTVKKIDKTKIEGYMKERYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN---VCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             + +   G    E  +  VE YF      +   +   +   V+  G  I+ +   + H+
Sbjct: 182 QNIVISVAGNFAEEKLIEFVEMYFGDWKYSNKTGVGYCISKPVFNRGVVIKNKKSDQAHL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            + F G   ++   Y   IL++ILG GMSSRLFQ +RE+ GL YSIS+    F D GVL 
Sbjct: 242 AVTFEGFGQENEKVYELLILSNILGGGMSSRLFQRIREELGLVYSISSFVSTFKDAGVLI 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T  +NI ++   I+  +   L+  I   E++    +I   +I   E +  R   I 
Sbjct: 302 IYAGTNPKNIASVYKEIMNQLNLFLKGEILPDEVEVAKQQIKGSIIFGLENTSSRMSNIG 361

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           K ++    I+  E I   I +I   +++  A+++ S   ++A++G
Sbjct: 362 KNMLLLNKIMEIEHITKIIDSIEYTNVIDTAREVLSKEFSVAVVG 406


>gi|300854508|ref|YP_003779492.1| putative zinc-dependent protease [Clostridium ljungdahlii DSM
           13528]
 gi|300434623|gb|ADK14390.1| predicted zinc-dependent protease [Clostridium ljungdahlii DSM
           13528]
          Length = 432

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 206/386 (53%), Gaps = 3/386 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ VI E +  ++S  V + ++ GSRNE ++ +G++HF+EHM FKGT+ RT+ EI E I
Sbjct: 9   NGLKVIVENIDYVNSISVGLWVKNGSRNENEKNNGISHFIEHMFFKGTSNRTSLEIAECI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG INA+T  E T ++   L  H  LA+++I DML NS F+  DIE+E+ V++EEI 
Sbjct: 69  EDVGGQINAFTGKEATCFYVKALDSHFELAIDVISDMLFNSKFSNEDIEKEKGVIIEEIN 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M++D   D L    S+ +W D  I  PILG  +T+ SFT E+++ ++  +YT +   V  
Sbjct: 129 MNDDSPEDVLSDLHSKAMWGDDSISLPILGNADTVKSFTREELLEYIRSHYTPENSVVSI 188

Query: 189 VGAVDHEFCVSQVESYFNVC-SVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G +D       +E YF    S  K   +     ++     +++ + + H+ LG  G   
Sbjct: 189 AGKIDMNTVEKLMEKYFGKWNSNGKSLINYSSPQFLKNHLFKRKSIEQLHISLGVPGVES 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
            + D Y   +L ++ G G SS LFQ++RE+ G+CYSI ++  +F++ GV+ I +    + 
Sbjct: 249 GNDDIYALLLLNNVYGGGTSSILFQKIREEMGICYSIYSYPASFNNIGVVNIYTGLNVKY 308

Query: 308 IMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
              +   I + +Q  + E I+   + K   ++    +   E    +     K V+    +
Sbjct: 309 SYDVICRIKDELQKFVKEGIDSNRLKKAKEQLKGNYVLGLESMSSKMFNNGKSVLLLNKL 368

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIF 392
                IID I+ I  + I  V K  F
Sbjct: 369 STPSDIIDKINKIDQDTIKRVMKNTF 394


>gi|260753486|ref|YP_003226379.1| processing peptidase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552849|gb|ACV75795.1| processing peptidase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 408

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/403 (29%), Positives = 216/403 (53%), Gaps = 2/403 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ R+ + S+G+ +  + M  +++  V +    G+R+E     G+AH +EHM+FKG   R
Sbjct: 1   MSPRLHRLSNGLAIALQPMSGVETMAVGLYSNVGARSEPDRYSGLAHMVEHMVFKGAAGR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A+ I E  E  GG +NA+T+ +HT + A +L E+  L LE++ D++ + + +  ++ERE
Sbjct: 61  NARMIAEAAENCGGQLNAWTARDHTVFQARMLSEYWDLGLELVADLVRSPTLDGEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL E+G S D   D +      + +KDQ +GRP+LG   +I +     +  +V + Y
Sbjct: 121 KGVVLSELGESYDTPDDIIHDYLQSVAFKDQALGRPVLGNETSIKAIDRPALSQWVKQYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             +   +   G +D +  +   E  F+     +   +++ A +  G Y   RD  + H+ 
Sbjct: 181 QPEGFVLAAAGKIDEDAFLKMAEGRFSDWEKGQ-PLAVEKAKFTTGRYDDHRDSDQTHIA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG+ G +YQ    + + +LASILG GMSSRLFQ +RE+ GL YS+ +  +++ + G+  I
Sbjct: 240 LGYRGFSYQDIHSHASALLASILGGGMSSRLFQILREEEGLVYSVYSWSQSWIETGIFGI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
             A  K++       I +++   +E++ + E+ +  A+  A L+ + E    R   + +Q
Sbjct: 300 YCAADKKDASKALILIRQIMADTVESVSEEELQRAKAQARAGLLMNLEGVAARCDHLGRQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           +     I+   ++++ I A++ +DI  V +   S    LA +G
Sbjct: 360 IQIHNRIVNPSEVVEWIDAVSLDDIRSVGQYSLSQGEALASVG 402


>gi|116669996|ref|YP_830929.1| peptidase M16 domain-containing protein [Arthrobacter sp. FB24]
 gi|116610105|gb|ABK02829.1| peptidase M16 domain protein [Arthrobacter sp. FB24]
          Length = 447

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/413 (30%), Positives = 209/413 (50%), Gaps = 13/413 (3%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA +   +  GSR+E   +HG  HFLEH+LFKGT +RTA
Sbjct: 27  VRRSVLPGGVRVLTEAMPGQRSATIGFWVGVGSRDEAHGQHGSTHFLEHLLFKGTKRRTA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    ++VGG+ NA T+ E T Y A VL   +P+A+++I DM++ +  +P ++E+ER+
Sbjct: 87  LEIASAFDEVGGESNAATAKESTCYFARVLDTDLPMAIDVIADMITGAVLDPQEMEQERD 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M  DD  D     F   V     +GRPI G PE I +   + +     R Y  
Sbjct: 147 VILEEIAMDSDDPTDVAHEHFVAAVLGTHPLGRPIGGTPEAIRAVARDSVWDHYRRYYRP 206

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA----------VYVGGEYIQKR 231
           D + +   G +DH+     V    +    A ++    P               G ++ KR
Sbjct: 207 DELVITAAGGLDHDVVCGLVVDALHQAGWA-LEPGAAPVERRSTERADITGTAGLHVVKR 265

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
            + + ++++G           Y+ ++L ++LG GMSSRLFQEVREKRGL YS  +   ++
Sbjct: 266 PVEQANIIMGCPTIVATDGRRYVMSVLNAVLGGGMSSRLFQEVREKRGLVYSTYSFASSY 325

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSY 350
           +D G   + +      +  +   +   +  L E+ I   E+ K   ++   ++ + E + 
Sbjct: 326 ADAGYFGMYAGCTPSKVRQVVELLGAELDKLAEHGISGDELRKAVGQLCGGIVLALEDTG 385

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   + +  +  G     E+ +  I ++T E +  +A ++ ++  T+ ++GP
Sbjct: 386 SRMSRLGRAELVSGEYQDIEETLRQIKSVTVEQVRELALELAAAPRTVTVVGP 438


>gi|39996694|ref|NP_952645.1| M16 family peptidase [Geobacter sulfurreducens PCA]
 gi|39983575|gb|AAR34968.1| peptidase, M16 family [Geobacter sulfurreducens PCA]
 gi|298505705|gb|ADI84428.1| zinc-dependent peptidase, PqqL family [Geobacter sulfurreducens
           KN400]
          Length = 418

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 126/403 (31%), Positives = 221/403 (54%), Gaps = 5/403 (1%)

Query: 5   ISKT--SSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++KT   +G+ +I+E MP + S  + + +  GSR+ER+E +G+AHF+EH++FKGT +R A
Sbjct: 2   VNKTILDNGVRIISEYMPHVHSVSIGIWVANGSRHERREHNGVAHFVEHLMFKGTERRNA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P  ++++ D+  NS F+  +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPKTIDLLADIFLNSIFDSEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D++   F    W+   +G  ILG  E+I   + E II+ +   Y +
Sbjct: 122 VVLQEINMLEDTPDDYVHDLFHRSFWRGHPLGMSILGSVESIEGLSREAIITHLKEKYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G V H+  +S V+  F        ++      Y     + ++DL + H+ LG
Sbjct: 182 DDIIIAVAGNVRHDELLSLVDGLFGRVPEGSGRDICHLPAYEKQVEVVEKDLEQVHICLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
                      +   ++ ++LG  MSSRLFQE+RE+ GL YS+ ++  + +D G L +  
Sbjct: 242 TKAFPQNHPRRFEVYLVNTLLGGSMSSRLFQEIRERLGLAYSVYSYVVSHTDAGSLVVYV 301

Query: 302 ATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T+ E +   L  ++ E+ +   E +   E++    +I   +  S E S  R  +++K  
Sbjct: 302 GTSPEKLDDVLDITVAELKRLKTELVPLPELESAKEQIKGSIYLSLESSDNRMTKLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILG 402
           ++ G  +   ++ D   ++T   I+ +A +IF     TLA++G
Sbjct: 362 IYFGRYIPIHELADGFDSVTSRGILELAGEIFDERYLTLALMG 404


>gi|269838052|ref|YP_003320280.1| peptidase M16 domain-containing protein [Sphaerobacter thermophilus
           DSM 20745]
 gi|269787315|gb|ACZ39458.1| peptidase M16 domain protein [Sphaerobacter thermophilus DSM 20745]
          Length = 421

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 123/400 (30%), Positives = 208/400 (52%), Gaps = 6/400 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK-EIVEE 67
           +G+ V+T  M  + SA + +  R GSR E  ++ G++HFLEHM+FKGT +R     + +E
Sbjct: 9   NGVRVVTSRMDHVRSATLILYFRVGSRYESDDQAGISHFLEHMVFKGTERRPDPIMLTQE 68

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           IE VGG +NA TS E T+Y   V   H+  A +++ DML +S+F+P ++E+ER V++EEI
Sbjct: 69  IEGVGGILNAATSRESTNYWVKVPSAHLARAFDVLADMLRHSTFDPEELEKERFVIIEEI 128

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
               D   D +     E+VW  Q +GRP++G  +T+S+ + E +I+++   Y  DR+ + 
Sbjct: 129 RGIHDTPDDLIHDVIDELVWDGQSVGRPVIGSVDTVSAISREDLITYLRTQYRPDRLVIA 188

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--KRDLAEEHMMLGFNGC 245
             G + HE  V   E YF     + +   ++  V      ++   R   + H+ +     
Sbjct: 189 AAGDIHHEQVVELAEQYFGDLPASDVNTFVQAEVRQQEPRVRLLTRPTEQAHLCVAVPAL 248

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
            Y     Y+  ++ ++L  GMSSRLFQE+RE+ GL Y +  +   ++D G   + + T  
Sbjct: 249 PYTDDRRYVQEMIDAVLSSGMSSRLFQEIRERLGLVYEVYGYFREYADVGQGVVYAGTDP 308

Query: 306 ENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
             +     +I+     L  E +   E+++       +++   E S   A  +  Q    G
Sbjct: 309 ARVEQTIEAILREFDKLRREPVPADELERTKELRRGRIVMGLEDSRAVAAWVGSQEAVFG 368

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            IL  E+++  I A+T E I  +A ++F      LAI+GP
Sbjct: 369 EILTPEEVMARIDAVTAEQIQELATELFRPDLLNLAIVGP 408


>gi|167648452|ref|YP_001686115.1| peptidase M16 domain-containing protein [Caulobacter sp. K31]
 gi|167350882|gb|ABZ73617.1| peptidase M16 domain protein [Caulobacter sp. K31]
          Length = 422

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 117/395 (29%), Positives = 199/395 (50%), Gaps = 2/395 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ + MP +++  + V    G+  E     G +H LEHM+FKG  +R++++IVE I
Sbjct: 12  NGVRVVCDPMPGLETIALSVVAGRGAAYEDPARSGWSHLLEHMVFKGAGQRSSRDIVEVI 71

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E  GG INA T  E TS+    LK  + L + ++ D++   + + +D+ RE+ VV +EI 
Sbjct: 72  EAQGGQINAATGYERTSFQVRALKGGLDLGMGVLADLVLRPTLDEADLTREKQVVAQEIA 131

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
            + D   D++        W D  + RPILG  ++++S T E +  +    Y ADR+ V  
Sbjct: 132 EAADAPDDYVFDLVQAAAWGDHPLARPILGTVDSVNSATVEGLAHWRGELYAADRLIVSA 191

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            GAVD +  +      F          +  PA +VGG   Q R L +  ++      + +
Sbjct: 192 SGAVDLDEVLDLARRAFGSMPAEAGALASDPAGFVGGRKSQARKLEQAQLVFMLPAVSAR 251

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             D++   I A  LG GMSSRLFQE REKRGL Y+I A+ + ++D G L + +  A  + 
Sbjct: 252 EDDYFALRIFAEALGGGMSSRLFQEAREKRGLAYNIDAYADTYADAGALGVYAGCAASDA 311

Query: 309 MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILC 368
                   E +  L   IE  E+ +  A++ A +  ++E+   RA + + Q +    +  
Sbjct: 312 AETAKVCAEQILGLAARIEDAELARAKAQLKAHMFMAREQPLSRAEQAAGQTLMFDRLYT 371

Query: 369 SEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
             ++ + + A++ ED+  + + +        AILG
Sbjct: 372 PAELAEAVDAVSVEDLQRLGRMMLGPGKAATAILG 406


>gi|258652432|ref|YP_003201588.1| peptidase M16 domain-containing protein [Nakamurella multipartita
           DSM 44233]
 gi|258555657|gb|ACV78599.1| peptidase M16 domain protein [Nakamurella multipartita DSM 44233]
          Length = 451

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 129/408 (31%), Positives = 213/408 (52%), Gaps = 13/408 (3%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            G+ V+TE +P   SA + V +  GS +E     G +HFLEH+LFKGT  RT  EI + +
Sbjct: 33  GGLRVVTESVPGARSATIGVWVGVGSVDETPRLAGASHFLEHLLFKGTRTRTGYEIADAV 92

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + VGG++NA+TS E+T Y+A +L E   LA++++ D++ ++     D++ ER V+LEEI 
Sbjct: 93  DAVGGELNAFTSHEYTCYYARILAEQAKLAVDLVCDVVLDAVIATDDVDTERTVILEEIA 152

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M +DD  D L   F+E V+    +  P++G   TI++ +  +I  +  R Y   +M V  
Sbjct: 153 MRDDDPEDTLADAFAEAVFAGHPVAAPVIGSTGTITAMSRSQIAGYYRRRYHPGQMVVAI 212

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY---------VGGEYIQKRDLAEEHMM 239
            G VDH   +  V + F    +A+  E+  PA Y         +G   +  RD  + H+ 
Sbjct: 213 AGGVDHGDALRWVRAAF-ASRLARDPEA-GPAQYRSGRGRARALGRPLVITRDTEQAHLC 270

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG       S D  +  +L+S LG GMSSRLF+ +RE+RGL YS  +    +SD G L +
Sbjct: 271 LGVPSGNRNSPDRSVLAVLSSALGGGMSSRLFRSIREERGLAYSCYSGTAAYSDVGALSV 330

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  A +++  + S I   +  + EN +   E+ +   ++   L  + E S  +   I K
Sbjct: 331 YAGCAPDHLGEVASLIGRELLDVAENGLRPDELTRVRGQLCGSLALALEDSESKMSRIGK 390

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            ++        E+    I ++T E +  +A+++     + AI+GP  D
Sbjct: 391 SLLVRQEFRTVEQEFAAIRSVTAEQVGALARQLLQRPLSAAIVGPYAD 438


>gi|303239216|ref|ZP_07325745.1| peptidase M16 domain protein [Acetivibrio cellulolyticus CD2]
 gi|302593261|gb|EFL62980.1| peptidase M16 domain protein [Acetivibrio cellulolyticus CD2]
          Length = 417

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 127/388 (32%), Positives = 208/388 (53%), Gaps = 7/388 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +I E +P + S  V V +  GSRNE  E +G++HF+EHMLFKGT KR+AKEI E I
Sbjct: 9   NGVRIICEKIPYVRSVSVGVWVGTGSRNETIEINGVSHFIEHMLFKGTNKRSAKEIAESI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG INA+T  E T Y+   L  H+ +AL+++ DM  NS+F+  DI+ ER VV+EEIG
Sbjct: 69  DSIGGQINAFTGKECTCYYTKTLDTHIDIALDLLTDMFFNSTFSKKDIDVERKVVIEEIG 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +     E VW    +G PILG  + +     + II ++S +Y      +  
Sbjct: 129 MYEDSPEDLVHDYLPETVWDGDALGMPILGTHDCLHKINRDTIIDYISGHYLPSNTVIAV 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-YVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G  D    V  ++  F      K  E+    V +   + I+++D  + H+ LGF G  +
Sbjct: 189 AGNYDENSLVESIKRNFGSWHTDKTLENQFGKVSFKASKKIKEKDTEQMHICLGFEGIEH 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA--- 304
            + D Y    + ++ G GMSSRLFQ++RE+ GL YSI ++  ++ + G+  I +      
Sbjct: 249 GNDDLYPLLAVNNVFGGGMSSRLFQKIREEMGLVYSIYSYPSSYKNAGLYTIYAGMNPRH 308

Query: 305 KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
           ++  + L  + + +++     I + E+ K   ++    I   E +  R   + K  +  G
Sbjct: 309 QDTFLRLVMNDIRILEKY--GISEDELAKSKEQLKGSYILGLESTSSRMNSLGKSELMLG 366

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIF 392
            I   E++++ I A+  E +  V K++F
Sbjct: 367 IINSPEEVLNKIDAVNNEKVNEVIKRVF 394


>gi|94264885|ref|ZP_01288659.1| Peptidase M16-like [delta proteobacterium MLMS-1]
 gi|93454655|gb|EAT04923.1| Peptidase M16-like [delta proteobacterium MLMS-1]
          Length = 420

 Score =  209 bits (532), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 208/407 (51%), Gaps = 7/407 (1%)

Query: 3   LRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            R S+ ++G+ ++TE  P     V + I  G+R+E     G AHF+EHMLFKGT +R+A 
Sbjct: 2   FRQSELANGVRIVTEQAPSKVVAVGIWIEVGARDEHDLTSGFAHFVEHMLFKGTERRSAH 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I  E + +GG  NA+TS E T   A VL + +P   +++ D++   +F P+++E ER V
Sbjct: 62  QIAREFDVMGGMANAFTSTETTCVQATVLADRLPQVADLLADIVLAPAFVPAEVENEREV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + +EI M ED   D +   F+  +W    +G P+LG    I +   E + SF  R+Y   
Sbjct: 122 IGQEIAMVEDTPDDLIHDLFNRQLWGRHPLGNPVLGSARVIGALNSEHLRSFHRRHYIPQ 181

Query: 183 RMYVVCVGAVDHE-FCVSQVESY--FNVCSVAKIKESMKPAVYVGGE-YIQKRDLAEEHM 238
           R+ +   G ++HE FC    +S+   +           +P  +   E  +  R L + H+
Sbjct: 182 RILIAAAGQLEHEQFCQLWADSFGALSAPEGTGAGAGRQPPRFAEPERRVFDRGLEQLHL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG--V 296
           MLG  G A    D Y  ++L +ILG  MSSRLFQE+REKRGL Y++ ++    SD+G   
Sbjct: 242 MLGTYGPAENDPDRYAFHLLNTILGGNMSSRLFQEIREKRGLAYAVFSYLNCHSDSGNFG 301

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
           LY+          A   +  E+ +   E +   E+D+      A ++ ++E    R   +
Sbjct: 302 LYLG-VDPLAAEEAAGLAAREIRRLRREPVTAGELDEARDYARALIMLAEENMEARMSRL 360

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++  M  G  L   +I+  +  ++ +DI+ VA + F+       LGP
Sbjct: 361 ARNTMAFGRELPVTEILAKLDRVSVDDIMAVADQTFTRPLNGVALGP 407


>gi|94269021|ref|ZP_01291350.1| Peptidase M16-like [delta proteobacterium MLMS-1]
 gi|93451374|gb|EAT02234.1| Peptidase M16-like [delta proteobacterium MLMS-1]
          Length = 420

 Score =  209 bits (531), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 126/407 (30%), Positives = 209/407 (51%), Gaps = 7/407 (1%)

Query: 3   LRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            R S+ ++G+ ++TE  P     V + I  G+R+E     G AHF+EHMLFKGT +R+A 
Sbjct: 2   FRQSELANGVRIVTEQAPSKVVAVGIWIEVGARDEHDLTSGFAHFVEHMLFKGTERRSAH 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I  E + +GG  NA+TS E T   A VL + +P   +++ D++   +F P+++E ER V
Sbjct: 62  QIAREFDVMGGMANAFTSTETTCVQATVLADRLPQVADLLADIVLAPAFVPAEVENEREV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + +EI M ED   D +   F+  +W    +G P+LG    I +   E + SF  R+Y   
Sbjct: 122 IGQEIAMVEDTPDDLIHDLFNRQLWGRHPLGNPVLGSARVIGALNSEHLRSFHRRHYIPQ 181

Query: 183 RMYVVCVGAVDHE-FCVSQVESY--FNVCSVAKIKESMKPAVYVGGE-YIQKRDLAEEHM 238
           R+ +   G ++HE FC    +S+   +     +     +P  +   E  +  R L + H+
Sbjct: 182 RILIAAAGQLEHEQFCQLWADSFGALSAPEGTRAGAGRQPPRFAEPERRVFDRGLEQLHL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG--V 296
           MLG  G A    D Y  ++L +ILG  MSSRLFQE+REKRGL Y++ ++    SD+G   
Sbjct: 242 MLGTYGPAENDPDRYAFHLLNTILGGNMSSRLFQEIREKRGLAYAVFSYLNCHSDSGNFG 301

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
           LY+          A   +  E+ +   E +   E+D+      A ++ ++E    R   +
Sbjct: 302 LYLG-VDPLAAEEAAGLAAREIRRLRREPVTAGELDEARDYARALIMLAEENMEARMSRL 360

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           ++  +  G  L   +I+  +  ++ +DI+ VA + F+       LGP
Sbjct: 361 ARNTLAFGRELPVTEILAKLDRVSVDDIMAVADQTFTRPLNGVALGP 407


>gi|114566443|ref|YP_753597.1| processing peptidase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114337378|gb|ABI68226.1| processing peptidase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 422

 Score =  209 bits (531), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 211/410 (51%), Gaps = 4/410 (0%)

Query: 14  VITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGG 73
           ++ E+  + SA + V I+ GSR+E++E  G +HF+EHMLFKGT  R+A++I E  E++GG
Sbjct: 14  IVEEIPYLKSAALGVYIKLGSRHEKEEIAGASHFIEHMLFKGTESRSARDIAESFEEIGG 73

Query: 74  DINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDD 133
            +NA+TS E T  +A  L E++  A+EII DML NS+F   D   E+ V++EEI + ED 
Sbjct: 74  QLNAFTSKEFTCVYARTLDENISSAMEIIFDMLFNSTFATRDFATEKEVIIEEINIYEDT 133

Query: 134 SWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVD 193
             D +   F+  +W+   +G PILG  +++S+F+ ++I  F  + Y    M +   G VD
Sbjct: 134 PDDLIHDLFARNLWQGHPMGSPILGTLDSVSAFSRDEIFDFYKKCYVPSNMVIAVAGNVD 193

Query: 194 HEFCVSQVESYFNVCSVAKIK-ESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDF 252
                 QVE       + ++     K + Y     + +++  +  + LG  G +Y  ++ 
Sbjct: 194 KNLIKEQVEKCLVRQPLTQVNWPEPKHSEYSSFVRLLEKETEQVQICLGVPGISYFDQNR 253

Query: 253 YLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALT 312
           Y+ N++ SILG GMSSRLFQ++RE+ GL YS+ +    +SD G       T    I    
Sbjct: 254 YVQNVMNSILGGGMSSRLFQKIREELGLAYSVYSSPSTYSDTGSYSFYIGTGPGKIATFF 313

Query: 313 SSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEK 371
            ++   ++  +   + +RE+ +    I + +    E    R   + K  +    ++  E 
Sbjct: 314 EALYHELEFFVSRGVSEREVSRTQQLIKSSMYLGLESVMNRMSRLGKSFLMYNRVIPVED 373

Query: 372 IIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSELIHALEG 420
           +I  I A+    I   +  I      +LA +GP  + +P   +  H   G
Sbjct: 374 VIKEILAVDAGKIQSFSSNILQKPAFSLAAIGPA-EVLPQVEKEFHKWWG 422


>gi|254994675|ref|ZP_05276865.1| mitochondrial processing protease [Anaplasma marginale str.
           Mississippi]
          Length = 368

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/373 (32%), Positives = 215/373 (57%), Gaps = 14/373 (3%)

Query: 51  MLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSS 110
           M FKGT  R+A +I    + +GG+ NAYT  EHT YH  V+K  V +ALE++ D++  S+
Sbjct: 1   MAFKGTDTRSALDIAMAFDCIGGNFNAYTDKEHTVYHVKVMKRDVHIALEVLEDIVLRSA 60

Query: 111 FNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEK 170
           F   +IERE+NVVL+EI  + D     +  ++ E+ +K QI G PILG  +++   +   
Sbjct: 61  FPEVEIEREKNVVLQEIYQTNDSPGSIIFDKYMEVAYKGQIFGAPILGSEQSVLGLSRAD 120

Query: 171 IISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK 230
           ++ ++S NY  + M +   G + HE  V   + +  +    +  + + P VY GG+YI+ 
Sbjct: 121 LVQYMSANYYGNNMTLSVAGDIAHEDVVRMSQGFAQIQD--RNPQPVAPPVYTGGQYIEA 178

Query: 231 RDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHEN 290
           RDL + ++++GF G +Y    +Y   +L  ILG  MSSRLFQE+REKRGL YSIS+ + +
Sbjct: 179 RDLDQVNIVIGFPGVSYLDERYYTMQVLDVILGSSMSSRLFQEIREKRGLVYSISSFNSS 238

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           +SD+G+  I +AT + N+  L  +I   ++ L E +++ E+ +  +K+ ++++ S+E + 
Sbjct: 239 YSDSGLFSIHAATDEGNLQELLKTIAAEMKKLPETVKEEELLRAKSKLESEVLMSRESTV 298

Query: 351 LRALEISKQVMFCGS----ILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGP- 403
            +    S+ + +C S     +  E++I  I A+   D++  A  +  +    T+A +G  
Sbjct: 299 GK----SEALGYCYSHYNKYITKEEMISKIRAVNLGDVINSADLLLQNRGKLTVAAIGKV 354

Query: 404 -PMDHVPTTSELI 415
            P+  + T S ++
Sbjct: 355 GPLPSLETISNML 367


>gi|42523059|ref|NP_968439.1| zinc proteinase [Bdellovibrio bacteriovorus HD100]
 gi|39575264|emb|CAE79432.1| probable zinc proteinase [Bdellovibrio bacteriovorus HD100]
          Length = 422

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/408 (27%), Positives = 218/408 (53%), Gaps = 4/408 (0%)

Query: 1   MNLRISKT--SSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           MN +  K+  S+GI V++E+ P   A  + + +  G+R+E  +  G++H LEH++FKGT 
Sbjct: 1   MNTKFKKSELSNGIRVVSELHPGSRAVSMGIWVLTGTRDETPDVAGISHLLEHLVFKGTK 60

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            R+A +I + +E +GG++NAYT+ E+T YHA VLK+H   AL+++ D++SN      + +
Sbjct: 61  TRSAYQIAKSLEALGGELNAYTTREYTCYHALVLKDHWEKALDVLADLVSNMKLTQKEFD 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
            E+ V+L+EI MSED   D +   F E V+    +GRPILG P +++     +++++  +
Sbjct: 121 LEKGVILQEIAMSEDSHEDMVYDVFYEQVYGAHPLGRPILGTPVSVARMKQTQVMNYYKK 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
            YT   + V   G +DH+  ++ ++        +++K + +   ++   ++ ++   + H
Sbjct: 181 TYTGKNIIVSASGCIDHDDLMAGIQKRLGAKKKSELKNTRRVPRWLNRRHVVEKQAEQVH 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           M+LG    ++Q +  +   +  ++LG GM+S+L+Q VREKRGL YSI +      D+G+L
Sbjct: 241 MLLGLPTASFQDKHRFEAVVTNTLLGGGMTSKLYQSVREKRGLVYSIHSSLNTNIDSGML 300

Query: 298 YIASATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I + T  +N   +   I  E  +     + + +++    ++   ++   +    R   +
Sbjct: 301 TIYAGTEAKNARKVGDLISKEFAKIRKAGVTKADVEMCKTQVIGSILLGSDDIENRMTSL 360

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
           +   M  G     E +ID I A+T + +    + +        +L  P
Sbjct: 361 AVNEMVFGRYRAVESVIDEIKAVTVDSVNEYIRNVLDLDKAAGVLLGP 408


>gi|210622621|ref|ZP_03293281.1| hypothetical protein CLOHIR_01229 [Clostridium hiranonis DSM 13275]
 gi|210154122|gb|EEA85128.1| hypothetical protein CLOHIR_01229 [Clostridium hiranonis DSM 13275]
          Length = 414

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 209/393 (53%), Gaps = 4/393 (1%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +  K  +G+T+I E +P   S  + +  RAG + E     G++HF+EHM+FKGT  RT+K
Sbjct: 3   KTKKLKNGLTIIAEEIPYFKSISMGIWFRAGIKTEENYIDGVSHFIEHMMFKGTKNRTSK 62

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++V EIE +GG INA+T  E T Y+  +L EH+ + ++I+ DM+ NS F+  DIERE++V
Sbjct: 63  QLVAEIENLGGVINAFTGRECTCYYVRLLDEHLNIGIDILSDMILNSKFDEKDIEREKSV 122

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + EE+ M ED   D       E V+ ++ IG+ ILG  E+I S   E I+ +  + Y  +
Sbjct: 123 ITEELKMYEDSPEDLTYDILLEKVYDNKGIGKNILGSKESIKSMNREAILDYFEKFYVPE 182

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G  D +  V  +E  F      K   +++  ++      + RD  + ++ + F
Sbjct: 183 NAVLSICGNFDFDETVKLIEDKFANWHGEKPNYNLQDEIFNPCVVKKDRDYEQTNLAICF 242

Query: 243 --NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
                   S D Y  +I+ ++LG   +SRLFQ +RE  GL YSI +  E + D G L I 
Sbjct: 243 ECENIGSSSNDVYTIDIINNVLGGSSTSRLFQRIREDEGLVYSIYSEQEFYRDKGELGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++ + EN+  +   I E + SL EN I + E+     ++  + +   E +  R   I K 
Sbjct: 303 ASMSTENLEDVYRLIKEEIVSLNENGITEEELKNSKEQLKGEFMLGMESTESRMSAIGKY 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           ++  G +   E +I+ +++IT EDI  V K + 
Sbjct: 363 MLITGKVETLEDVIEGLNSITMEDINRVIKDVL 395


>gi|150390427|ref|YP_001320476.1| peptidase M16 domain-containing protein [Alkaliphilus
           metalliredigens QYMF]
 gi|149950289|gb|ABR48817.1| peptidase M16 domain protein [Alkaliphilus metalliredigens QYMF]
          Length = 406

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 120/381 (31%), Positives = 208/381 (54%), Gaps = 3/381 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ ++TE +P + S  + + I+AGSRNE +  +G++HF+EHMLFKGT  R+AK+I EEI
Sbjct: 9   NGLRIVTEHIPHVKSISIGLWIKAGSRNEDESNNGVSHFIEHMLFKGTENRSAKDIAEEI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG INA+TS E T Y+A VL EH  L L+++ DM   S  +  +I++ER+V++EEI 
Sbjct: 69  DGIGGQINAFTSKECTCYYAKVLDEHYELVLDVLADMFFKSKLDSLEIDKERSVIIEEIS 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D      S+ ++    +G PILG  +T+ +   + +  ++   YT D   +  
Sbjct: 129 MYEDSPEDLAHDLLSQTIYSGNTLGLPILGTQKTLENIDKKSMKDYMENYYTPDNTVIAI 188

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMMLGFNGCAY 247
            G  + +  +  +E  F        +      + +  E   K+   E+ H+ LGF G + 
Sbjct: 189 AGNFEEKSLLQAIEKRFANWESQPHRSKQASEIKLNFEEKVKKKEIEQVHLCLGFQGTSL 248

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
            S++ Y   +  +ILG  MSSRLFQ +RE++GL YSI ++   ++D+G L I +    + 
Sbjct: 249 DSKNLYPLLVFNNILGGSMSSRLFQNIREEKGLAYSIYSYPSIYTDSGFLAIYAGMNPQQ 308

Query: 308 IMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
              ++  I + + +L E  + + E  K   ++    I   E +  R   + K  +  G I
Sbjct: 309 YSVVSELISQELSNLREKGLTETEFRKSKEQLKGNYILGLESTSGRMSSMGKSELLLGKI 368

Query: 367 LCSEKIIDTISAITCEDIVGV 387
              ++++D I+ I  ++++ V
Sbjct: 369 YSPKEVVDRINRIEIKNVLQV 389


>gi|284108782|ref|ZP_06386447.1| peptidase, M16 family protein [Candidatus Poribacteria sp. WGA-A3]
 gi|283829856|gb|EFC34147.1| peptidase, M16 family protein [Candidatus Poribacteria sp. WGA-A3]
          Length = 409

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 216/399 (54%), Gaps = 17/399 (4%)

Query: 17  EVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDI 75
           E MP + S  + V    G+R+E   + G+AHFLEHM+FKGT +R+A  I  EI+ +GG++
Sbjct: 2   ERMPSLKSVALSVWENVGTRDEGPRQKGLAHFLEHMMFKGTRRRSATRISHEIDSLGGEM 61

Query: 76  NAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSW 135
           NA+T+ E T+ +  VL + +   ++++ D+  +S F+  +IERE+ VVLEEI    DD  
Sbjct: 62  NAFTTHETTALYIKVLDQQIGQGIDLLADVFHHSRFDRKEIEREKQVVLEEIRTVRDDPE 121

Query: 136 DFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHE 195
           DF+    ++ V +   +GR ILG   T+       ++ ++ ++Y  ++  +   G  + +
Sbjct: 122 DFVQELHAKQVLRGHPLGRSILGDQATMKRIQRRDVLHYLEQHYRPEKTVIAVAGNFEGK 181

Query: 196 FCVSQVESYFN----VCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRD 251
              + V + F     V S     +  KP    GG  +  + L + H+ +GF G       
Sbjct: 182 KVEALVNAAFGKWHPVGSEGNGVQRQKPPHVRGGIMVHHKRLEQVHLCMGFKGLPVAHPA 241

Query: 252 FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI-ASATAKENIMA 310
            Y  + L ++LG GMSSRLFQE+REKRGL Y+I +   +FSD GVL I A++ AKE    
Sbjct: 242 RYAAHTLNALLGGGMSSRLFQEIREKRGLAYTIYSQLSSFSDGGVLTIYAASGAKE---- 297

Query: 311 LTSSIVEVVQSLLENIEQR-----EIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
              S+VEVV   ++ +++R     E+++   ++   L+   E +Y R  +++K  +  G 
Sbjct: 298 -APSVVEVVCREIKKLQKRGPLPQELERTKNQLKGTLMLGLEGTYGRMNKLAKDELVQGR 356

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
            +   +++  I  ++  D+  + +++ +    ++  LGP
Sbjct: 357 YVSLRELVSEIDRVSVRDVHEIGRELLNFGAMSVTALGP 395


>gi|325962823|ref|YP_004240729.1| Zn-dependent peptidase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468910|gb|ADX72595.1| putative Zn-dependent peptidase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 447

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/412 (30%), Positives = 215/412 (52%), Gaps = 11/412 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA +   +  GSR+E   +HG  HFLEH+LFKGT +RTA
Sbjct: 27  VRRSVLPGGVRVLTEAMPGQRSATIGFWVGVGSRDEAPGQHGSTHFLEHLLFKGTRRRTA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    ++VGG+ NA T+ E T Y A VL   +P+A+++I DM++ +  +P+++E+ER+
Sbjct: 87  LEIASAFDEVGGESNAATAKESTCYFARVLDTDLPMAIDVIADMITGAVLDPAEMEQERD 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M  DD  D     F   V     +GRPI G P+ I +   + +     R Y  
Sbjct: 147 VILEEIAMDSDDPTDVAHEHFVSAVLGSHPLGRPIGGTPDAIRAVARDSVWEHYQRYYRP 206

Query: 182 DRMYVVCVGAVDH----EFCVSQVESY---FNVCSVAKIKESMKPAVYVG--GEYIQKRD 232
           D + +   G ++H    +  V  +ES        +    + S + A+  G  G ++ KR 
Sbjct: 207 DELVITAAGGLEHDVVCDLVVEALESAGWSLEADAAPVDRRSTERALITGTAGLHVVKRA 266

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           + + ++++G           Y+ ++L ++LG GMSSRLFQE+REKRGL YS  +   +++
Sbjct: 267 VEQANIIMGCPTIVATDERRYVMSVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFASSYA 326

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +      +  +   +   +  L E+ I   E+ K   ++   ++ + E +  
Sbjct: 327 DAGYFGMYAGCTPSKVRQVLDLLAVELDKLAEHGISDDELRKAVGQLGGGIVLALEDTGS 386

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   + +  +  G     ++ +  I A+T E +  +A ++ ++  T+ ++GP
Sbjct: 387 RMSRLGRAELVSGEYQDIDETLRLIKAVTAEQVQELAAELAAAPRTVTVVGP 438


>gi|57233779|ref|YP_182137.1| M16 family peptidase [Dehalococcoides ethenogenes 195]
 gi|57224227|gb|AAW39284.1| peptidase, M16 family [Dehalococcoides ethenogenes 195]
          Length = 419

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 129/406 (31%), Positives = 206/406 (50%), Gaps = 9/406 (2%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S   SG+ VI+  MP   S  + V I  GSR E   E G +HF+EHM+F+G+ K    +
Sbjct: 4   LSVLPSGLRVISHHMPASRSVTICVYIGVGSRYETDCEAGASHFIEHMVFRGSKKYPDSQ 63

Query: 64  IVEE-IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++   IE VGG +NA T  E T Y+A V  +   LAL+++ DML    FNP D+E+ER V
Sbjct: 64  LISSAIEGVGGILNAATDRESTLYYAKVGSDKFALALDVLSDMLVTPLFNPEDLEKERKV 123

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + EEI MS D+    +     E++W D  +GR I G  ++++    +K++ F+ R+YT  
Sbjct: 124 IYEEISMSLDNPSHRVGLLLDEILWPDHPLGRDIAGSRQSVAGLDSQKLLDFMHRHYTPA 183

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ----KRDLAEEHM 238
            + V   G + H+  VS +   F   +  +  ++ +P  Y  G   Q    KRD  + ++
Sbjct: 184 NIVVAVAGDIKHKNAVSAISQAFGGLAGQQKVQTFEP--YHSGNPCQVGVDKRDAEQINL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ML   G        Y  +IL +ILGDGMSSRLF  VR+  GL YS+ +  E   D G   
Sbjct: 242 MLAMPGMNRLDERRYAFSILNTILGDGMSSRLFARVRDNLGLAYSVQSGLEYLHDTGAFS 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +A    N+ A   +++  +++    I   E+ K       ++  + E S   A  I  
Sbjct: 302 VFAAVDPANLTACIKAVLSELETAKTTITAEELTKAKEMSKGRIQLAMEDSRYMAKWIGS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
           Q + C  +   E +I  I  ++ + ++ +A + F      LA++GP
Sbjct: 362 QELLCQRVNTHEDVIRLIDGVSLKGVMQLAGEYFQKPQMRLALVGP 407


>gi|300088489|ref|YP_003759011.1| peptidase M16 domain-containing protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299528222|gb|ADJ26690.1| peptidase M16 domain protein [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 421

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 216/428 (50%), Gaps = 21/428 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK-RTA 61
           R +   +G+ ++T+ MP   S+ + V +   SR E     G++HF+EHMLF+GT K RTA
Sbjct: 3   RKTTLPNGLRILTQEMPHTLSSSICVFVGTSSRYEPDNLGGVSHFIEHMLFRGTEKHRTA 62

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E IE VGG +N  T  E T Y A V   H    L+ + DM+ +S F+P D+ERER 
Sbjct: 63  HDISEAIEGVGGIMNGGTDKESTVYWAKVASSHFMPTLDTLADMMLHSRFDPEDLERERQ 122

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M+ED     +      ++W +  +GR I G   TI       I++F+S +Y  
Sbjct: 123 VIIEEIHMTEDQPDQKVCQLIDSILWPNHPLGRDIAGTESTIRDMGRADILNFMSGHYRP 182

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGG--------EYIQKRDL 233
           D   V   G + HE  +  V   F         ES +P+    G          I+ RD+
Sbjct: 183 DNTVVSIAGGLTHEQMIKAVIDEFGEW------ESREPSCVFTGFTPNGGRRMIIEHRDI 236

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + +  L     +      Y  ++L  ILG+GMSSRLF E+R+K GL Y+I ++ +   D
Sbjct: 237 EQAYFQLAMPAMSTVDPRRYTQSLLNVILGEGMSSRLFTEIRDKLGLAYAIQSYADFLQD 296

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
            G L +A++   +N+    ++++  ++ L   I + E++K       ++    E S   A
Sbjct: 297 TGALTVAASVDTDNLEQAVAAVINELEKLKTTITRHELNKARELSKGRMALRLEDSRHVA 356

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTS 412
             +  Q +  G IL  E++I  +  IT +DI  +A++I  +    LA++GP  D  P   
Sbjct: 357 TWLGGQEILAGEILTPEEVITRLDKITLKDITDLAEEIIQADKFHLAVVGPVADETP--- 413

Query: 413 ELIHALEG 420
            L H L+G
Sbjct: 414 -LRHLLDG 420


>gi|308272444|emb|CBX29048.1| hypothetical protein N47_J00290 [uncultured Desulfobacterium sp.]
          Length = 441

 Score =  206 bits (523), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 135/414 (32%), Positives = 225/414 (54%), Gaps = 15/414 (3%)

Query: 12  ITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEK 70
           I +IT+ MP   S  + + ++AG+R+E QEE+G++HF+EHMLFKGT+KR+A +I +E + 
Sbjct: 34  IGIITKNMPHACSVSMGIWVKAGTRDESQEENGISHFVEHMLFKGTSKRSAFQIAKEFDA 93

Query: 71  VGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMS 130
           +GG+ NA+TS+E T YH  V+  HV  A +++ D+  NS F+  +IE+ER V+++EIGM 
Sbjct: 94  MGGNSNAFTSMETTCYHTKVITSHVKTATDLLFDIFLNSLFDTKEIEKERPVIIQEIGMV 153

Query: 131 EDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVG 190
           ED   D++     +  +K+  +G  +LG    +++F PEK+  F    Y   R+ +   G
Sbjct: 154 EDSPEDYIHLLSGQCFFKNNPLGFSVLGTRSNVTNFKPEKVKEFFELLYQPSRIVISVAG 213

Query: 191 AVDHEFCVSQV----ESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
            ++H   +  V    ESY N        E + P V  GG  I ++DL + H+   F G  
Sbjct: 214 NIEHNNILDLVGPIIESYKNNTFSP---ERITPDVQ-GGVNIFEKDLEQVHICALFKGLP 269

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
                 Y  +++ +ILG  MSSRLFQE+REKRGL YS+ +   ++SD G+    +A   E
Sbjct: 270 ISDERRYAFSLINTILGGNMSSRLFQEIREKRGLAYSVYSFISSYSDTGMFGAFAAVDPE 329

Query: 307 NIM-ALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
           N   A    I E+ + +   I+ +E+          L+ + E +  +    ++  +    
Sbjct: 330 NAFDAADLIIKEIKKIIKHAIDDQELKDAVEYTKGCLLLASESTDNQMFRQAQNEINFKR 389

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +   +I   I ++T +++  +A  +F S   +L +LGP    VP  S+ +  L
Sbjct: 390 HIPLHEITGKIESVTKDEVYDLACLLFGSGNLSLTVLGP----VPDKSKFMDVL 439


>gi|241762474|ref|ZP_04760551.1| processing peptidase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241372976|gb|EER62643.1| processing peptidase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 384

 Score =  206 bits (523), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 111/373 (29%), Positives = 201/373 (53%), Gaps = 1/373 (0%)

Query: 33  GSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLK 92
           G+R+E     G+AH +EHM+FKG   R A+ I E  E  GG +NA+T+ +HT + A +L 
Sbjct: 10  GARSEPDRYSGLAHMVEHMVFKGAAGRNARMIAEAAENCGGQLNAWTARDHTVFQARMLS 69

Query: 93  EHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQII 152
           E+  L LE++ D++ + + +  ++ERE+ VVL E+G S D   D +      + +KDQ +
Sbjct: 70  EYWDLGLELVADLVRSPTLDGEELEREKGVVLSELGESYDTPDDIIHDYLQSVAFKDQAL 129

Query: 153 GRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK 212
           GRP+LG   +I +     +  +V + Y  +   +   G +D +  +   ES F+     +
Sbjct: 130 GRPVLGNETSIKAIDRPALSQWVKQYYQPEGFVLAAAGKIDEDAFLKMAESRFSDWDKGQ 189

Query: 213 IKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQ 272
              +++ A +  G Y   RD  + H+ LG+ G +YQ    + + +LASILG GMSSRLFQ
Sbjct: 190 -PLAVEKAKFTTGRYDDHRDSDQTHIALGYRGFSYQDIRSHASALLASILGGGMSSRLFQ 248

Query: 273 EVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREID 332
            +RE+ GL YS+ +  +++ + G+  I  A  K++     + I +++   +E++ + E+ 
Sbjct: 249 ILREEEGLVYSVYSWSQSWIETGIFGIYCAADKKDASKALTLIRQIMADTVESVSEEELQ 308

Query: 333 KECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           +  A+  A L+ + E    R   + +Q+     I+   ++++ I  ++ +DI  V +   
Sbjct: 309 RAKAQARAGLLMNLEGVAARCDHLGRQIQIHNRIVNPSEVVEWIDTVSLDDIRSVGQYSL 368

Query: 393 SSTPTLAILGPPM 405
           S    LA +G  +
Sbjct: 369 SQGEALASVGDGL 381


>gi|253568940|ref|ZP_04846350.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251840959|gb|EES69040.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 406

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/392 (31%), Positives = 216/392 (55%), Gaps = 13/392 (3%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E      A+    I AG+R+E ++E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 10  NGLRIIHEPTLSKVAYCGFAIDAGTRDEAEDEQGMAHFVEHLIFKGTEKRKAWHILNRME 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  +A  L  H+  ALE++GD++ +S+F   +IE+E  V+++EI  
Sbjct: 70  NVGGDLNAYTNKEETVVYAAFLTGHLERALELLGDIVFHSTFPQHEIEKETEVIIDEIQS 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED+  + +   F +M++++  +GR ILGKPE + SF  E ++SF SR Y    M     
Sbjct: 130 YEDNPSELIFDDFEDMIFRNHPLGRNILGKPELLRSFRTEDVLSFTSRFYQPGNMVFFVQ 189

Query: 190 GAVDHEFCVSQVESY-FNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  D +  +   E Y F++ +V    + M P +YV    +  +D  + H+M+G  G  AY
Sbjct: 190 GQYDFKKIIRLAEKYLFDIPAVTVDNQRMPPPLYVPERLVVPKDTHQAHVMIGSRGYNAY 249

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L N+L    G GM+S+L   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 250 DDKRTALYLLNNVLG---GPGMNSKLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGTD 306

Query: 305 KENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            E++   + LT   ++ ++ +     Q    K+  ++  ++  + +     AL ++K  +
Sbjct: 307 IEDMDTCLKLTYKELKRMRDVKMTSSQLAAAKK--QLIGQIGVASDNFENNALGMAKTYL 364

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
                  SE +   I A+T E ++ VA ++F+
Sbjct: 365 HYHKYESSESVFHRIEALTAEQLLEVANEMFA 396


>gi|227497566|ref|ZP_03927792.1| possible peptidase [Actinomyces urogenitalis DSM 15434]
 gi|226832966|gb|EEH65349.1| possible peptidase [Actinomyces urogenitalis DSM 15434]
          Length = 454

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/413 (30%), Positives = 213/413 (51%), Gaps = 12/413 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ VITE +P + SA + +    GSR+E   + G  HFLEH+LFKGT  R A
Sbjct: 40  LRRSILPGGVRVITEAVPGLRSASIGMWFGVGSRDEASGQEGATHFLEHLLFKGTASRDA 99

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           + I E  + +GG+ NA TS EHTSY+A V  +    AL+++ DM+++S  +P+++E ER 
Sbjct: 100 RAIAESFDMIGGESNAATSKEHTSYYARVQGKDAGQALDVLTDMVTSSLLDPAEVETERG 159

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQI-IGRPILGKPETISSFTPEKIISFVSRNYT 180
           V++ E+  + DD  D     F+   + +   +GRPI G  ET+++   + +     R Y 
Sbjct: 160 VIVSELADAADDPQDVAQEAFARAAFGEGTPLGRPIGGTYETVTAVPRDAVWEHYQRTYG 219

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNV----CSVAKIKESMK----PAVYVGGEYIQKRD 232
           +D + V   GAV HE    +V +        CS A      +    P   +    +  R 
Sbjct: 220 SDTLVVAAAGAVSHEEVCERVAADLAAAGWDCSAASQPRPRRFETEPWTALDVHDVTVRR 279

Query: 233 LAEE-HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
            +E+ H+ L   G A +    +  ++L +ILG GMSSRLFQEVREKRGL Y+  A   ++
Sbjct: 280 QSEQSHVYLTCQGIATRDERRWPMSVLTTILGGGMSSRLFQEVREKRGLAYTTYAFDTSY 339

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSY 350
           +  G   + +  A +++  + + +V   + L  + + +RE+++   +I   ++   E S 
Sbjct: 340 AGAGAFGLYAGCAPQDVDEVCTVMVGEFEKLAADGVTERELERARGQIRGSMVLGGEDSL 399

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   + +  +  G +   E+ +  +  +T +D+  +A  + +      ++GP
Sbjct: 400 ARMGRLGRGEVVTGRLRSMEENLRRLERVTGQDVQDLAAWLLAQRRARVLVGP 452


>gi|226227169|ref|YP_002761275.1| putative S16B family peptidase [Gemmatimonas aurantiaca T-27]
 gi|226090360|dbj|BAH38805.1| putative S16B family peptidase [Gemmatimonas aurantiaca T-27]
          Length = 429

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/412 (31%), Positives = 210/412 (50%), Gaps = 13/412 (3%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            L  +   +G+TV++E +P   S      +RA + +ER EE G++H LEHM+FKGT  R+
Sbjct: 17  QLHRTDLPNGLTVLSEAVPGARSVAFGAWVRAATLHERPEEMGVSHLLEHMVFKGTRTRS 76

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+EI   +E +GG ++AYT  EHTSY A VL EH+  A  +IG+++      P D+  ER
Sbjct: 77  AQEIALSLETLGGSLDAYTEREHTSYQARVLDEHLGEAASVIGELIFEPLLKPEDLALER 136

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M ED   D +    +  VW D   G  ILG  +T+ S     I +   R Y 
Sbjct: 137 KVILEEISMVEDTPDDIIFDVHNRAVWGDHPHGYAILGTRDTVKSLDIPHIRALQERAYH 196

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP-------AVYVGGEYIQKRDL 233
             R+ V   G V+H+  +  ++       + + +  M P       A     E+++++D+
Sbjct: 197 PGRLVVAASGRVEHDQLLEVLD---RAGWLTRARGDMTPFALDPVEAAGPHAEHVKRKDI 253

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
           A+ H++LG  G A+     Y   ++  +LG GMSSRLFQ VRE+ GL YS+      F+D
Sbjct: 254 AQTHIVLGGQGIAHGDSRRYAFALIDMLLGGGMSSRLFQRVREELGLAYSVHTFSSAFAD 313

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLR 352
            GV  +  ATA E+      ++ EV++ +  E + + ++     ++  +L+ S E    R
Sbjct: 314 TGVHGVYLATAPESAQEALDAVREVLREVASEGLPEADMLAGKRQLRGQLVLSMEGVSSR 373

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAI-LGP 403
               +   ++       ++ +  + AI  + +  VA+  F     + + LGP
Sbjct: 374 MYRAATTALYGEPFRSVDEQMALVDAIDEDTVRDVARDFFDPDRHILVSLGP 425


>gi|308176849|ref|YP_003916255.1| M16 family peptidase [Arthrobacter arilaitensis Re117]
 gi|307744312|emb|CBT75284.1| putative M16 family peptidase [Arthrobacter arilaitensis Re117]
          Length = 456

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 123/414 (29%), Positives = 217/414 (52%), Gaps = 15/414 (3%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   S  V   +  GSR+E    +G  HFLEH+LFKGT KRTA
Sbjct: 36  VRRSILPGGVRVLTEAMPGQRSTTVGFWVPVGSRDEEAGHYGSTHFLEHLLFKGTAKRTA 95

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI +  + VGG+ NA T+ E T Y+A VL   +P+AL++I DM++++  +P ++E+ER 
Sbjct: 96  LEIAQSFDAVGGESNAATAKESTCYYARVLDTDLPMALDVIADMVTSAVIDPQELEQERG 155

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EE+ M  DD+ D    RF   V  D  +GRPI G PE I   + E ++     +Y  
Sbjct: 156 VIIEELAMDADDAMDVAHERFVANVLGDHPLGRPIGGTPEEIMEISREAVMEHYRAHYRP 215

Query: 182 DRMYVVCVGAVDHE-FC------VSQVESYFNVCSVAKIKESMKPAVY--VGGEYIQKRD 232
             + +   G+++H+  C      +++     +  +V + +   +PA      G  +  R 
Sbjct: 216 GELIITAAGSLEHDKLCELVLKALTEAGWELDPMAVPEPRRMGEPAKINSKAGLEVINRP 275

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + ++++G  G         +  +L ++LG GMSSRLFQE+REKRGL YS  +    ++
Sbjct: 276 GEQANIIIGCAGITGHDDRRQVLAVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFSAAYT 335

Query: 293 DNGV--LYIASATAK-ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           D G   +Y   A AK   ++ L  +  E+ +   + I + E+ +   ++    + + E  
Sbjct: 336 DAGYFGMYAGCAPAKAAQVIGLLGA--ELDRLAKDGITESELAQAKGQLSGGTVLALEDP 393

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             R   + +  M  G     ++ +  ++A++ +D+  +A+++ +    + ++GP
Sbjct: 394 GSRMSRLGRAEMITGEFQDIDEALARVNAVSAQDVQDLARELAAKDRVITVVGP 447


>gi|45658535|ref|YP_002621.1| metalloprotease [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45601778|gb|AAS71258.1| metalloprotease [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 428

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 208/385 (54%), Gaps = 3/385 (0%)

Query: 11  GITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           GITV+ +  P   SA   V +R GSR+E  +  G  HFLEHMLFK T KR+AK+  E+IE
Sbjct: 17  GITVLFQKAPHTVSASAGVFVRVGSRHESSKNAGYCHFLEHMLFKDTAKRSAKQQAEDIE 76

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
           +VGG  NA TS E+T +H  V  +H+ + LE++ +M+       SDI+ E  V+LEE+  
Sbjct: 77  RVGGFTNAATSREYTYFHVTVAGKHIGIGLELLAEMIYEPLLKQSDIDNEAGVILEELQG 136

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   D++   + +  +    +GR I+G  E++S  T + I+ F    Y  + M++   
Sbjct: 137 YEDSPEDYIHDFYYQNFFPKNSLGRDIIGTRESVSGVTHKSILDFYDTYYHTENMFLSIS 196

Query: 190 GAVDHEFCVSQVESYFNVCSVAKIK-ESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
           G  + +   +    YFN   V K +  S+       G + +K+ L + + +LG  G A +
Sbjct: 197 GNFEPDEIFTIAAKYFNRTRVKKREGNSLSLPKKKWGYFPKKKKLEQVYFILGGEGFARE 256

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             +    ++   ILG G SSRLFQ+VRE++GLCY I+A+  +++D G+  I  +T+KE  
Sbjct: 257 FHNASSASLFTHILGGGTSSRLFQKVREEKGLCYHITAYPSSYADVGINSIVCSTSKEKF 316

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
           +     I + ++S+L++ I ++E+          L  S E++  R   I+   ++ G   
Sbjct: 317 ITCLEIISDEIKSVLDHGISEKELLDAQTNHEGTLSISYEQTESRMNTIALMELYYGRNF 376

Query: 368 CSEKIIDTISAITCEDIVGVAKKIF 392
             E+ +  I +IT ED+   AK +F
Sbjct: 377 SYEERVKEIYSITLEDLNMFAKSVF 401


>gi|294827766|ref|NP_711129.2| Zn-dependent peptidase [Leptospira interrogans serovar Lai str.
           56601]
 gi|293385611|gb|AAN48147.2| Zn-dependent peptidase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 427

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 208/385 (54%), Gaps = 3/385 (0%)

Query: 11  GITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           GITV+ +  P   SA   V +R GSR+E  +  G  HFLEHMLFK T KR+AK+  E+IE
Sbjct: 16  GITVLFQKAPHTVSASAGVFVRVGSRHESSKNAGYCHFLEHMLFKDTAKRSAKQQAEDIE 75

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
           +VGG  NA TS E+T +H  V  +H+ + LE++ +M+       SDI+ E  V+LEE+  
Sbjct: 76  RVGGFTNAATSREYTYFHVTVAGKHIGIGLELLAEMIYEPLLKQSDIDNEAGVILEELQG 135

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   D++   + +  +    +GR I+G  E++S  T + I+ F    Y  + M++   
Sbjct: 136 YEDSPEDYIHDFYYQNFFPKNSLGRDIIGTRESVSGVTHKSILDFYDTYYHTENMFLSIS 195

Query: 190 GAVDHEFCVSQVESYFNVCSVAKIK-ESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
           G  + +   +    YFN   V K +  S+       G + +K+ L + + +LG  G A +
Sbjct: 196 GNFEPDEIFTIAAKYFNRTRVKKREGNSLSLPKKKWGYFPKKKKLEQVYFILGGEGFARE 255

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
             +    ++   ILG G SSRLFQ+VRE++GLCY I+A+  +++D G+  I  +T+KE  
Sbjct: 256 FHNASSASLFTHILGGGTSSRLFQKVREEKGLCYHITAYPSSYADVGINSIVCSTSKEKF 315

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
           +     I + ++S+L++ I ++E+          L  S E++  R   I+   ++ G   
Sbjct: 316 ITCLEIISDEIKSVLDHGISEKELLDAQTNHEGTLSISYEQTESRMNTIALMELYYGRNF 375

Query: 368 CSEKIIDTISAITCEDIVGVAKKIF 392
             E+ +  I +IT ED+   AK +F
Sbjct: 376 SYEERVKEIYSITLEDLNMFAKSVF 400


>gi|257466754|ref|ZP_05631065.1| Zinc protease [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917903|ref|ZP_07914143.1| zinc protease [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691778|gb|EFS28613.1| zinc protease [Fusobacterium gonidiaformans ATCC 25563]
          Length = 416

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/394 (31%), Positives = 213/394 (54%), Gaps = 6/394 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GITV+ E +P + S  +   +R G+RNER+EE G++HF+EHM+FKGT  RTA
Sbjct: 5   VQVKTLSNGITVLIEKVPELQSFSLGFFVRTGARNEREEESGISHFIEHMMFKGTETRTA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K++ E I+  GG INAYTS E T Y+  +L   + +A++++ DM+ +S+F   +IE+ERN
Sbjct: 65  KDLSEVIDNEGGIINAYTSRETTVYYVQLLSNKLEIAIDVLSDMMLHSTFTEENIEKERN 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M ED   D +         +  I    I G PE +   T E  ++++   Y A
Sbjct: 125 VIIEEIKMYEDSPEDTVHDENISFALRG-IQSNSISGTPEGLKKITREHFMNYLKDQYVA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC--SVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             + +   G  D    ++Q+E   +    S  K +   +  +Y G + I  RD  + H+ 
Sbjct: 184 SNLLIAISGNFDETVLMTQLEEKMSAFPQSDKKREYDNRYEIYAGTQVI-TRDTQQVHIC 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G        Y  +ILA+ LG GMS+RLFQ +RE++GL YS+ ++   + D G+   
Sbjct: 243 FNTRGIDVHHPKKYAASILANALGGGMSARLFQRIREEKGLAYSVYSYQSVYEDCGIFTT 302

Query: 300 ASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T KE    + + I E  + +  E I ++E+ +   +  + L+   E S  R   ++ 
Sbjct: 303 YAGTTKEAYQEVVNMIQEEYKKVREEGITEQELQRCKNQFTSALMFHLESSKGRMSSMAS 362

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G +   E+I+  I+ ++ EDI  +A+ +F
Sbjct: 363 SYINNGKVEAREEIMKRINEVSLEDIKEMAQYLF 396


>gi|184201240|ref|YP_001855447.1| M16B family peptidase [Kocuria rhizophila DC2201]
 gi|183581470|dbj|BAG29941.1| putative M16B family peptidase [Kocuria rhizophila DC2201]
          Length = 477

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 129/411 (31%), Positives = 209/411 (50%), Gaps = 25/411 (6%)

Query: 11  GITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           G  V+TE MP   S  V   +  GSR+E     G  HFLEH+LFKGT +R++ EI E  +
Sbjct: 57  GTRVLTEKMPGQRSVSVGFWVSLGSRDEAPGMLGSTHFLEHLLFKGTARRSSLEIAEAFD 116

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
           +VGG+ NA+TS EHT YHA VL E +P+A++++ DM + +  +P + +RER V+LEEI M
Sbjct: 117 RVGGESNAFTSHEHTCYHARVLSEALPMAVDVLADMFTGAVLDPEEFDRERGVILEEIAM 176

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
             DD  DF   +F+E V+    + RPI G PE I S   + +       Y  + + V   
Sbjct: 177 DRDDPTDFAFEQFTEQVFHGSPLARPIAGTPEEIRSVARDAVWQHYRAAYRPENLVVTVA 236

Query: 190 GAVDHEFCVSQVESYF-------NVCSVAKIKESMKPAVY--VGGEYIQKRDLAEEHMML 240
           G ++HE  V  V                A  +    PA+   + G     R + + +++L
Sbjct: 237 GGLEHENVVQLVRESLARAGWDPGTSGGAGARRPTTPALLTPLTGTRALDRSVEQANVVL 296

Query: 241 GFNGCAYQSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           G  G   QS D   F +T +L + LG GMSSRLF  +RE++GL YS  +   ++SD G  
Sbjct: 297 G--GAGLQSGDERRFAMT-VLNAALGGGMSSRLFHTIREQKGLAYSTFSFSGSYSDAGFF 353

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREID-KECAKIHAKL----IKSQERSYLR 352
            + +    E +  +T     +++  L+ + Q  +D  E AK+  +L    + + E +  R
Sbjct: 354 GMYAGCTAERVDRVTG----LMRDELDRLAQDGMDAAELAKVEGQLSGATVLALEDTGSR 409

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              +    +  G  +  ++ +  I A++ +D+  +A ++        ++GP
Sbjct: 410 MSRLGSAELKTGVFMDVDESLRRIRAVSSQDVQELAARLSEDATVRTVVGP 460


>gi|303248939|ref|ZP_07335186.1| peptidase M16 domain protein [Desulfovibrio fructosovorans JJ]
 gi|302489662|gb|EFL49598.1| peptidase M16 domain protein [Desulfovibrio fructosovorans JJ]
          Length = 419

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 124/407 (30%), Positives = 208/407 (51%), Gaps = 11/407 (2%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R  +  +G+ V TE+MP + +A + + I AGSR+E   + GMAH  EHM FKGT  R A 
Sbjct: 12  RAVRLPNGVRVATEIMPQVKTASLGIWIEAGSRHEAPGQEGMAHLWEHMAFKGTASRDAL 71

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I +E++ +GG  NA+TS E T +H  V+  H+  A  ++ D++ N + +P ++ RE+ V
Sbjct: 72  AIAKELDILGGLANAFTSREATCFHIRVMDAHMERAFAVLSDIVLNPALDPEELAREKGV 131

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +++EI M E+   D +   F    W +  I  PI G P ++ + TP+ + ++    Y  D
Sbjct: 132 IVQEISMVEETPEDKVHEDFWAAAWANPAIAHPITGTPASVMAATPKALNAWRKTRYRPD 191

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            + +V  G+VDH+  V+ VE  F                Y       +R+  + H++L +
Sbjct: 192 AIAIVAAGSVDHDAQVAMVEKTFGRLPAVSAPTPSGVGTYTPPRLAVRRESEQNHVILSY 251

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
                +S + +   ILA++LG  MSSRLFQEVRE+RGL YSI A     ++ G+  I +A
Sbjct: 252 PSVGNKSPERFGHTILATLLGGNMSSRLFQEVRERRGLAYSIYAGVNALAETGIFEIQAA 311

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDK---ECAKIHAK--LIKSQERSYLRALEIS 357
              E     T  +++VV++ L  +    + K   E  + H K  L    E +  R + ++
Sbjct: 312 VEPER----TRELIDVVRAELAAVADGAVTKEELEHTREHLKGLLYLGAESTENRMMRLA 367

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
           +  +     +   +    +  +T  D+ G+A+  F+     + ILGP
Sbjct: 368 RNTLLFDRHIPLTETAAALDTVTPADLAGIARAAFTEENAGICILGP 414


>gi|28210967|ref|NP_781911.1| zinc protease [Clostridium tetani E88]
 gi|28203406|gb|AAO35848.1| zinc protease [Clostridium tetani E88]
          Length = 436

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 132/396 (33%), Positives = 208/396 (52%), Gaps = 12/396 (3%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           ++   ++G+ V  E +  + S  + + ++ GSRNE +  +G++HF+EHM+FKGT  R AK
Sbjct: 7   KLYSLNNGLRVALEKIDYVQSVSIGLWVKNGSRNENEHNNGISHFIEHMMFKGTNNRNAK 66

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EIV+ IE +GG INA+T  E T Y+  +L  H+ +AL+I+ DM+ NS FN  DIE E+ V
Sbjct: 67  EIVKTIEDLGGHINAFTGKEATCYYIKLLYTHLDVALDILSDMIFNSKFNEEDIELEKGV 126

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M+ED   D L    S+  W D  I  PILG  + + SFT   II ++  +YT +
Sbjct: 127 ILEEISMNEDSPEDVLVELHSKAAWGDDPISLPILGSAKGVRSFTRNHIIEYLKSHYTPE 186

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY-----VGGEYIQKRDLAEEH 237
              +   G  D E     +E YF     +    + KP +Y     +     +K+++ + H
Sbjct: 187 NCVISIAGNFD-ENIYKLIEDYFGHWKAS----NEKPLLYSTPDVLNNHLFRKKEIEQLH 241

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           M LG  G    + D Y   +L +I G   SS LFQ++RE++G CYSI ++  ++++ G++
Sbjct: 242 MNLGMQGVEIGNEDMYTILLLNNIFGGSTSSILFQKIREEKGRCYSIYSYVNSYNNTGIV 301

Query: 298 YIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I +    +  + +   IVE V    +  I Q +I +    +    I   E +  R    
Sbjct: 302 NIYTGLNSKYSIEVLKLIVEEVHKFSKYCICQEQIIQGKEGLKGSYILGLESTSSRMFSN 361

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           ++ V+F   I   E II  I  I  E I  V +  F
Sbjct: 362 ARSVLFLNRINKPEDIIKKIDKIDMESIHRVKENTF 397


>gi|295395381|ref|ZP_06805580.1| M16 family peptidase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971703|gb|EFG47579.1| M16 family peptidase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 426

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 199/401 (49%), Gaps = 8/401 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +GI VI+E +P I S  V V + +GSR+E  +  G  HFLEHMLFKGT  R+AK+I    
Sbjct: 20  NGIRVISETIPGIQSETVGVWVGSGSRDETDDNAGSTHFLEHMLFKGTATRSAKDIARTF 79

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           ++ GG+ NA T+ E T+Y++  L   +P     + DM+  S+   ++ ERER V+L+E+ 
Sbjct: 80  DRTGGEANAMTAKECTAYYSRCLVADLPDVCATLWDMVLASTLAVAEFERERTVILDELA 139

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M  DD  D L   + E+++ D  +GRP+    E I +   +++       Y   R+    
Sbjct: 140 MGADDPEDVLFEAYDELIYADSPLGRPVGATKERIQALAYDELQHHYKEAYVGPRLIFSA 199

Query: 189 VGAVDHEFCVSQVESYFN-----VCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
            G  DHE  V  V             V      + P V+  GE    R   ++ +++G  
Sbjct: 200 AGGADHEDLVDLVWRATQHLPEATAPVGTTSGRVTP-VFSPGERHIARPTEQQSLIMGVA 258

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G      D +   +LAS+LG GMSSRLFQ VRE+RGL Y++      +SD G   I +  
Sbjct: 259 GLHDGHDDRFTLTVLASLLGGGMSSRLFQTVREERGLAYAVHTTGSQYSDVGDFGIYAGC 318

Query: 304 AKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           A      +    VE  Q L  E     E+    A++ A  +   E + +R   ++K  + 
Sbjct: 319 APAVAQQVVDLCVEQCQRLASEGPMAAEVADTAAQVSAATVLGMESTAIRMNRLAKSELS 378

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              ++ + ++++ +  +T ED+  +A+++F     L  LGP
Sbjct: 379 NRPLVDAAELVERVRGVTAEDVQALAQRLFGGPWALCSLGP 419


>gi|172057840|ref|YP_001814300.1| peptidase M16 domain-containing protein [Exiguobacterium sibiricum
           255-15]
 gi|171990361|gb|ACB61283.1| peptidase M16 domain protein [Exiguobacterium sibiricum 255-15]
          Length = 413

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 118/407 (28%), Positives = 215/407 (52%), Gaps = 5/407 (1%)

Query: 10  SGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ +++E +    S    + I+AGSR E +EEHG++H +EHM+FKGT K++AKEI    
Sbjct: 9   NGVRIVSERIENARSVATGIFIKAGSRTETKEEHGISHLIEHMMFKGTKKQSAKEIAVYF 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG+INA+TS + T Y+   L EH   A +++ DM   S+F+  ++E+E+ VV+EEI 
Sbjct: 69  DRLGGNINAFTSKDQTCYYVKTLDEHAITAFDVLADMFLESTFDEEELEKEKRVVIEEIK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    +   + + ++ RPILG  E++   + + I+ ++   Y  +++ +  
Sbjct: 129 MYEDTPDDLVHELLAVAAYGEDVMARPILGTEESVKQLSRQMIVEYLQEAYAPEQIVISV 188

Query: 189 VGAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G V  E  ++Q+++ F ++ S  KI++  +P V       +++D  + H+   F     
Sbjct: 189 AGHVTDEL-ITQIKNRFGSLQSSGKIRQITEP-VLKSDALRKEKDTEQVHVCYNFRAIPS 246

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
                    +L +  G  MSSRLFQ +RE RGL YS+ +++  F D+G   I   T+KE 
Sbjct: 247 ADDRLPTLALLNNAFGATMSSRLFQSIREDRGLAYSVFSYYTTFDDHGTFTIYVGTSKET 306

Query: 308 IMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
           +  + + +   ++ LLE+ +  +E++    ++   LI   E         ++  +  G  
Sbjct: 307 LEEVETVLSAEIKQLLEHGLTTKELEDGIEQLKGSLILGNESISSHMNRNARNELHLGMH 366

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSE 413
              E ++  +  IT  D+  +   IFS  P  A + P +D     +E
Sbjct: 367 PTLEDVLTEVEQITPADVQEMIAYIFSEPPAKAYILPEIDEADLETE 413


>gi|257452881|ref|ZP_05618180.1| Zinc protease [Fusobacterium sp. 3_1_5R]
 gi|317059423|ref|ZP_07923908.1| zinc protease [Fusobacterium sp. 3_1_5R]
 gi|313685099|gb|EFS21934.1| zinc protease [Fusobacterium sp. 3_1_5R]
          Length = 416

 Score =  202 bits (515), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 125/394 (31%), Positives = 213/394 (54%), Gaps = 6/394 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++   S+GITV+ E +P + S  +   +R G+RNER+EE G++HF+EHM+FKGT  RTA
Sbjct: 5   VQVKTLSNGITVLIEKVPELQSFSLGFFVRTGARNEREEESGISHFIEHMMFKGTETRTA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K++ E I+  GG INAYTS E T Y+  +L   + +A++++ DM+ +S+F   +IE+ERN
Sbjct: 65  KDLSEVIDNEGGIINAYTSRETTVYYVQLLSNKLEIAIDVLSDMMLHSTFTEENIEKERN 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M ED   D +         +  I    I G PE +   T +  ++++   Y A
Sbjct: 125 VIIEEIKMYEDSPEDTVHDENISFALRG-IQSNSISGTPEGLKKITRDHFMNYLKDQYVA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC--SVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             + +   G  D    ++Q+E   +    S  K +   +  +Y G + I  RD  + H+ 
Sbjct: 184 SNLLIAISGNFDETVLMTQLEEKMSSFPKSDKKREYDNRYEIYAGTQVI-TRDTQQVHIC 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G        Y  +ILA+ LG GMS+RLFQ +RE++GL YS+ ++   + D G+   
Sbjct: 243 FNTRGIDVHHPKKYAASILANALGGGMSARLFQRIREEKGLAYSVYSYQSVYEDCGIFTT 302

Query: 300 ASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T KE    + + I E  + +  E I ++E+ +   +  + L+   E S  R   ++ 
Sbjct: 303 YAGTTKEAYQEVVNMIQEEYKKVREEGITEQELQRCKNQFTSALMFHLESSKGRMSSMAS 362

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G +   E+I+  I+ ++ EDI  +A+ +F
Sbjct: 363 SYINNGKVEAREEIMKRINEVSLEDIKEMAQYLF 396


>gi|322420100|ref|YP_004199323.1| processing peptidase [Geobacter sp. M18]
 gi|320126487|gb|ADW14047.1| processing peptidase [Geobacter sp. M18]
          Length = 424

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 209/409 (51%), Gaps = 10/409 (2%)

Query: 3   LRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR++  S+G+ V T+ +  + SA + + I + +RNE  E  G +HF+EH+LFKGT  RTA
Sbjct: 10  LRLTTLSNGVRVATQQIQGMQSASIGIRIDSSTRNEEPETGGASHFIEHLLFKGTPSRTA 69

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I ++   +G   NAYTS E   Y+A  L   +P   EI+ DM  +S     ++E+ER 
Sbjct: 70  DQITDQFNSIGARANAYTSQEEVFYYAISLASIIPATFEILADMFVHSWLPEKEVEKERG 129

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M++D    F+  +F +  W+   +G PILG  ETI + + ++++     NY A
Sbjct: 130 VVLQEILMNQDTPGRFIYNQFHQGFWQGHPLGTPILGTAETIGAISRQRLMEHKFANYLA 189

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
           +   V   G V+H+  V Q E         V  V K     +PAV     Y   R + + 
Sbjct: 190 NATIVSVAGNVEHDRVVEQAERLLGELPTGVLRVKKAATGWQPAVSQNVHY--PRAIEQL 247

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H  +G+      +   +   +L  ILG GM+SRLF+EVRE+R L Y++ +   +++D+  
Sbjct: 248 HFYMGYPLPPAGNEHRHKLAVLNQILGSGMNSRLFREVRERRSLAYTVYSMMSSYTDSAS 307

Query: 297 LYIASATAKENIM-ALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L I + T+ E    A+     EV++ + E + +  +     +I    + + +    +   
Sbjct: 308 LMIYAGTSSERAQEAVDVCHAEVMRFIEEKVTEEVLVAAKEQIRCARLMALDDCETQVRR 367

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGP 403
           IS      G+    E  +D I+A+T E++  VA+ +F    P +   GP
Sbjct: 368 ISNTTSLLGAPEPIELSLDAIAAVTAEEVRDVAQLLFDGVVPRVESAGP 416


>gi|116328708|ref|YP_798428.1| Zn-dependent peptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116121452|gb|ABJ79495.1| Zn-dependent peptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 428

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 127/387 (32%), Positives = 206/387 (53%), Gaps = 3/387 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            GIT++ +  P   SA   V +R GSR+E  +  G  HFLEHMLFK T KRTAKE  E+I
Sbjct: 16  GGITLLFQQAPHTVSASAGVFVRVGSRHESTKNAGYCHFLEHMLFKDTAKRTAKEQAEDI 75

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E+VGG  NA TS E+T +H  V  +H+ L LE++ +M+       SDIE E  V+LEE+ 
Sbjct: 76  ERVGGFTNAATSREYTYFHVTVAGKHIGLGLELLAEMIYEPLLKQSDIENEAGVILEELQ 135

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
             ED   D++   + +  +    +GR I+G  E++S     K++ F +  Y  + M++  
Sbjct: 136 GYEDSPEDYIHDFYYQNFFPKNSLGRDIIGTRESVSGVDHRKLLEFYNTYYHTENMFLSI 195

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIK-ESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G  + +   +    YFN     K   +++       G + +K+ L + + +LG  G A 
Sbjct: 196 SGNFEPDEIFAIAGKYFNKLKKKKKDIDALPLPKKQWGYFPKKKKLEQVYFVLGGEGFAR 255

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
           +  +  L ++   ILG G SSRLFQ+VRE++GLCY I+A+  ++ D G+  I  +T+KE 
Sbjct: 256 EFHNASLASLFTHILGGGTSSRLFQKVREEKGLCYQITAYPSSYIDVGINSIVCSTSKEK 315

Query: 308 IMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
            +    +I + ++ +L+  I +RE+    +     L  S E++  R   I+   ++ G  
Sbjct: 316 FVTCLETIADEIKLILDRGITERELLDAQSNHEGALSISYEQTESRMNTIALMELYYGRN 375

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFS 393
              E+ +  I +IT ED+   A+  F 
Sbjct: 376 YSYEERVKEIYSITLEDLNRFARSAFG 402


>gi|116330634|ref|YP_800352.1| Zn-dependent peptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116124323|gb|ABJ75594.1| Zn-dependent peptidase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 428

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 127/387 (32%), Positives = 206/387 (53%), Gaps = 3/387 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
            GIT++ +  P   SA   V +R GSR+E  +  G  HFLEHMLFK T KRTAKE  E+I
Sbjct: 16  GGITLLFQQAPHTVSASAGVFVRVGSRHESTKNAGYCHFLEHMLFKDTAKRTAKEQAEDI 75

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E+VGG  NA TS E+T +H  V  +H+ L LE++ +M+       SDIE E  V+LEE+ 
Sbjct: 76  ERVGGFANAATSREYTYFHVTVAGKHIGLGLELLAEMIYEPLLKQSDIENEAGVILEELQ 135

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
             ED   D++   + +  +    +GR I+G  E++S     K++ F +  Y  + M++  
Sbjct: 136 GYEDSPEDYIHDFYYQNFFPKNSLGRDIIGTRESVSGVDHRKLLEFYNTYYHTENMFLSI 195

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIK-ESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAY 247
            G  + +   +    YFN     K   +++       G + +K+ L + + +LG  G A 
Sbjct: 196 SGNFEPDEIFAIAGKYFNKLKKKKKDIDALPLPKKQWGYFPKKKKLEQVYFVLGGEGFAR 255

Query: 248 QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKEN 307
           +  +  L ++   ILG G SSRLFQ+VRE++GLCY I+A+  ++ D G+  I  +T+KE 
Sbjct: 256 EFHNASLASLFTHILGGGTSSRLFQKVREEKGLCYQITAYPSSYIDVGINSIVCSTSKEK 315

Query: 308 IMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI 366
            +    +I + ++ +L+  I +RE+    +     L  S E++  R   I+   ++ G  
Sbjct: 316 FVTCLETIADEIKLILDRGITERELLDAQSNHEGALSISYEQTESRMNTIALMELYYGRN 375

Query: 367 LCSEKIIDTISAITCEDIVGVAKKIFS 393
              E+ +  I +IT ED+   A+  F 
Sbjct: 376 YSYEERVKEIYSITLEDLNRFARSAFG 402


>gi|220912210|ref|YP_002487519.1| peptidase M16 domain protein [Arthrobacter chlorophenolicus A6]
 gi|219859088|gb|ACL39430.1| peptidase M16 domain protein [Arthrobacter chlorophenolicus A6]
          Length = 447

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 123/412 (29%), Positives = 211/412 (51%), Gaps = 11/412 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA +   +  GSR+E   +HG  HFLEH+LFKGT +RTA
Sbjct: 27  VRRSVLPGGVRVLTEAMPGQRSATIGFWVGVGSRDEAHGQHGSTHFLEHLLFKGTKRRTA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    ++VGG+ NA T+ E T Y A VL   +P+A+++I DM++ +  +P ++E+ER+
Sbjct: 87  LEIASAFDEVGGESNAATAKESTCYFARVLDTDLPMAIDVIADMITGAVLDPDEMEQERD 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M  DD  D     F   V     +GRPI G P+ I +   + +     R Y  
Sbjct: 147 VILEEIAMDSDDPTDVAHEHFVASVLGSHPLGRPIGGTPDAIRAVARDSVWEHYQRYYRP 206

Query: 182 DRMYVVCVGAVDHE----FCVSQVESY-----FNVCSVAKIKESMKPAVYVGGEYIQKRD 232
           D + +   G ++H+      V  +E+       N   V +            G  + KR 
Sbjct: 207 DELVITAAGGLEHDVVCGLVVDALEAAGWSLETNASPVDRRPTERALITGTAGLQVVKRA 266

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           + + ++++G           Y+ ++L ++LG GMSSRLFQE+REKRGL YS  +   +++
Sbjct: 267 VEQANIIMGCPTIVATDERRYVMSVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFASSYA 326

Query: 293 DNGVLYI-ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + A  T  +    L    +E+ +   + I + E+ K   ++   ++ + E +  
Sbjct: 327 DAGYFGMYAGCTPSKVRQVLELLGIELDKLAEDGISEDELRKAVGQLCGGIVLALEDTGS 386

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   + +  +  G     ++ +  I ++T E +  +A ++ ++  T+ ++GP
Sbjct: 387 RMSRLGRAELVSGEYQDIDETLRLIKSVTAEQVQELAAELAAAPRTVTVVGP 438


>gi|118578485|ref|YP_899735.1| processing peptidase [Pelobacter propionicus DSM 2379]
 gi|118501195|gb|ABK97677.1| processing peptidase [Pelobacter propionicus DSM 2379]
          Length = 424

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/411 (30%), Positives = 218/411 (53%), Gaps = 16/411 (3%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +GI V+T+ +  + SA + + I + +RNE  +  G +HF+EH+LFKGT +R+A 
Sbjct: 11  RMTTLDNGIRVVTQSIAGMQSAAIGIRIDSSTRNEPADMGGASHFIEHLLFKGTDRRSAD 70

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I+EE + +G   NAYTS E   Y+A  L   +P   +I+ D+  NS+    ++E+ER V
Sbjct: 71  RIMEEFDALGAGANAYTSQEEVFYYATCLCSALPATFDILADLFVNSTLPQEEVEKERGV 130

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VL+EI M +D+   +L  RF +  WKD  IG+ +LG  E+I+S   ++++      Y A+
Sbjct: 131 VLQEISMIQDNPGRYLYQRFHQGFWKDHPIGQSVLGTTESIASVGRDRLMGHKLSQYVAN 190

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKI--KESMKPAVYVGGEYIQK-RDLA 234
              V   G V+H+  V  V+    +C     SV +I  +   +P++   G Y+   R + 
Sbjct: 191 ATIVSAAGNVEHDRIVELVQRL--LCELPGGSVPRIAPEPGWQPSI---GVYVHNPRPME 245

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           +    +G+      +   +   +   ILG GMSSRLF+EVRE+RGL Y++ +   ++SD+
Sbjct: 246 QTQFYMGYPIPPAGNEHRHTLAVFNQILGGGMSSRLFREVRERRGLAYAVYSTMVSYSDS 305

Query: 295 GVLYIASATAKENIM-ALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
             L + + T  E    A+     E+++   E +    +D    ++  K + S +    + 
Sbjct: 306 ASLLVFAGTGPERAQEAIDVCHGELLRFCGETVSSETLDSAREQLRCKRLMSLDDCETQV 365

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGP 403
             IS  +   G+    E ++  I+A++ ED+  +A+ +F   TP +  +GP
Sbjct: 366 RRISNSLSVLGTPEPMEDVLRGIAAVSAEDVRSLAQSLFGEVTPRVESVGP 416


>gi|327399808|ref|YP_004340677.1| processing peptidase [Hippea maritima DSM 10411]
 gi|327182437|gb|AEA34618.1| processing peptidase [Hippea maritima DSM 10411]
          Length = 398

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 213/369 (57%), Gaps = 14/369 (3%)

Query: 23  SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLE 82
           SA V + + AGS  E ++E G+AHF+EHMLFKGT KRT K+I  +I+K+GG INA+TS E
Sbjct: 12  SASVGIFVPAGSAFESEKERGLAHFIEHMLFKGTKKRTYKDIAADIDKLGGVINAFTSTE 71

Query: 83  HTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARF 142
           +T ++  VLK+++P A +++ D++++S  + +++E+E+ V++EEI M+ D+  D +   F
Sbjct: 72  YTGFYVKVLKDYIPKAFDVLADIITDSVIDENELEKEKGVIIEEINMTNDNPDDAVYEAF 131

Query: 143 SEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV-GAVDH-EFCVSQ 200
            E        G+PILG  E I ++T E ++ F+ + Y  + M V  V G VD  +F V +
Sbjct: 132 LENAIPTS-FGKPILGTKEHIIAYTREDLLKFLGKFYKPEEMIVSAVGGGVDEFDFDVGK 190

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC----AYQSRDFYLTN 256
            E +FN    +K K  ++     G + I+ RD+A+ ++++   GC     Y  R  Y  +
Sbjct: 191 -EFFFNEYFQSKPKTELRFEFKSGIDVIE-RDIAQTNVVM---GCELFSVYDDRK-YAAS 244

Query: 257 ILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIV 316
           +L S  G  MSSRLFQ +RE++ LCYSI +  + +S  G+  I +AT+ + +  L   I 
Sbjct: 245 LLNSSFGATMSSRLFQSIREEKSLCYSIYSSVKLYSKGGMFLIFAATSNDRVQHLIDGIR 304

Query: 317 EVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDT 375
             ++ L +  + + E++      +     S E SY   ++ +   +  G  +  + I+D 
Sbjct: 305 LEIEKLKKYGLTKEELENAKTNFNGGYALSLESSYSVMVKQAIDTILYGDYVSEDYIMDK 364

Query: 376 ISAITCEDI 384
           I+ +T EDI
Sbjct: 365 INRVTLEDI 373


>gi|325299517|ref|YP_004259434.1| processing peptidase [Bacteroides salanitronis DSM 18170]
 gi|324319070|gb|ADY36961.1| processing peptidase [Bacteroides salanitronis DSM 18170]
          Length = 407

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/406 (31%), Positives = 209/406 (51%), Gaps = 18/406 (4%)

Query: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           M  + +   +GI ++ E  PI+ A+    + AG+R+ER +E GMAHF+EH++FKGT KR 
Sbjct: 1   MGYQTATLPNGIRIVHEPNPINVAYCGYAVDAGTRDERADEQGMAHFVEHLIFKGTRKRH 60

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I+  +E VGG++NAYT+ E T  ++  LKE    A E++ D++ NS+F  ++IE+E 
Sbjct: 61  AWHILNRMENVGGELNAYTNKEETVIYSAFLKEDFLRAAELLTDIVFNSTFPQNEIEKET 120

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   ED   + +   F E+++ +  +GR ILGKPE + +F  E  + FV R Y 
Sbjct: 121 EVIIDEIQSYEDSPAELIFDDFEELIFPNHPLGRNILGKPEQLRNFRSEDALDFVGRYYK 180

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK--PAVYVGGEYIQKRDLAEEHM 238
            D +     G +D    V  +E    +    K++  ++  P  YV  +    +D  + H+
Sbjct: 181 PDNLVFFVQGNLDFNRIVRTMEKVTAMIPFGKVENYVRQAPGPYVPRQVTVHKDTHQVHV 240

Query: 239 MLGFNG-CAYQSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           M+G  G  AY  R    + L NIL    G GM+SRL   +REKRGL Y++ ++   ++D 
Sbjct: 241 MIGGRGYSAYDERRTGLYLLNNILG---GPGMNSRLNVALREKRGLVYNVESNLTAYTDT 297

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQ-----ERS 349
           G   I      E+        +E+VQ  L  + ++ +         K I  Q     +  
Sbjct: 298 GTFCIYFGCDPED----ADRCIELVQRELRKLREQPLTDSRLNAAKKQIIGQIGVASDNF 353

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST 395
              AL+++K  +        E++   I A+T   +  +A ++FS  
Sbjct: 354 ENNALDMAKCFLHYKHYENKEEVFRRIEALTAGQLQDIANEMFSEN 399


>gi|159899139|ref|YP_001545386.1| peptidase M16 domain-containing protein [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892178|gb|ABX05258.1| peptidase M16 domain protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 422

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/400 (30%), Positives = 213/400 (53%), Gaps = 6/400 (1%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR-TAKEIVEE 67
           +G+ + T+ MP   S  + +  + GSR E     G++HFLEHM FKGT K  TAK++ E 
Sbjct: 10  NGLRIYTDEMPHTHSVSMGIFTQVGSRYENARLTGISHFLEHMFFKGTAKYPTAKDLSEA 69

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           IE +GG INA TS + T Y+  V   H    ++++ DML+ + F+P +IE+ER V+ EEI
Sbjct: 70  IEGIGGYINATTSYDTTCYYCKVANIHTERGIDVLTDMLNAALFDPKEIEKERGVIQEEI 129

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
            MS D    ++     E++W DQ +GR I G  E++ +F+ E ++++  ++Y A    + 
Sbjct: 130 KMSLDVPAQWVHQLLDELMWGDQPLGRDIAGTLESVGAFSREDLLNYRDQHYVAGNTVIS 189

Query: 188 CVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--KRDLAEEHMMLGFNGC 245
             G  +    V ++ S F+   V  + + +    +     +    +   + + +LG    
Sbjct: 190 LAGNFNSTEIVDRLTSLFSHYRVLDVPKPITTNSFGTAPVVHLLNKPTEQTNFVLGLKSF 249

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
            Y   D +  ++L SILG GMSSRLFQE+RE+RGL YS+ ++   + D G   +      
Sbjct: 250 GYGDSDRWALSVLDSILGGGMSSRLFQEIREERGLAYSVGSYTAEYDDAGKWIVYGGVEV 309

Query: 306 ENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
              +   ++I+E ++ L ++ +   E+ +   ++   ++   E ++  A   ++  +  G
Sbjct: 310 SKAVDAIAAIIEELRKLRDHGVTAAELHRIKEQVKGGMLLGLEDTWSVANRNARHELRYG 369

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            ++  E+I+  I A+T EDI  VA+++       LAI+GP
Sbjct: 370 EVIPVEQIVAWIEAVTLEDIQRVAQRLIRPDNLYLAIIGP 409


>gi|294785397|ref|ZP_06750685.1| peptidase, M16 family [Fusobacterium sp. 3_1_27]
 gi|294487111|gb|EFG34473.1| peptidase, M16 family [Fusobacterium sp. 3_1_27]
          Length = 408

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 217/394 (55%), Gaps = 4/394 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   ++ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NIKLKKLDNGITLITENLPDISTFSMGFFVKTGAMNETKKESGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS E T Y+  +L   + +A++++ DML NS+F+   IE+ER
Sbjct: 63  AKEISEFVDFEGGILNAFTSREMTCYYIKLLSSKLDIAIDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M +D   + +  +  E   +  I    I G   ++     + I++++ ++Y 
Sbjct: 123 NVIIEEIKMYDDIPEEIVHEKNIEYALRG-IHSNSISGTVSSLKKIDRKAILNYLEKHYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMM 239
           A+ + +V  G +D ++   ++         AK KE +     +       +  + + H+ 
Sbjct: 182 AENLVIVVAGNIDEKYLYKELNKRMKDFRKAKKKEVLDLTYEIKKGKKVVKKPSNQIHLC 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G + +S   Y   I+++ILG+GMSSRLFQ++RE+RGL YS+  +   F + G+L +
Sbjct: 242 FTTKGVSSKSDLRYPAAIISNILGEGMSSRLFQKIREERGLAYSVYTYLTRFENCGLLSV 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
              T KE+   +   I E   ++ EN I +RE+ K   K  +    S E +  R   ++ 
Sbjct: 302 YVGTTKEDYKEVIKLIKEEFNNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLAS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G I+  +K+ + I  +T +DI   A  +F
Sbjct: 362 TYITYGKIISLDKVREDIEKVTLKDIKKAADFLF 395


>gi|256845303|ref|ZP_05550761.1| zinc protease [Fusobacterium sp. 3_1_36A2]
 gi|256718862|gb|EEU32417.1| zinc protease [Fusobacterium sp. 3_1_36A2]
          Length = 408

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 217/394 (55%), Gaps = 4/394 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   ++ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NIKLKKLDNGITLITENLPDISTFSMGFFVKTGAMNETKKESGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS E T Y+  +L   + +A++++ DML NS+F+   IE+ER
Sbjct: 63  AKEISEFVDFEGGILNAFTSREMTCYYIKLLSSKLDIAIDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M +D   + +  +  E   +  I    I G   ++     + I++++ ++Y 
Sbjct: 123 NVIIEEIKMYDDIPEEIVHEKNIEYALRG-IHSNSISGTVSSLKKIDRKAILNYLEKHYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMM 239
           A+ + +V  G +D ++   ++         AK KE +     +       +  + + H+ 
Sbjct: 182 AENLVIVVAGNIDEKYLYKELNKRMKDFRKAKKKEVLDLTYEIKKGKKVVKKPSNQIHLC 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G + +S   Y   I+++ILG+GMSSRLFQ++RE+RGL YS+  +   F + G+L +
Sbjct: 242 FTTKGVSSKSDLRYPAAIISNILGEGMSSRLFQKIREERGLAYSVYTYLTRFENCGLLSV 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
              T KE+   +   I E   ++ EN I +RE+ K   K  +    S E +  R   ++ 
Sbjct: 302 YVGTTKEDYNEVIKLIKEEFNNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLAS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G I+  +K+ + I  +T +DI   A  +F
Sbjct: 362 TYITYGKIISLDKVREDIEKVTLKDIKKAADFLF 395


>gi|309791868|ref|ZP_07686352.1| peptidase M16 domain protein [Oscillochloris trichoides DG6]
 gi|308226088|gb|EFO79832.1| peptidase M16 domain protein [Oscillochloris trichoides DG6]
          Length = 425

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 209/402 (51%), Gaps = 6/402 (1%)

Query: 8   TSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK-RTAKEIV 65
           T +G+ ++ E +P   S  +   + AGSR+E     G AHF+EHM FKG+    TA++I 
Sbjct: 7   TPTGLRILVEPLPHTYSVSIGCFVHAGSRHEPDAHAGAAHFIEHMCFKGSHAFPTARQIS 66

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           E +E VGG +NA TS E T Y A V   H   AL ++ DML+   F+P ++E+ER V++E
Sbjct: 67  EAVEGVGGILNASTSYESTVYWAKVATIHFDRALAVLADMLTRPIFDPRELEKERRVIIE 126

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI   +D   D +     +++W +Q +GR I G  ET+++ +   ++ F  R+Y  D M 
Sbjct: 127 EIRGIQDSPSDLIHEILHQVMWGEQSLGRDIAGSVETVAALSRTDLLDFFQRHYNRDTMV 186

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--KRDLAEEHMMLGFN 243
           +   G +  +  V  V+  F+    A     + P     G  ++   RD+ + +  LG  
Sbjct: 187 ISVAGNITVDQVVEAVDRAFSDLPRATALNPLIPPQACRGPQVKLIGRDIEQGNFCLGVP 246

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +Y   D     +L S+LG GMSSRLFQ +RE+ G+ YS+ ++H   SD G+  I  + 
Sbjct: 247 GLSYNDADRRALQVLDSVLGGGMSSRLFQVLREENGMAYSVGSYHTELSDTGMWVIYGSV 306

Query: 304 AKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
             E++        +++  L+++ +   E+     ++   ++ S E ++  A      ++ 
Sbjct: 307 EPESLRDGLVLCRDMLADLVQHGVTTEELAMVKEQVKGGILLSLEDTWSVASRNGAHMLR 366

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGP 403
            G ++  E+++  +  +T E I  VA++ +      LA+LGP
Sbjct: 367 YGHVIPVEQVVAEVETVTAEQIQHVAQRLLLPEALHLAVLGP 408


>gi|294782106|ref|ZP_06747432.1| peptidase, M16 family [Fusobacterium sp. 1_1_41FAA]
 gi|294480747|gb|EFG28522.1| peptidase, M16 family [Fusobacterium sp. 1_1_41FAA]
          Length = 408

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 129/395 (32%), Positives = 218/395 (55%), Gaps = 6/395 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   I+ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NIKLKKLDNGITLITEHLPNVSTFSMGFFIKTGAINETKKESGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS E T Y+  +L   + +AL+++ DML NS+F+   IE+ER
Sbjct: 63  AKEISEFVDFEGGILNAFTSREVTCYYIKLLSSKMDVALDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   + +  +  E   K  I    I G   ++     + I+ ++  +Y 
Sbjct: 123 NVIIEEIRMYEDIPEEIVHEKNIEFALKG-IHSNSISGTIASLKKINRKAILKYLEEHYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ + VV  G +D ++   ++         AK KE +    Y   +  +        + L
Sbjct: 182 AENLVVVACGNIDEKYLYKELNKRMKDFRKAK-KEEVLDLTYQIKKGKKVIKKPSNQIHL 240

Query: 241 GFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            F   G + +S   Y   I+++ILG+GMSSRLFQ++RE+RGL YS+  +   F++ G+L 
Sbjct: 241 CFTTRGVSNKSELRYPAAIISNILGEGMSSRLFQKIREERGLAYSVYTYLTRFTNCGLLS 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           +   T KE+   +   I E  +++ EN I +RE+ K   K  +    S E +  R   ++
Sbjct: 301 VYVGTTKEDYKEVIKLIKEEFKNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLA 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              +  G I+  +K+ + I  ++ +DI   A+ +F
Sbjct: 361 STYLTYGEIISLDKVREDIEKVSLKDIKKAAEFLF 395


>gi|148654573|ref|YP_001274778.1| peptidase M16 domain-containing protein [Roseiflexus sp. RS-1]
 gi|148566683|gb|ABQ88828.1| peptidase M16 domain protein [Roseiflexus sp. RS-1]
          Length = 431

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 215/403 (53%), Gaps = 12/403 (2%)

Query: 10  SGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR-TAKEIVEE 67
            G+ V+ E +P   S  V   +  G+ +E + E G+AHF+EHMLFKGT +R + K I + 
Sbjct: 15  GGLRVLIEALPYAHSVSVGCFVSVGAGHEARHESGIAHFIEHMLFKGTQRRPSPKLIADA 74

Query: 68  IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEI 127
           IE VGG ++AYTS E T Y+A V   +   A++++ DML    F+P DIE+ER V+ EE+
Sbjct: 75  IEGVGGTLDAYTSFESTVYYAKVADIYFDRAIDVLADMLIAPRFDPLDIEKERRVIAEEL 134

Query: 128 GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVV 187
             +ED   + +       +W DQ +GR I G  ETI++F  E+I+SF   +YT   + + 
Sbjct: 135 HQTEDTPSELVHLVLDAAMWGDQPLGRDIAGSEETIAAFRAEQIVSFWRAHYTKRNIVIS 194

Query: 188 CVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKR--DLAEEHMMLGF 242
             G VD +  +  V   F+     S A +  S  P     G  +  R  D  + +  +GF
Sbjct: 195 IAGHVDVQRALDAVAVAFDALPEGSPAMLLPSQPPRP---GPAVTLRSDDNEQGNFCIGF 251

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G ++   D     +  +++G G SSRLFQE+RE+RGL Y+I ++   + D G   I  +
Sbjct: 252 RGISHNDPDRRALLVFDTVIGGGASSRLFQEIREERGLAYNIGSYSREYHDTGKWVIFGS 311

Query: 303 TAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
              + +    ++++ E+ ++ +E I   E+ +   ++   ++ S E ++  A       +
Sbjct: 312 VEPQCVDECIATVMTELRRARVEGITAEELAQVKEQVKGGILLSLEDTWAIASRNGSHQL 371

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
             G ++  E+++  + A++ +D++ VA+++       LA++GP
Sbjct: 372 RYGRVIPIEQVVAEVEAVSRDDVLRVAQRVLRDDHLHLAVIGP 414


>gi|291461217|ref|ZP_06027680.2| peptidase, M16 family [Fusobacterium periodonticum ATCC 33693]
 gi|291378154|gb|EFE85672.1| peptidase, M16 family [Fusobacterium periodonticum ATCC 33693]
          Length = 413

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 125/394 (31%), Positives = 218/394 (55%), Gaps = 4/394 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   I+ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 8   NIKLKKLDNGITLITEHLPNVSTFSMGFFIKTGAINETKKESGISHFIEHLMFKGTKNRT 67

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS E T Y+  +L   + +AL+++ DML NS+F+   IE+ER
Sbjct: 68  AKEISEFVDFEGGILNAFTSREVTCYYIKLLSSKMDIALDVLTDMLLNSNFDEESIEKER 127

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   + +  +  E   K  I    I G   ++     + I+ ++  +Y 
Sbjct: 128 NVIIEEIRMYEDIPEEIVHEKNIEFALKG-IHSNSISGTIASLKKINRKAILKYLEEHYV 186

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMM 239
           A+ + +V  G +D ++   ++         AK +E +     +       +  + + H+ 
Sbjct: 187 AENLVIVVSGNIDEKYLYKELSKKMKDFRRAKKEEVLDLTYQIKKGKKVVKKPSNQIHLC 246

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G + +S   Y   I+++ILG+GMSSRLFQ++RE+RGL YS+  +   F++ G+L +
Sbjct: 247 FTTRGVSNKSELRYPAAIISNILGEGMSSRLFQKIREERGLAYSVYTYLTRFTNCGLLSV 306

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
              T KE+   +   I E  +++ EN I +RE+ K   K  +    S E +  R   ++ 
Sbjct: 307 YVGTTKEDYKEVIKLIKEEFKNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLAS 366

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G I+  +K+ + I  ++ +DI   A+ +F
Sbjct: 367 TYLTYGEIISLDKVREDIEKVSLKDIKKAAEFLF 400


>gi|256832258|ref|YP_003160985.1| processing peptidase [Jonesia denitrificans DSM 20603]
 gi|256685789|gb|ACV08682.1| processing peptidase [Jonesia denitrificans DSM 20603]
          Length = 439

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 125/411 (30%), Positives = 209/411 (50%), Gaps = 11/411 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ VITE MP   S  V      GSR+E    +G  HFLEH+LFKGT +RTA
Sbjct: 26  IRRSVLPGGVRVITEQMPGQRSVTVGAWFNVGSRDEADGHYGSTHFLEHLLFKGTPRRTA 85

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I    + VGG+ NA T  E+T Y+A VL   +P+A+++I DM++++S +  ++E ER 
Sbjct: 86  FDIAGAFDSVGGEANAVTGKENTCYYARVLDTDLPMAVDVILDMVTSASLDAHELEIERG 145

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D +   F+  V  D  +GRPI G   TI++   E + +    +Y  
Sbjct: 146 VILEELAMNDDDPGDVIHEHFTSHVLGDHPLGRPIGGTAHTITAVPREAVWAHYRAHYVP 205

Query: 182 DRMYVVCVGAVDHEFCVSQV-----ESYFNVCSVAK--IKESMKPAVYVGGEYIQ--KRD 232
           + + V   G+VDH+     V        +++ S A    + S  P      E+     R 
Sbjct: 206 EGLVVTAAGSVDHDVLCDMVLEALDRGGWDLASAATPLPRRSASPLDVPLSEHRVDIPRA 265

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H+++G  G +      +  ++L + LG GMSSR+FQE+REKRGL YS      ++S
Sbjct: 266 TEQAHVIVGCQGLSAADERRFDMSVLTAALGGGMSSRIFQEIREKRGLAYSTYCFGSSYS 325

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
             G   + +  A   +  + S +V  ++ L    +   E+ +   ++   L+   E S  
Sbjct: 326 GIGTFGLYAGCAPARVRDVESLMVAELEKLAAHGLTHEEMVRTQGQLRGSLVLGVEDSGA 385

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           R   + +  +  G +   ++ I  I+A+T E +  +A+++       A +G
Sbjct: 386 RMNRLGRAELVTGELYSLDESIHKINAVTAERVQSLAQELARRVRVTATIG 436


>gi|332976844|gb|EGK13669.1| M16 family peptidase [Desmospora sp. 8437]
          Length = 428

 Score =  199 bits (506), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 124/396 (31%), Positives = 214/396 (54%), Gaps = 2/396 (0%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+ V+ E +P + S    + I AGSR E +E +G++HFLEHMLFKGT KRTA+++ E  
Sbjct: 18  NGVRVVAESIPHVRSVAFGLWIGAGSRWETEENNGISHFLEHMLFKGTKKRTARQLAETF 77

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           +++GG +NA+TS E T Y+A VL EH+ +A++++ DM   S F P +IE+E+ VV EEI 
Sbjct: 78  DEIGGQVNAFTSKEMTCYYAKVLDEHLEIAIDVLADMFFESLFEPEEIEKEQKVVEEEIR 137

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D +    S    +   +G  +LG  E + SF    ++ +  ++Y  D++ +  
Sbjct: 138 MVEDTPDDVVHEYLSAAAMEKNPLGYAVLGNVENVRSFHRSLLLDYKGKHYRPDQLVIAL 197

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQ 248
            G +   +     E +        I       ++  G  I+ +   + H  +G  G A  
Sbjct: 198 AGNLPEHYLEWIAERFGGFQREGNIGSRGGGPLFTAGTSIRHKATEQSHFCIGLPGVAVG 257

Query: 249 SRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENI 308
               Y  N+L ++LG  MSSRLFQEVRE+RGL YS+ ++H  +SD G+  I + TA    
Sbjct: 258 DPQIYSYNLLNNLLGGNMSSRLFQEVREERGLAYSVFSYHSAYSDTGLFTIYAGTAPGQE 317

Query: 309 MALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL 367
             +   ++ +++ L E+ + + E+ K   ++   ++ S E +  R   + K  +  G   
Sbjct: 318 NEVIEILLRIMKELREDGVSEEELRKGKEQLKGSMMMSLESTNNRMSRLGKNELLLGCHK 377

Query: 368 CSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             ++++  + ++T +D++  A+ IFS     +I+ P
Sbjct: 378 SLDEVVAAVESLTRQDLLKAAQAIFSHPMAFSIISP 413


>gi|269121331|ref|YP_003309508.1| peptidase M16 domain protein [Sebaldella termitidis ATCC 33386]
 gi|268615209|gb|ACZ09577.1| peptidase M16 domain protein [Sebaldella termitidis ATCC 33386]
          Length = 408

 Score =  199 bits (505), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 120/377 (31%), Positives = 210/377 (55%), Gaps = 12/377 (3%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           L+++ T  GI +I + +  + SA + V ++ G+++E  EEHG++H +EHM+FKGT  R  
Sbjct: 2   LKLTNTPKGIKIIYDYISNVSSASIGVFVKTGAKDETAEEHGLSHLIEHMMFKGTKNRNY 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI +E++ +GG INAYTS E T Y+  VLK++V  ALEI+ DM+ NS F+  ++E+E++
Sbjct: 62  QEISQEVDYLGGSINAYTSKEETVYYISVLKDYVEQALEILCDMVGNSVFDQEELEKEKD 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQI---IGRPILGKPETISSFTPEKIISFVSRN 178
           V++EEI M +D   D +     E+  KD I   +G+PI+G  +++  FT + I+ + +  
Sbjct: 122 VIVEEIRMYQDTPDDLV----LELNSKDSIAGNLGKPIIGTEKSVKGFTRDNIVKYYTER 177

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-YVGGEYIQKRDLAEEH 237
           YT D + +V  G    E     ++ YF   +  K     K    +  GE + ++D+ + +
Sbjct: 178 YTKDNLVIVVSGNFKKEKIKRIIDKYFGNFNQEKTDRYEKIDFSFQNGEKVYEKDIKQVN 237

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + + + G +Y   +    +++++I+G  MSSRLFQ++RE+ GL YS+   ++ + + GV+
Sbjct: 238 ICISYPGVSYLDENKIYYDVISNIMGGTMSSRLFQKIREEMGLAYSVHTFNQTYKEGGVV 297

Query: 298 --YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             YI +   K    A+  +  E +      I   E++K   K  +K+  S E    R   
Sbjct: 298 TTYIGT-NEKSYKKAVKITKDEFLNLRRNGINISELEKAQNKFLSKIAFSLENIRNRMNI 356

Query: 356 ISKQVMFCGSILCSEKI 372
           I    +  G I   EK+
Sbjct: 357 IGTHYLKYGEIFDEEKL 373


>gi|29348717|ref|NP_812220.1| putative zinc protease ymxG [Bacteroides thetaiotaomicron VPI-5482]
 gi|29340623|gb|AAO78414.1| putative zinc protease ymxG [Bacteroides thetaiotaomicron VPI-5482]
          Length = 406

 Score =  199 bits (505), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 120/390 (30%), Positives = 212/390 (54%), Gaps = 9/390 (2%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E      A+    I AG+R+E ++E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 10  NGLRIIHEPTLSKVAYCGFAIDAGTRDEAEDEQGMAHFVEHLIFKGTEKRKAWHILNRME 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  +A  L  H+  ALE++GD++ +S+F   +IE+E  V+++EI  
Sbjct: 70  NVGGDLNAYTNKEETVVYAAFLTGHLERALELLGDIVFHSTFPQHEIEKETEVIIDEIQS 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED+  + +   F +M++++  +GR ILGKPE + SF  E ++SF  R Y    M     
Sbjct: 130 YEDNPSELIFDDFEDMIFRNHPLGRNILGKPELLRSFRTEDVLSFTRRFYQPGNMVFFVQ 189

Query: 190 GAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  D +  +   E +  ++ +V    + M P +YV    +  +D  + H+M+G  G  AY
Sbjct: 190 GQYDFKKIIRLAEKHLSDIPAVTVDNQRMPPPLYVPERLVVPKDTHQAHVMIGSRGYNAY 249

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L N+L    G GM+S+L   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 250 DDKRTALYLLNNVLG---GPGMNSKLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGTD 306

Query: 305 KENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            E++ + L  +  E+ +     +   ++     ++  ++  + +     AL ++K  +  
Sbjct: 307 IEDMDICLKLTYKELKRMRDVKMTSSQLAAAKKQLIGQIGVASDNFENNALGMAKTYLHY 366

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFS 393
                SE +   I A+T E ++ VA ++F+
Sbjct: 367 HKYESSESVFHRIEALTAEQLLEVANEMFA 396


>gi|223937580|ref|ZP_03629483.1| peptidase M16 domain protein [bacterium Ellin514]
 gi|223893743|gb|EEF60201.1| peptidase M16 domain protein [bacterium Ellin514]
          Length = 420

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 212/410 (51%), Gaps = 15/410 (3%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           ++++  +G+TV+T  MP + S  + + +  G R E  E +G+ HF+EH+LFKGT KRTA+
Sbjct: 3   QVTQLKNGLTVVTAEMPYMTSVSLGLWVGVGGRYEPAELNGVCHFIEHLLFKGTKKRTAR 62

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I E++E +GG +NA+TS E T YH+    +H    L+++ DM  NS F+P DI +ER V
Sbjct: 63  DISEDVEGIGGYMNAFTSEEVTCYHSRARYDHFDDLLDVLVDMFLNSRFDPEDINKERGV 122

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + EE+ M  D     +    +E  W  Q +GRP+ G  +T+   +   +I ++ RNY A+
Sbjct: 123 IKEELAMYLDQPQHLVQELLNETHWPGQPLGRPLTGTEKTLDGLSRPLVIDYLKRNYVAN 182

Query: 183 RMYVVCVGAVDHE---FCVSQVESYFNVCSVAK----IKESMKPAVYVGGEYIQKRDLAE 235
           R  +   G + H+     VS++   F      K    I++   P +      +  ++  +
Sbjct: 183 RTVIAAAGRLKHKQIVKAVSRIAPRFPQGPHPKFVPVIEDQQAPRI-----RLHTKETEQ 237

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
             + LG + C+      +   +L +ILG+ MSSRLFQ +RE  GL YS+ +    F D G
Sbjct: 238 TQIALGISTCSRHDPRRHALRLLNTILGENMSSRLFQVLREDLGLAYSVYSSPSYFEDTG 297

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIE-QREIDKECAKIHAKLIKSQERSYLRAL 354
            + I++    +N+      I+  ++ L +    Q E  +    I  ++    E +  R +
Sbjct: 298 TITISAGLDLKNLNKALKLIIHELKRLTDTAPGQAEFRRARDYIIGQIDLGLESTDNRMM 357

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
            + +Q +  G I+  +++   +S +T  ++  VA++        LA++ P
Sbjct: 358 WLGEQFLGYGKIMSPQEMKRRVSQVTPAEVRAVAREFLRPEHLNLALVSP 407


>gi|82621176|gb|ABB86276.1| mitochondrial processing peptidase-like [Solanum tuberosum]
          Length = 522

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/416 (31%), Positives = 210/416 (50%), Gaps = 17/416 (4%)

Query: 4   RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   SG+ V TE  + + +A V V I AGSR E  E +G AHFLEHM+FKGT KRT+ 
Sbjct: 96  RVTTLPSGLRVATETNLAVKTATVGVFIDAGSRFETDETNGTAHFLEHMIFKGTEKRTSW 155

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ EEIE +GG +NAYTS E T+Y+A VL   VP+AL+I+ D+L NS F    IERER+V
Sbjct: 156 EMEEEIENMGGHLNAYTSREQTAYYAKVLDNDVPVALDILADILQNSKFEERKIERERDV 215

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + I + T   +  ++S +YTA 
Sbjct: 216 ILREMEEVEGQTEEVIFDHLHSTAFQYSPLGRTILGPAQNIKTITRSHLKDYISTHYTAP 275

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES----MKPAVYVGGEY-IQKRDLAEEH 237
           RM +V  G V HE  V QV+  F   S      S     +PA++ G E  +   D+    
Sbjct: 276 RMVIVASGPVKHEEFVEQVKKQFTKLSTNPTTASELVAREPAIFTGSEVRVIDDDIPLAQ 335

Query: 238 MMLGFNGCAYQSRDFYLTNILASIL---------GDGMSSRLFQEVREKRGLCYSISAHH 288
             + F G  +   D     ++ S+L         G  M S L Q V     L  S+ + +
Sbjct: 336 FAVAFQGAPWTDPDAIPLMVMQSMLGTWNKNAGGGKHMGSDLAQSVAINE-LAESMMSFN 394

Query: 289 ENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
            N+ D G+  + +    + +  L+  I+  +  L   +   ++ + C ++ + L+   + 
Sbjct: 395 TNYKDTGLFGVYAVAKPDCLSDLSYCIMREISKLCYRVSDADVTRACNQLKSSLMLHIDG 454

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGP 403
           +   A +I +Q++  G  +   ++   + A+    I  VA + IF     ++ LGP
Sbjct: 455 TSPVAEDIGRQLLTYGRRIPVTELFARVDAVDASTIKRVANRFIFDQDVAISALGP 510


>gi|301632681|ref|XP_002945410.1| PREDICTED: uncharacterized zinc protease RBE_0522-like [Xenopus
           (Silurana) tropicalis]
          Length = 408

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 213/392 (54%), Gaps = 13/392 (3%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E  P   A+    + AG+R+E + E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 12  NGLRIIHEPSPSKVAYCGFAVDAGTRDESENEQGMAHFVEHLIFKGTRKRKAWHILNRME 71

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  ++  L EH   A+E++ D++ +S+F  ++IE+E  V+++EI  
Sbjct: 72  NVGGDLNAYTNKEETVVYSAFLTEHFGRAVELLVDIVFHSTFPQNEIEKETEVIIDEIQS 131

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   + +   F +MV+++  +GR ILGKPE +  F  +  ++F SR Y    M    +
Sbjct: 132 YEDTPSELIFDDFEDMVFRNHPLGRNILGKPELLRQFHSQDAMAFTSRFYQPSNMVFFVL 191

Query: 190 GAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  D +  + QVE   +   + ++  + + P +YV    +  +D  + H+M+G  G  AY
Sbjct: 192 GNFDFKRVIRQVEKLLSDLPLVEVHNQRIPPPLYVPERLVIHKDTHQAHVMIGSRGYNAY 251

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L NIL    G GM+SRL   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 252 DDKRTALYLLNNILG---GPGMNSRLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGTD 308

Query: 305 KENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
             ++   + LT   +  ++ +     Q    K+  ++  ++  + + +   AL ++K  +
Sbjct: 309 PADVDTCLKLTYKELRRMRDVKMTSSQLMAAKK--QLIGQIGVASDNNENNALGMAKTFL 366

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
                  SE +   I AIT E ++ VA ++F+
Sbjct: 367 HYNKYESSESVYQRIEAITAELLLEVANEMFA 398


>gi|237736828|ref|ZP_04567309.1| zinc protease [Fusobacterium mortiferum ATCC 9817]
 gi|229420690|gb|EEO35737.1| zinc protease [Fusobacterium mortiferum ATCC 9817]
          Length = 408

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/396 (31%), Positives = 211/396 (53%), Gaps = 6/396 (1%)

Query: 1   MNLRISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ + K S+GI V+ + +  I++  + + ++ GSR+E  EE G++H++EHM+FKGTT R
Sbjct: 2   MSIEVRKLSNGIPVLMDNIDSINTISLGIFVKTGSRDEYPEESGVSHYIEHMMFKGTTNR 61

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TAK+I EE++  GG INAYTS + T Y+  +L   +   +EI+ DM +NS+F   ++E+E
Sbjct: 62  TAKDISEEVDNEGGMINAYTSRDTTCYYIQMLSNKIEKGVEILSDMFANSTFTEENLEKE 121

Query: 120 RNVVLEEIGMSEDDSWDFL-DARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           RNV++EEI M ED   + + D      V   Q     +LG  E+++    ++ + +    
Sbjct: 122 RNVIIEEIRMYEDIPEEIIHDENIKFAVTGTQ--SNSVLGTIESLNGIDRDRFVKYFKDQ 179

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG-GEYIQKRDLAEEH 237
           Y A  + +   G +D +     +E  F       ++ ++     +  GE    RD  + H
Sbjct: 180 YRASNLVISVAGKMDCDKLFEMLEKGFGKLEDYPVERNIDNNYTINSGENKIVRDTNQVH 239

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +     G +      Y   I++S+LG  MSSRLFQ++RE+RGL YS+  +   F + GV 
Sbjct: 240 LCFNTKGVSLVDEMKYPAAIISSVLGGNMSSRLFQKIREERGLAYSVYTYSSAFLEGGVF 299

Query: 298 YIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + + T  E+   +   I +  + + EN I   E+ K   +  + L  S E S  R   +
Sbjct: 300 TVYAGTTHESYRDVIDIIRDEFEDIRENGITAYELQKSKNQFLSMLTFSLEGSKGRMNRM 359

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           +   +  G ++  +KII++I  IT +DI   AK IF
Sbjct: 360 ANSYLLYGEVIDIDKIINSIEKITLDDIKETAKVIF 395


>gi|183220917|ref|YP_001838913.1| putative zinc-dependent peptidase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189911013|ref|YP_001962568.1| Zn-dependent peptidase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167775689|gb|ABZ93990.1| Zn-dependent peptidase [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779339|gb|ABZ97637.1| Putative Zn-dependent peptidase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 428

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 200/392 (51%), Gaps = 13/392 (3%)

Query: 10  SGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+TV+ + M   S+  V V ++ GS  E   EHG  HFLEHMLFK T  RT+KEI E I
Sbjct: 14  NGLTVLFQPMKHASSMGVGVFLKQGSLAESNSEHGYFHFLEHMLFKDTETRTSKEIAESI 73

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E+VGG +N  T  E+T Y+   +K    LA EI+ DML    F   DI+ E+ V++EE+ 
Sbjct: 74  ERVGGILNGSTGREYTQYYVVAIKNQAELAFEILSDMLFRPLFRKEDIQTEKGVIMEEMR 133

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
             ED   DF+   +   ++     GR I+G   +++  T   I  F  ++Y    M +  
Sbjct: 134 SYEDAPDDFVYDYYFRNIFGKSPYGRDIIGTKTSVTGVTESSIRRFFEKHYFPKNMVISV 193

Query: 189 VGAVDHEFCVSQVESYFNVCSV--AKIKESMKPAVYVG-GEYIQKRDLAEEHMMLGFNGC 245
            G    E  +   + YF+  +       E + P+      +++++R + + H+MLG NG 
Sbjct: 194 SGNFTWEKVLDLTKKYFSFANPKGKNPTELLIPSPKKSYTKHLERRKIEQFHIMLGVNGS 253

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
               R   +  ++++ILG GM+SRLFQ +REK GLCYSI +    +   G+  I+SAT+K
Sbjct: 254 KRDYRTVTVAGLISTILGGGMASRLFQNIREKEGLCYSIYSFPSYYKTTGLFSISSATSK 313

Query: 306 ENIMALTSSIVEVVQSLLENIEQREID-KECAKIHAKLIKSQERSYL----RALEISKQV 360
           E      +  VE++   LE I +     KE A   +  + S    Y     R   I  Q 
Sbjct: 314 EK----AARCVELILKELETITKHGFSKKELADAKSNQMGSIAIGYELPENRMNNIGLQE 369

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
           ++ G     E  +  I ++T E+I  VAK++F
Sbjct: 370 IYYGKYFSLEDRMRAIKSVTLEEINHVAKEMF 401


>gi|289705303|ref|ZP_06501701.1| peptidase M16 inactive domain protein [Micrococcus luteus SK58]
 gi|289557966|gb|EFD51259.1| peptidase M16 inactive domain protein [Micrococcus luteus SK58]
          Length = 439

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 191/357 (53%), Gaps = 24/357 (6%)

Query: 3   LRISKTSSGITVITEVMPIDSAFVKVN--IRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           +R S    G+ V+TE MP D   V +   +  GSR+E  E +G  HFLEH+LFKGT  RT
Sbjct: 24  VRRSVLPGGVRVLTEAMP-DQRSVTIGYWVAVGSRDESPEGYGATHFLEHLLFKGTPTRT 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I    ++VGG+ NA T+ E T YHA VL E +P+A+E++ DML++S  +P ++E ER
Sbjct: 83  AMDIAAAFDRVGGESNAGTAKESTVYHARVLDEDLPMAVEVLTDMLTSSLIDPDELETER 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M  DD  D    + +E++     +GRPI G PETI + T + ++   +  Y 
Sbjct: 143 GVILEELAMDADDPVDVAHEKLAEVMLDGHPLGRPIGGTPETIRAVTRDHVVGHYTHWYR 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA--------------VYVGGE 226
            D + V   G +DH+     V +     S  ++     PA              V  G  
Sbjct: 203 PDELVVTAAGHLDHDEVCRLVLAALR-ASGWELTPGALPAPRRAVDTAGAAASRVRTGTH 261

Query: 227 YIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISA 286
            + K  + + ++++G    +    D +   ++ S+LG GMSSRLFQE+RE+RGL Y+  +
Sbjct: 262 TVTKA-VEQANVLVGGRSLSTTDPDRFALGVMQSVLGGGMSSRLFQEIRERRGLAYNTYS 320

Query: 287 HHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKECAKIHAKL 342
               +SD G   + +    + +      +  ++++ L+ + + ++ ++E A+ H ++
Sbjct: 321 FSAGYSDAGYWGLYAGCQPDRV----EEVAALMEAELDRMAEADVTEEELARAHGQI 373


>gi|298387080|ref|ZP_06996634.1| peptidase, M16 family [Bacteroides sp. 1_1_14]
 gi|298260230|gb|EFI03100.1| peptidase, M16 family [Bacteroides sp. 1_1_14]
          Length = 406

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 214/392 (54%), Gaps = 13/392 (3%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E      A+    I AG+R+E ++E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 10  NGLRIIHEPTLSKVAYCGFAIDAGTRDEAEDEQGMAHFVEHLIFKGTEKRKAWHILNRME 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  +A  L  H+  ALE++GD++ +S+F   +IE+E  V+++EI  
Sbjct: 70  NVGGDLNAYTNKEETVVYAAFLTGHLERALELLGDIVFHSTFPQHEIEKETEVIIDEIQS 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED+  + +   F +M++++  +GR ILGKPE + SF  E ++SF  R Y    M     
Sbjct: 130 YEDNPSELIFDDFEDMIFRNHPLGRNILGKPELLRSFRTEDVLSFTRRFYQPGNMVFFVQ 189

Query: 190 GAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  D +  +   E +  ++ +V    + M P +YV    +  +D  + H+M+G  G  AY
Sbjct: 190 GQHDFKKIIRLAEKHLSDIPAVTVDNQRMPPPLYVPERLVVPKDTHQAHVMIGSRGYNAY 249

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L N+L    G GM+S+L   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 250 DDKRTALYLLNNVLG---GPGMNSKLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGTD 306

Query: 305 KENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            E++   + LT   ++ ++ +     Q    K+  ++  ++  + +     AL ++K  +
Sbjct: 307 IEDMDTCLKLTYKELKRMRDVKMTSSQLAAAKK--QLIGQIGVASDNFENNALGMAKTYL 364

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
                  SE +   I A+T E ++ VA ++F+
Sbjct: 365 HYHKYESSESVFHRIEALTAEQLLEVANEMFA 396


>gi|269123697|ref|YP_003306274.1| peptidase M16 domain-containing protein [Streptobacillus
           moniliformis DSM 12112]
 gi|268315023|gb|ACZ01397.1| peptidase M16 domain protein [Streptobacillus moniliformis DSM
           12112]
          Length = 405

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/398 (31%), Positives = 218/398 (54%), Gaps = 10/398 (2%)

Query: 11  GITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           GI  +   +  D++F + V    GS NE++ E G++H LEHMLF GT KR   EI EE++
Sbjct: 9   GIKTLINKIEDDASFTISVCFNTGSVNEKENEKGLSHVLEHMLFTGTNKRNNFEISEEMD 68

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
             G   NAYTS E T+Y+   L        EI  DM+++  F    I++E+ ++ EEI M
Sbjct: 69  FYGAKYNAYTSKEVTNYYFTSLSSKQKETTEIFFDMITDPIFPEDQIKKEKEIIFEEIRM 128

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
           S+DD W  +  +  E +++   +   I+G  E++ SFT E +I +  RNYT D + +   
Sbjct: 129 SKDDIWSVVFEQMQENLFEGN-LKYNIIGTEESVGSFTREMLIDYYKRNYTRDNLVISVS 187

Query: 190 GAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM-MLGFNGCAYQ 248
           G +D E  ++Q+++YF+  +  K++ + +       +Y +K+++ + ++ +L  N    +
Sbjct: 188 GNIDEELLINQIKTYFSKLNENKVELTFEKDELKKTDYREKKEINQVNVYILTKNNVKDR 247

Query: 249 S-RDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISA---HHENFSDNGVLYIASATA 304
           S +D+Y+   L  I+GDG SSRLFQE+REKR L YS++A    ++N    GV    S   
Sbjct: 248 SLKDYYIDICLEMIIGDGFSSRLFQEIREKRSLAYSVNAMNFDYKNLKTFGVYIGTSVNK 307

Query: 305 KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
            +  + +T  I++ ++   E I +RE++K    I +    ++E S +    ++   +F G
Sbjct: 308 YKESLEVTLQILDNIKK--EGITERELEKVKNSILSTRATAKENSKIVGRLLNMYKVF-G 364

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
            +   ++I DT+  I+ ED+   A+ + ++  T  I G
Sbjct: 365 KVFTDKEIADTLLCISVEDVNNKARILLNNFSTCVIGG 402


>gi|329890625|ref|ZP_08268968.1| peptidase M16 inactive domain protein [Brevundimonas diminuta ATCC
           11568]
 gi|328845926|gb|EGF95490.1| peptidase M16 inactive domain protein [Brevundimonas diminuta ATCC
           11568]
          Length = 404

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/383 (32%), Positives = 194/383 (50%), Gaps = 9/383 (2%)

Query: 26  VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTS 85
           V V +  G+R E +   G +H LEH++FKG     A+EIVE IE  GG INA T  E TS
Sbjct: 9   VTVAVNGGARMEDEARSGWSHLLEHLVFKGAGDMGAREIVERIEAEGGSINAATGYERTS 68

Query: 86  YHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEM 145
           +    LK  +PLA++++ D++     +  +IERE++VV +EI  + D   D +       
Sbjct: 69  FDVRALKGSLPLAMQVLSDLVFRPILSSEEIEREKDVVAQEIAEAFDTPDDHVFEMAQTQ 128

Query: 146 VWKDQIIGRPILGKPETISSFTP---EKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVE 202
            +  Q +GRPILG   +I+S  P     +  + +R Y+ D M V   GAVD    ++  E
Sbjct: 129 AFAGQALGRPILG---SIASLAPADRAAVADWRARLYSPDHMVVSVSGAVDEPELLTLAE 185

Query: 203 SYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASIL 262
            +F   +VA   E   PAV+ GGE    R + + +++        +        +   IL
Sbjct: 186 VWFG-QAVAAPHEPTAPAVFTGGEAKLARKIEQANLVFQLPSLGVRDPRQPALRLFTEIL 244

Query: 263 GDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTS-SIVEVVQS 321
           G GM+SRLFQ  RE RGL Y+I A+HE + + GVL + +  A E  + L      E++  
Sbjct: 245 GGGMASRLFQSAREDRGLAYAIDAYHETYDELGVLGVYAGAAAERSLELAELCAAEILDL 304

Query: 322 LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITC 381
             +   + E+ +  A ++A L  + E    R+  ++ Q +  G+ + SE+    I A T 
Sbjct: 305 ADKGPTEAELARAKAVLNASLWMADESPASRSGRLAGQTLAFGAPVSSEESAARIEAQTA 364

Query: 382 EDIVGVAKKIFS-STPTLAILGP 403
           +D+  V + + S      A+LGP
Sbjct: 365 QDLRAVGQAMTSQGLAATAVLGP 387


>gi|73749114|ref|YP_308353.1| M16 family peptidase [Dehalococcoides sp. CBDB1]
 gi|289433090|ref|YP_003462963.1| peptidase M16 domain protein [Dehalococcoides sp. GT]
 gi|73660830|emb|CAI83437.1| peptidase, M16 family [Dehalococcoides sp. CBDB1]
 gi|288946810|gb|ADC74507.1| peptidase M16 domain protein [Dehalococcoides sp. GT]
          Length = 419

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 128/405 (31%), Positives = 203/405 (50%), Gaps = 9/405 (2%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S   SG+ VI+  MP   S  + V I  GSR E+  E G +HF+EHM+F+G+ K    +
Sbjct: 4   LSVLPSGLRVISHHMPASRSVTICVYIGVGSRYEKDCEAGASHFIEHMVFRGSAKYPNSQ 63

Query: 64  IVEE-IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++   IE VGG +NA T  E T Y+A V  +   LAL+++ DML    F+P D+E+ER V
Sbjct: 64  LISSAIEGVGGILNAATDRESTLYYAKVGSDKFALALDVLSDMLVTPVFDPEDLEKERKV 123

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           V EEI MS D+    +     E++W +  +GR I G  ++++    ++++SF+  +Y   
Sbjct: 124 VYEEISMSMDNPSHRVGLLIDEILWPNHPLGRDIAGSRQSVAGLDRQRLLSFMHCHYNPA 183

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY----IQKRDLAEEHM 238
            + V   G + H   VS +   F+      I ++ +P  Y  G      + KRD  + ++
Sbjct: 184 NVVVAVAGDIKHSPAVSAISQAFSGLGGQNIVQTFEP--YHSGNPCPVGVDKRDAEQINL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ML   G        Y  +IL +ILGDGMSSRLF  VR+  GL YS+ +  E   D G   
Sbjct: 242 MLAMPGMNRLDNRRYAFSILNTILGDGMSSRLFAHVRDNLGLAYSVQSGTEFLHDTGAFS 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +A    N+ A   +I+  +++    I   E+ K       ++  + E S   A  I  
Sbjct: 302 IFAAVDPANLTACIEAILSEMEAAKTTITAEELTKAKEMSKGRIQLAMEDSRYMAKWIGS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILG 402
           Q + C  +   E +I  I  +T   ++ +A + F      LA++G
Sbjct: 362 QELLCRRVNTHEDVIRLIDGVTLTSVMELAGEYFRKPEMRLALVG 406


>gi|254303142|ref|ZP_04970500.1| M16B family zinc (Zn2+) peptidase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323334|gb|EDK88584.1| M16B family zinc (Zn2+) peptidase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 408

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 218/395 (55%), Gaps = 6/395 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   I+ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NIKLKKLDNGITLITENLPDISTFSMGFFIKTGAMNETKKESGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           +KEI E ++  GG +NA+TS   T Y+  +L   + +A++++ DML NS+F+   IE+ER
Sbjct: 63  SKEISEFVDFEGGILNAFTSRNMTCYYIKLLSSKIDVAIDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   + +  +  E   +  I    I G   T+     + I++++ ++Y 
Sbjct: 123 NVIIEEIKMYEDIPEEIVHEKNVEYALRG-IHSNSISGTVATLKKIDRKAILNYLEKHYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ + +V  G +D ++   ++         +K KE +    Y   +  +        + L
Sbjct: 182 AENLVIVASGNIDEKYLYKELNKKMKNFRKSK-KEEILDLTYEIKKGKKIVKKPSNQIHL 240

Query: 241 GFN--GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            F   G +  S+  Y   I+++ILG+GMSSRLFQ++RE+RGL YS+  +   F + G+L 
Sbjct: 241 CFTTRGVSSNSKLRYSAAIISNILGEGMSSRLFQKIREERGLAYSVYTYLTRFENCGLLS 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           +   T KE+   +   I E  +++ EN I +RE+ K   K  +    S E +  R   ++
Sbjct: 301 VYVGTTKEDYKDVIKLIKEEFKNIKENGISERELRKAKNKYESAFTFSLESTGSRMNRLA 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
              +  G I+  +K+ + I  +T +DI   A+ +F
Sbjct: 361 SMYVTYGKIISLDKVREDIEKVTLKDIKKAAEFLF 395


>gi|295086073|emb|CBK67596.1| Predicted Zn-dependent peptidases [Bacteroides xylanisolvens XB1A]
          Length = 406

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 124/392 (31%), Positives = 209/392 (53%), Gaps = 13/392 (3%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E      A+    I AG+R+E + E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 10  NGLRIIHEPTLSKVAYCGFAIDAGTRDEAENEQGMAHFVEHLIFKGTEKRKAWHILNRME 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  +A  LKEH+  ALE++GD++ +S+F   +IE+E  V+++EI  
Sbjct: 70  NVGGDLNAYTNKEETVVYAAFLKEHLERALELLGDIVFHSTFPQHEIEKETEVIIDEIQS 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   + +   F +M++++  +GR ILGKPE + SF  E ++SF  R Y    M     
Sbjct: 130 YEDTPSELIFDDFEDMIFRNHPLGRNILGKPELLRSFRTEDVLSFTRRFYQPGNMVFFVQ 189

Query: 190 GAVDHEFCVSQVESY-FNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  D    +  VE Y  ++  V        P +YV       RD  + H+M+G  G  AY
Sbjct: 190 GQYDFRRIIRLVEKYLLDIPDVRVENRRTPPPLYVPEHLTVPRDTHQAHVMIGSRGYNAY 249

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L N+L    G GM+S+L   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 250 DDKRTALYLLNNVLG---GPGMNSKLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGTD 306

Query: 305 KENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            +++   + LT   ++ ++ +     Q    K+  ++  ++  + +     AL ++K  +
Sbjct: 307 VDDMDTCLKLTYKELKRMRDVKMTSSQLAAAKK--QLIGQIGVASDNFENNALGMAKTYL 364

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
                  SE +   I  +T E ++ VA ++F+
Sbjct: 365 HYHKYESSELVFKRIEELTAEQLLEVANEMFA 396


>gi|256379819|ref|YP_003103479.1| peptidase M16 domain protein [Actinosynnema mirum DSM 43827]
 gi|255924122|gb|ACU39633.1| peptidase M16 domain protein [Actinosynnema mirum DSM 43827]
          Length = 461

 Score =  197 bits (501), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 215/417 (51%), Gaps = 24/417 (5%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +   SG+ VITE +P   SA V + ++ GSR+E  E  G AH+LEH+LFKGT +RTA
Sbjct: 37  VRRTLLPSGLRVITEHIPGARSAAVGLWVQVGSRDEAPEVAGAAHYLEHLLFKGTARRTA 96

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I EEI+ VGG++NA+T+ EHT Y+A VL   +PLA++++ D++ ++     D E ER 
Sbjct: 97  AAIAEEIDAVGGELNAFTAKEHTCYYAHVLDSDLPLAVDLVCDVVFDALCEQRDFETERG 156

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F E +     +GR +LG  ++I+    + + +F    Y+ 
Sbjct: 157 VVLEEIAMRDDDPEDLLHDAFLEALMGGHELGRSVLGSEQSITDMDRDALYAFYRGRYSL 216

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGE---------Y 227
             M +   G VDHE  +          +  ++ E +      P    GGE          
Sbjct: 217 PSMVLSAAGNVDHERVLE--------LARERVGERLLDVPGTPVPPRGGEVRVDPVDRLV 268

Query: 228 IQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAH 287
           +   D  + H+MLG           +  N+L + LG GMSSRLFQEVRE+RGL Y + + 
Sbjct: 269 LHSDDTEQAHLMLGVRALDRHDERRFALNVLNAALGGGMSSRLFQEVRERRGLAYQVYSS 328

Query: 288 HENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQ 346
             +++D G   + +    + +  +   I +V+  ++ N +   EI +   ++   ++   
Sbjct: 329 VGSYADTGTWSVYAGCQPDRLGDVAGVIRDVLAEVVANGLTDAEIARAKGQLRGAMVLGL 388

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           E +  R   + K  +  G  L  E+ ++ + A+T  ++  +A ++       A++GP
Sbjct: 389 EDTGSRMSRVGKGELNYGDYLSVEQTLERVDAVTSAEVAELAAELLRRPVAAAVVGP 445


>gi|19704364|ref|NP_603926.1| Zinc protease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|19714616|gb|AAL95225.1| Zinc protease [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
          Length = 408

 Score =  197 bits (501), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 119/394 (30%), Positives = 218/394 (55%), Gaps = 4/394 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   ++ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NIKLKKLDNGITLITEKLPDMSTFSMGFFVKTGAMNETKKESGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS + T Y+  +L   + +A++++ DML NS+F+   IE+ER
Sbjct: 63  AKEISEFVDFEGGILNAFTSRDLTCYYIKLLSSKIDIAIDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   + +  +  E   +  +    I G   ++     + I++++ + Y 
Sbjct: 123 NVIIEEIKMYEDIPEEIVHEKNVEYALRG-VHSNSISGTVASLKKINRKAILNYLEKYYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMM 239
           A+ + +V  G +D ++   ++          K +E +  +  +       +  + + H+ 
Sbjct: 182 AENLVIVASGNIDEKYLYKELNKKMKNFRKTKKEEVLDLSYEIKKGKKVVKKPSNQIHLC 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G + +S   Y   I++++LG+GMSSRLFQ++RE+RGL YS+  +   F + G+L +
Sbjct: 242 FTTRGVSSKSELRYPAAIISNVLGEGMSSRLFQKIREERGLAYSVYTYLTRFENCGLLSV 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
              T KE+   +   I E  +++ EN I +RE+ K   K  +    S E +  R   ++ 
Sbjct: 302 YVGTTKEDYKEVIKLIKEEFKNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLAS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G I+  +K+ + I  +T +DI   A+ +F
Sbjct: 362 TYIIYGKIISLDKVREDIEKVTLKDIKKAAEFLF 395


>gi|300743981|ref|ZP_07073001.1| peptidase, M16 family [Rothia dentocariosa M567]
 gi|300380342|gb|EFJ76905.1| peptidase, M16 family [Rothia dentocariosa M567]
          Length = 443

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 201/406 (49%), Gaps = 23/406 (5%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ VITE MP      +   +  GSR+E     G  HFLEH+LFKGT  RTA
Sbjct: 33  VRRSILPGGVRVITERMPGTRGVSLGFWVGVGSRDEAPGMLGSTHFLEHLLFKGTPSRTA 92

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I +  + VGG+ NA T+ EHT Y+A VL +  P+A++++ DM+SN+  +P  +E+ER 
Sbjct: 93  FDIAQAFDAVGGESNALTAKEHTCYYARVLDDDTPMAVDVLADMVSNALLDPEHLEQERG 152

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D     F E +     +GRPI G P+ I     + +     + YT 
Sbjct: 153 VILEEIAMDQDDPTDVAFENFVEQLMGQNPLGRPIGGTPQEIMQVPRDAVWEHYKQYYTP 212

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF---------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
           DR+ +   G+++H   V+ V              V  V +   +    V     +  ++ 
Sbjct: 213 DRLVISAAGSLEHSHIVNLVLDALTRFGWNLPEGVAPVPRRVRTESGIVPFSKLHEVQKG 272

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + ++++G           Y  ++L+S  G GMSSRLFQE+REKRGL YS  A    +S
Sbjct: 273 FEQTNIVMGCPSIIAGDERRYAMSVLSSAFGSGMSSRLFQEIREKRGLAYSTFAFSGAYS 332

Query: 293 DNGV--LYIASATAKENIMALTSSIVEVVQSLLE-----NIEQREIDKECAKIHAKLIKS 345
           D G   +Y     AK      T  + E++Q   +      I + E+ K   ++    +  
Sbjct: 333 DAGYFGMYAGCLPAK------TEQVCELLQYEFDKLVSAGITEEELSKVRGQLAGSTVLG 386

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI 391
            E S  R   + +  +  G    ++++++ I A+T +D+  +A+ +
Sbjct: 387 SEDSGSRMSRLGRAELDSGKFTSTDELLEKIRAVTLDDVHDLARYL 432


>gi|256027207|ref|ZP_05441041.1| Zinc protease [Fusobacterium sp. D11]
 gi|289765184|ref|ZP_06524562.1| zinc protease [Fusobacterium sp. D11]
 gi|289716739|gb|EFD80751.1| zinc protease [Fusobacterium sp. D11]
          Length = 408

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 219/394 (55%), Gaps = 4/394 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   ++ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NVKLKKLDNGITLITENLPDISTFSMGFFVKTGAMNETKKECGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS E T Y+  +L   + +A++++ DML NS+F+   IE+ER
Sbjct: 63  AKEISEFVDFEGGILNAFTSREMTCYYIKLLSSKIDIAIDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   + +  +  E   +  I    I G   ++     + I++++ ++Y 
Sbjct: 123 NVIIEEIKMYEDIPEEIVHEKNVEYALRG-IHSNSISGTVASLKKIDRKAILNYLEKHYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMM 239
           A+ + +V  G +D ++   ++          K +E +  +  +       +  + + H+ 
Sbjct: 182 AENLVIVASGNIDEKYLYKELNKKMKNFRKTKKEEILDLSYEIKKGKKVVKKPSNQIHLC 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G + +S   Y   I++++LG+GMSSRLFQ++RE+RGL YS+  +   F + G+L +
Sbjct: 242 FTTRGVSSKSNLRYPAAIISNVLGEGMSSRLFQKIREERGLAYSVYTYLTRFENCGLLSV 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
              T KE+   +   I E  +++ EN I +RE+ K   K  +    S E +  R   ++ 
Sbjct: 302 YVGTTKEDYNEVIKLIKEEFKNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLAS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G I+  +K+ + I  +T +DI   A+ +F
Sbjct: 362 TYITYGKIISLDKVREDIEKVTLKDIKKAAEFLF 395


>gi|193213779|ref|YP_001994978.1| processing peptidase [Chloroherpeton thalassium ATCC 35110]
 gi|193087256|gb|ACF12531.1| processing peptidase [Chloroherpeton thalassium ATCC 35110]
          Length = 429

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 222/406 (54%), Gaps = 19/406 (4%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+TVITE +P + S  V +    GSR+E  E +G AHF+EHM+FKGT+KR   +I + +
Sbjct: 26  NGLTVITEHVPGVRSLSVGLWTNTGSRDETPENNGAAHFIEHMVFKGTSKRDYIQISKSL 85

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           E VGG +NA+T+ EHT ++A  L EH+ + ++++ D++   +F   ++E+E++V++EEI 
Sbjct: 86  ESVGGYLNAFTTKEHTCFYARSLAEHLKITIDVLTDLVFRPTFPEEELEKEKDVIIEEIK 145

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
            +ED   D +   F + +++   +G PI G  E++ + T    I+F+   Y  ++M +V 
Sbjct: 146 STEDTPDDLIFDDFDKFLFESHPLGLPIAGTEESVDALTRNDTIAFLKACYRPEKMLLVG 205

Query: 189 VGAVDHEFCVSQVESYFNVCSVAKIKESMKPA--VYVGGEYIQ-----KRDLAEEHMMLG 241
            G + H+  ++     F  C V K K   K     Y  G+Y        + + + H+++ 
Sbjct: 206 TGNLTHDALLN-----FAECFVPKRKTKPKSVRQTYDFGQYQPFTKEIAKPIQQAHILI- 259

Query: 242 FNGCAY--QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
             G  Y    ++++   +L ++LG GMSSRL   +REK GL YS+ +    F +     I
Sbjct: 260 --GAPYIRDDKNYFSAILLNTLLGGGMSSRLNLSLREKHGLVYSVFSSISTFDEINTFSI 317

Query: 300 ASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T K+ +    + I E +  LL +N+ +RE+D   A++   +I  QE    R   +++
Sbjct: 318 YAGTDKDKVKKTVALIHEELGQLLGKNVPKRELDLAKAQLKGAVIMGQESVSKRQSHLAR 377

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
              + G     +++I+ + +++ +DI  VA+++  ++    ++  P
Sbjct: 378 DHYYFGRDFSFDELIEMVESVSAKDIRSVAEQMLDASKFSTLIYQP 423


>gi|311113231|ref|YP_003984453.1| processing peptidase [Rothia dentocariosa ATCC 17931]
 gi|310944725|gb|ADP41019.1| possible processing peptidase [Rothia dentocariosa ATCC 17931]
          Length = 443

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 201/406 (49%), Gaps = 23/406 (5%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ VITE MP      +   +  GSR+E     G  HFLEH+LFKGT  RTA
Sbjct: 33  VRRSILPGGVRVITERMPGTRGVSLGFWVGVGSRDEAPGMLGSTHFLEHLLFKGTPSRTA 92

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I +  + VGG+ NA T+ EHT Y+A VL +  P+A++++ DM+SN+  +P  +E+ER 
Sbjct: 93  FDIAQAFDAVGGESNALTAKEHTCYYARVLDDDTPMAVDVLADMVSNALLDPEHLEQERG 152

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D     F E +     +GRPI G P+ I     + +     + YT 
Sbjct: 153 VILEEIAMDQDDPTDVAFENFVEQLMGQNPLGRPIGGTPQEIMQVPRDAVWEHYKKYYTP 212

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF---------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
           DR+ +   G+++H   V+ V              V  V +   +    V     +  ++ 
Sbjct: 213 DRLVISAAGSLEHSHIVNLVLDALTRYGWNLLEGVVPVPRRVRTESGIVPFSKLHEVQKG 272

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + ++++G           Y  ++L+S  G GMSSRLFQE+REKRGL YS  A    +S
Sbjct: 273 FEQTNIVMGCPSIIAGDERRYAMSVLSSAFGSGMSSRLFQEIREKRGLAYSTFAFSGAYS 332

Query: 293 DNGV--LYIASATAKENIMALTSSIVEVVQSLLE-----NIEQREIDKECAKIHAKLIKS 345
           D G   +Y     AK      T  + E++Q   +      I + E+ K   ++    +  
Sbjct: 333 DAGYFGMYAGCLPAK------TEQVCELLQYEFDKLVSAGITEEELSKVRGQLAGSTVLG 386

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI 391
            E S  R   + +  +  G    ++++++ I A+T +D+  +A+ +
Sbjct: 387 SEDSGSRMSRLGRAELDSGKFTSTDELLEKIRAVTLDDVHDLARYL 432


>gi|147669876|ref|YP_001214694.1| peptidase M16 domain-containing protein [Dehalococcoides sp. BAV1]
 gi|146270824|gb|ABQ17816.1| peptidase M16 domain protein [Dehalococcoides sp. BAV1]
          Length = 419

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 128/405 (31%), Positives = 203/405 (50%), Gaps = 9/405 (2%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S   SG+ VI+  MP   S  + V I  GSR E+  E G +HF+EHM+F+G+ K    +
Sbjct: 4   LSVLPSGLRVISYHMPASRSVTICVYIGVGSRYEKDCEAGASHFIEHMVFRGSAKYPNSQ 63

Query: 64  IVEE-IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++   IE VGG +NA T  E T Y+A V  +   LAL+++ DML    F+P D+E+ER V
Sbjct: 64  LISSAIEGVGGILNAATDRESTLYYAKVGSDKFALALDVLSDMLVTPVFDPEDLEKERKV 123

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           V EEI MS D+    +     E++W +  +GR I G  ++++    ++++SF+  +Y   
Sbjct: 124 VYEEISMSMDNPSHRVGLLIDEILWPNHPLGRDIAGSRQSVAGLDRQRLLSFMHCHYNPA 183

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY----IQKRDLAEEHM 238
            + V   G + H   VS +   F+      I ++ +P  Y  G      + KRD  + ++
Sbjct: 184 NVVVAVAGDIKHAPAVSAISQAFSGLGGQNIVQTFEP--YHSGNPCPVGVDKRDAEQINL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ML   G        Y  +IL +ILGDGMSSRLF  VR+  GL YS+ +  E   D G   
Sbjct: 242 MLAMPGMNRLDNRRYAFSILNTILGDGMSSRLFAHVRDNLGLAYSVQSGTEFLHDTGAFS 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +A    N+ A   +I+  +++    I   E+ K       ++  + E S   A  I  
Sbjct: 302 IFAAVDPANLTACIEAILSEMEAAKTTITAEELTKAKEMSKGRIQLAMEDSRYMAKWIGS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILG 402
           Q + C  +   E +I  I  +T   ++ +A + F      LA++G
Sbjct: 362 QELLCRRVNTHEDVIRLIDGVTLTSVMELAGEYFRKPEMRLALVG 406


>gi|296327424|ref|ZP_06869971.1| M16 family peptidase [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
 gi|296155437|gb|EFG96207.1| M16 family peptidase [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
          Length = 408

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 119/394 (30%), Positives = 218/394 (55%), Gaps = 4/394 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+++ K  +GIT+ITE +P  S F +   ++ G+ NE ++E G++HF+EH++FKGT  RT
Sbjct: 3   NIKLKKLDNGITLITEKLPDMSTFSMGFFVKTGAMNETKKESGISHFIEHLMFKGTKNRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEI E ++  GG +NA+TS + T Y+  +L   + +A++++ DML NS+F+   IE+ER
Sbjct: 63  AKEISEFVDFEGGILNAFTSRDLTCYYIKLLSSKIDIAIDVLTDMLLNSNFDEESIEKER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   + +  +  E   +  +    I G   ++     + I++++ + Y 
Sbjct: 123 NVIIEEIKMYEDIPEEIVHEKNVEYALRG-VHSNSISGTVASLKKIDRKAILNYLEKYYV 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMM 239
           A+ + +V  G +D ++   ++          K +E +  +  +       +  + + H+ 
Sbjct: 182 AENLVIVASGNIDEKYLYKELNKKMKNFRKTKKEEVLDLSYEIKKGKKVVKKPSNQIHLC 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G + +S   Y   I++++LG+GMSSRLFQ++RE+RGL YS+  +   F + G+L +
Sbjct: 242 FTTRGVSSKSELRYPAAIISNVLGEGMSSRLFQKIREERGLAYSVYTYLTRFENCGLLSV 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
              T KE+   +   I E  +++ EN I +RE+ K   K  +    S E +  R   ++ 
Sbjct: 302 YVGTTKEDYKEVIKLIKEEFKNIKENGISERELRKAKNKYESAFTFSLESTSSRMNRLAS 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF 392
             +  G I+  +K+ + I  +T +DI   A+ +F
Sbjct: 362 TYIIYGKIISLDKVREDIEKVTLKDIKKAAEFLF 395


>gi|298483826|ref|ZP_07001998.1| peptidase, M16 family [Bacteroides sp. D22]
 gi|298270013|gb|EFI11602.1| peptidase, M16 family [Bacteroides sp. D22]
          Length = 406

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 123/392 (31%), Positives = 210/392 (53%), Gaps = 13/392 (3%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E      A+    I AG+R+E + E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 10  NGLRIIHEPTLSKVAYCGFAIDAGTRDEAENEQGMAHFVEHLIFKGTEKRKAWHILNRME 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  +A  LKEH+  ALE++GD++ +S+F   +IE+E  V+++EI  
Sbjct: 70  NVGGDLNAYTNKEETVVYAAFLKEHLERALELLGDIVFHSTFPQHEIEKETEVIIDEIQS 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   + +   F +M++++  +GR ILGKPE + SF  E ++SF  R Y    M     
Sbjct: 130 YEDTPSELIFDDFEDMIFRNHPLGRNILGKPELLRSFRTEDVLSFTRRFYQPGNMVFFVQ 189

Query: 190 GAVDHEFCVSQVESYF-NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  D +  +  VE Y  ++  V        P +Y+       RD  + H+M+G  G  AY
Sbjct: 190 GQYDFKKIIRLVEKYLSDIPDVRVENRRTPPPLYMPEHLTVSRDTHQAHVMMGSRGYNAY 249

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L N+L    G GM+S+L   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 250 DDKRTALYLLNNVLG---GPGMNSKLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGTD 306

Query: 305 KENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            +++   + LT   ++ ++ +     Q    K+  ++  ++  + +     AL ++K  +
Sbjct: 307 VDDMDTCLKLTYKELKRMRDVKMTSSQLAAAKK--QLIGQIGVASDNFENNALGMAKTYL 364

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
                  SE +   I  +T E ++ VA ++F+
Sbjct: 365 HYHKYESSELVFKRIEELTAEQLLEVANEMFA 396


>gi|239917239|ref|YP_002956797.1| predicted Zn-dependent peptidase [Micrococcus luteus NCTC 2665]
 gi|281414286|ref|ZP_06246028.1| predicted Zn-dependent peptidase [Micrococcus luteus NCTC 2665]
 gi|239838446|gb|ACS30243.1| predicted Zn-dependent peptidase [Micrococcus luteus NCTC 2665]
          Length = 439

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 114/357 (31%), Positives = 190/357 (53%), Gaps = 24/357 (6%)

Query: 3   LRISKTSSGITVITEVMPIDSAFVKVN--IRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           +R S    G+ V+TE MP D   V +   +  GSR+E  E  G  HFLEH+LFKGT  RT
Sbjct: 24  VRRSVLPGGVRVLTEAMP-DQRSVTIGYWVAVGSRDESPEGFGATHFLEHLLFKGTPTRT 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I    ++VGG+ NA T+ E T YHA VL E +P+A+E++ DML++S  +P ++E ER
Sbjct: 83  AMDIAAAFDRVGGESNAGTAKESTVYHARVLDEDLPMAVEVLTDMLTSSLIDPDELETER 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M  DD  D    + +E++     +GRPI G PETI + T + ++   +  Y 
Sbjct: 143 GVILEELAMDADDPVDVAHEKLAEVMLDGHPLGRPIGGTPETIRAVTRDHVVGHYTHWYR 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA--------------VYVGGE 226
            D + V   G +DH+     V +     S  ++     PA              V  G  
Sbjct: 203 PDELVVTAAGHLDHDEVCRLVLAALR-ASGWELTPGALPAPRRAVDTAGAAASRVRTGTH 261

Query: 227 YIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISA 286
            + K  + + ++++G    +    D +   ++ S+LG GMSSRLFQE+RE+RGL Y+  +
Sbjct: 262 TVTKA-VEQANVLVGGRSLSTTDPDRFALGVMQSVLGGGMSSRLFQEIRERRGLAYNTYS 320

Query: 287 HHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREI-DKECAKIHAKL 342
               +SD G   + +    + +      +  ++++ L+ + + ++ ++E A+ H ++
Sbjct: 321 FSAGYSDAGYWGLYAGCQPDRV----EEVAALMEAELDRMAEADVTEEELARAHGQI 373


>gi|53711465|ref|YP_097457.1| putative zinc protease YmxG [Bacteroides fragilis YCH46]
 gi|52214330|dbj|BAD46923.1| putative zinc protease YmxG [Bacteroides fragilis YCH46]
 gi|301161197|emb|CBW20735.1| putative peptidase [Bacteroides fragilis 638R]
          Length = 415

 Score =  196 bits (499), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 215/401 (53%), Gaps = 13/401 (3%)

Query: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           M   I   S+G+ +I E      A+    + AG+R+E + E GMAHF+EH++FKGT KR 
Sbjct: 10  MQYNIHTLSNGLRIIHEPSSSKVAYCGFAVDAGTRDEAENEQGMAHFVEHLIFKGTRKRK 69

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I+  +E VGGD+NAYT+ E T  ++  L EH   ALE++ D++ +S+F  ++IE+E 
Sbjct: 70  AWHILNRMENVGGDLNAYTNKEETVIYSAFLTEHFGRALELLADIVFHSTFPQNEIEKET 129

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   ED   + +   F +M++++  +GR ILG+P+ +  F  E  ++F SR Y 
Sbjct: 130 EVIIDEIQSYEDTPSELIFDDFEDMIFRNHPLGRNILGRPDLLKKFRSEDAMAFTSRFYQ 189

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK-PAVYVGGEYIQKRDLAEEHMM 239
              M    +G  + +  V QVE       +  ++     P +YV  + +  ++  + H+M
Sbjct: 190 PSNMVFFVLGDFNFQKIVRQVEKLLVDLPLVTVENQRTIPPLYVPEQLVVHKETHQAHVM 249

Query: 240 LGFNGC-AYQSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
           +G  G  AY  +    + L NIL    G GM+SRL   +RE+RGL Y++ ++  +++D G
Sbjct: 250 IGSRGYNAYDDKRTALYLLNNILG---GPGMNSRLNVSLRERRGLVYTVESNLTSYTDTG 306

Query: 296 VLYIASATAKENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
              I   T  E++   + LT   ++ ++ +     Q    K+  ++  ++  + + +   
Sbjct: 307 AFCIYFGTDPEDVDTCLKLTYKELKRMRDVKMTSSQLMAAKK--QLIGQIGVASDNNENN 364

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
           AL ++K  +       SE +   I A+T E ++ VA ++F+
Sbjct: 365 ALGMAKTFLHYNKYESSESVFRRIEALTAEGLLEVANEMFA 405


>gi|60679735|ref|YP_209879.1| putative peptidase [Bacteroides fragilis NCTC 9343]
 gi|253564473|ref|ZP_04841930.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|265764864|ref|ZP_06093139.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|60491169|emb|CAH05917.1| putative peptidase [Bacteroides fragilis NCTC 9343]
 gi|251948249|gb|EES88531.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|263254248|gb|EEZ25682.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 406

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 215/401 (53%), Gaps = 13/401 (3%)

Query: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           M   I   S+G+ +I E      A+    + AG+R+E + E GMAHF+EH++FKGT KR 
Sbjct: 1   MQYNIHTLSNGLRIIHEPSSSKVAYCGFAVDAGTRDEAENEQGMAHFVEHLIFKGTRKRK 60

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I+  +E VGGD+NAYT+ E T  ++  L EH   ALE++ D++ +S+F  ++IE+E 
Sbjct: 61  AWHILNRMENVGGDLNAYTNKEETVIYSAFLTEHFGRALELLADIVFHSTFPQNEIEKET 120

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   ED   + +   F +M++++  +GR ILG+P+ +  F  E  ++F SR Y 
Sbjct: 121 EVIIDEIQSYEDTPSELIFDDFEDMIFRNHPLGRNILGRPDLLKKFRSEDAMAFTSRFYQ 180

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK-PAVYVGGEYIQKRDLAEEHMM 239
              M    +G  + +  V QVE       +  ++     P +YV  + +  ++  + H+M
Sbjct: 181 PSNMVFFVLGDFNFQKIVRQVEKLLVDLPLVTVENQRTIPPLYVPEQLVVHKETHQAHVM 240

Query: 240 LGFNGC-AYQSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
           +G  G  AY  +    + L NIL    G GM+SRL   +RE+RGL Y++ ++  +++D G
Sbjct: 241 IGSRGYNAYDDKRTALYLLNNILG---GPGMNSRLNVSLRERRGLVYTVESNLTSYTDTG 297

Query: 296 VLYIASATAKENI---MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
              I   T  E++   + LT   ++ ++ +     Q    K+  ++  ++  + + +   
Sbjct: 298 AFCIYFGTDPEDVDTCLKLTYKELKRMRDVKMTSSQLMAAKK--QLIGQIGVASDNNENN 355

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
           AL ++K  +       SE +   I A+T E ++ VA ++F+
Sbjct: 356 ALGMAKTFLHYNKYESSESVFRRIEALTAEGLLEVANEMFA 396


>gi|164688509|ref|ZP_02212537.1| hypothetical protein CLOBAR_02154 [Clostridium bartlettii DSM
           16795]
 gi|164602922|gb|EDQ96387.1| hypothetical protein CLOBAR_02154 [Clostridium bartlettii DSM
           16795]
          Length = 413

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 117/407 (28%), Positives = 224/407 (55%), Gaps = 12/407 (2%)

Query: 10  SGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEI 68
           +G+T+I E +P + S  + + ++AGS  E +E  G++HF+EHMLFKGT  R++KE+  EI
Sbjct: 9   NGLTIIGEEIPYLKSISLGIWVKAGSIIETKENSGVSHFIEHMLFKGTKNRSSKELAREI 68

Query: 69  EKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIG 128
           + +GG +NA+TS E T ++  +L EH+ + +E++ DM+ NS F+  DIE+E++V+LEE+ 
Sbjct: 69  DNLGGILNAFTSKECTCFYVKLLDEHIDIGIEVLSDMILNSCFDKKDIEKEKSVILEELK 128

Query: 129 MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVC 188
           M ED   D       E ++KD  +G  ILG   T+ +F  E I+ + ++ Y  +   +  
Sbjct: 129 MYEDSPDDLSYDLLLENIYKDHSLGMNILGDRNTLKNFKRENILDYYNKYYVPNNSVISI 188

Query: 189 VGAVDHEFCVSQVESYFNV-----CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
            G  + E  V +++  F        S+   +    P +    + I++ +LA     +   
Sbjct: 189 CGNFNFEEIVEKIKDKFKTWEAKEASINTTEPKFNPCIIKKNKDIEQVNLAINLKAIPM- 247

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
                 R+ Y  +++ ++ G  +SSRLFQ++RE++GL YSI +    + + G L I ++T
Sbjct: 248 ---INDREVYALSVVNNVFGGSISSRLFQKIREEKGLVYSIYSSQTLYQECGELGIFAST 304

Query: 304 AKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           + EN+  +   I++ +  +  E I  +EI +   ++    +  +E +  R +   K ++ 
Sbjct: 305 SNENVEEVYKLILDEIDLIRNEYISLQEIHESKEQLKGSYMLDRESTSSRMMSNGKNLLM 364

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGPPMDHV 408
              +   + IID I+ +  +D+V + +K+F+     + I+G  ++++
Sbjct: 365 RNKVDDEQDIIDYINNVEYQDVVEIIEKVFNKENIGVCIVGKDVENI 411


>gi|270308593|ref|YP_003330651.1| peptidase, M16 family [Dehalococcoides sp. VS]
 gi|270154485|gb|ACZ62323.1| peptidase, M16 family [Dehalococcoides sp. VS]
          Length = 419

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 203/407 (49%), Gaps = 11/407 (2%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S   SG+ VI+  MP   S  + V I  GSR E   E G +HF+EHM+F+G+ K    +
Sbjct: 4   LSVLPSGLRVISHHMPASRSVTICVYIGVGSRYETDCEAGASHFIEHMVFRGSKKYPDSQ 63

Query: 64  IVEE-IEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++   IE VGG +NA T  E T Y+A V  +   LAL+++ DML    FNP D+E+ER V
Sbjct: 64  LISSAIEGVGGILNAATDRESTLYYAKVGSDKFALALDVLSDMLVTPLFNPEDLEKERKV 123

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           + EEI MS D+    +     E++W D  +GR I G  ++++    +K+ +F+  +Y   
Sbjct: 124 IYEEISMSLDNPSHRVGLLLDEILWPDHPLGRDIAGTRQSVAGLDKQKLQAFMHSHYNPA 183

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVY-----VGGEYIQKRDLAEEH 237
            + V   G + H+  V+ +   F+        +S  P  Y     +G   + KRD  + +
Sbjct: 184 NIVVAVAGDIKHKSAVAAISQAFSGLRGKNEIQSFAPYHYGNPCQIG---VDKRDAEQIN 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +M+   G        Y  +IL +ILGDGMSSRLF  VR+  GL YS+ +  E   D G  
Sbjct: 241 LMIAMPGMNRLDDCRYAFSILNTILGDGMSSRLFAHVRDNLGLAYSVQSGTEFLHDTGAF 300

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I +A    N+ A   +I+  ++S    I   E+ K       ++  + E S   A  I 
Sbjct: 301 SIYAAVDPANLTACVEAILTELESAKTTITAEELTKAKEMSKGRIHLAMEDSRYMAKWIG 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
            Q + C  +   E +I  I  ++ + ++ +A + F      LA++GP
Sbjct: 361 SQELLCRRVNTHEDVIRLIDEVSLKAVMELAGEYFRKPEMRLALVGP 407


>gi|206890752|ref|YP_002249619.1| peptidase, M16 family [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742690|gb|ACI21747.1| peptidase, M16 family [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 411

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 224/407 (55%), Gaps = 15/407 (3%)

Query: 5   ISKT--SSGITVITEVMPIDSAFV-KVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           I KT  SS + VI   M    +FV  + I+ G+R+E   ++G++HF+EH+ F+GT+KR A
Sbjct: 2   IKKTYLSSNLPVIMNKMNYYRSFVLGIWIKHGARHESSSKNGLSHFIEHLFFQGTSKRNA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I  EI+ +GGDINA+TS E T+ +  VL   +  A+E+IGD+ SN  F   +IE+ER+
Sbjct: 62  RDISFEIDSMGGDINAFTSREFTALYIKVLDSSICKAIELIGDIYSNPLFPEQEIEKERS 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EI    D   + +   F E  + D  +G+PILGK  T+S  T + II   +  Y  
Sbjct: 122 VILDEIRTINDTPDELIHDLFMENSFPDG-LGQPILGKESTVSEITRKDIIDCYNNFYGI 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY-----IQKRDLAEE 236
           +   + C G  + +  +  +E   N+ +    K S K  V     +     + ++DL E 
Sbjct: 181 NNCIISCAGNFEEKKLIECLEK--NITA----KTSNKSPVINNANFSSCLKVHEKDLNEI 234

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ +GF+   ++S   +   +L  I+G  +SSRLFQE+REK+G  Y+I +    + D GV
Sbjct: 235 HLCIGFDTFPFKSPYRHALTLLNCIIGGSVSSRLFQEIREKQGWVYNIYSFTSFYYDAGV 294

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
             I +A  ++ I  +  +I ++++ + EN+++ E+D+   ++ ++++ S E        +
Sbjct: 295 FGIYTACDRKKINKIIETIFKILKQIPENLKKEEMDRAKTQVISQILFSSESPSSIMHNL 354

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           + Q ++       E+ I  I  ++ +++  +A  +     ++ ILGP
Sbjct: 355 AYQELYLEESYSIEQQIKQIETVSFKELKNIASILKEKNFSITILGP 401


>gi|225452974|ref|XP_002284370.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 523

 Score =  196 bits (497), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 220/419 (52%), Gaps = 23/419 (5%)

Query: 4   RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE  +   +A V V I AGSR E  E +G AHFLEHM+FKGT +RTA+
Sbjct: 90  RVTTLPNGLRVATESNLAARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTAQRTAR 149

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A V+ + VP AL+I+ D+L NS F+ + I RER+V
Sbjct: 150 DLEEEIENMGGHLNAYTSREQTTYYAKVMDKDVPKALDILSDILQNSKFDENRINRERDV 209

Query: 123 VLEEI----GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           +L E+    G +E+  +D L A      ++   +GR ILG  + I + T   + +++S +
Sbjct: 210 ILREMEEVEGQTEEVIFDHLHA----TAFQYTPLGRTILGPAQNIKTITKAHLQNYISTH 265

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM----KPAVYVGGEY-IQKRDL 233
           YTA RM +   GAV HE  V QV+  F   S      S     +PA++ G E  +   D+
Sbjct: 266 YTAPRMVIAASGAVKHEDIVEQVKKLFTKLSTDPTTASQLVVEQPAIFTGSEVRMIDDDI 325

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGD-----GMSSRLFQEVREKRG---LCYSIS 285
                 + FNG ++   D     ++ S+LG      G    +  E+ ++ G   +  S+ 
Sbjct: 326 PLAQFAVAFNGASWTDPDSIALMVMQSMLGSWNKNAGGGKHMGSELAQRVGINEIAESMM 385

Query: 286 AHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKS 345
           A + N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + L+  
Sbjct: 386 AFNTNYKDTGLFGVYAIAKPDCLDDLAYAIMYEISKLCYRVSEADVTRARNQLKSSLLLH 445

Query: 346 QERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGP 403
            + +   A +I +Q++  G  +   ++   I A+    +  VA + IF     +A +GP
Sbjct: 446 IDGTSPVAEDIGRQLLTYGRRIPFAELFARIDAVDASTVKRVANRFIFDRDVAIAAMGP 504


>gi|160882950|ref|ZP_02063953.1| hypothetical protein BACOVA_00912 [Bacteroides ovatus ATCC 8483]
 gi|237720579|ref|ZP_04551060.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|260172620|ref|ZP_05759032.1| putative zinc protease ymxG [Bacteroides sp. D2]
 gi|299146930|ref|ZP_07039997.1| peptidase, M16 family [Bacteroides sp. 3_1_23]
 gi|315920910|ref|ZP_07917150.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156111633|gb|EDO13378.1| hypothetical protein BACOVA_00912 [Bacteroides ovatus ATCC 8483]
 gi|229450330|gb|EEO56121.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|298514815|gb|EFI38697.1| peptidase, M16 family [Bacteroides sp. 3_1_23]
 gi|313694785|gb|EFS31620.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 406

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 206/393 (52%), Gaps = 15/393 (3%)

Query: 10  SGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIE 69
           +G+ +I E      A+    I AG+R+E + E GMAHF+EH++FKGT KR A  I+  +E
Sbjct: 10  NGLRIIHEPTLSKVAYCGFAIDAGTRDEAENEQGMAHFVEHLIFKGTEKRKAWHILNRME 69

Query: 70  KVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGM 129
            VGGD+NAYT+ E T  +A  LKEH+  ALE++GD++ +S+F   +IE+E  V+++EI  
Sbjct: 70  NVGGDLNAYTNKEETVVYAAFLKEHLERALELLGDIVFHSTFPQHEIEKETEVIIDEIQS 129

Query: 130 SEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCV 189
            ED   + +   F +M++++  +GR ILGKPE + SF  E ++SF  R Y    M     
Sbjct: 130 YEDTPSELIFDDFEDMIFRNHPLGRNILGKPELLRSFRTEDVLSFTRRFYQPGNMVFFVQ 189

Query: 190 GAVDHEFCVSQVESY-FNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC-AY 247
           G  + +  +  VE Y  ++  V        P +YV       RD  + H+M+G  G  AY
Sbjct: 190 GQYEFKRIIRLVEKYLLDIPDVKVENRRTPPPLYVPEHLTVARDTHQAHVMIGSRGYNAY 249

Query: 248 QSRD---FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +    + L N+L    G GM+S+L   +RE+RGL Y++ ++  +++D G   I   T 
Sbjct: 250 DDKRTALYLLNNVLG---GPGMNSKLNVSLRERRGLVYNVESNLTSYTDTGAFCIYFGT- 305

Query: 305 KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIK----SQERSYLRALEISKQV 360
             ++  + + +    + L    + +    + A    +LI     + +     AL ++K  
Sbjct: 306 --DVDDMDTCLKLTYKELKRMRDTKMTSSQLAAAKKQLIGQIGVASDNFENNALGMAKTF 363

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS 393
           +       SE +   I  +T E ++ VA ++F+
Sbjct: 364 LHYHKYESSELVFKRIEELTAEMLLEVANEMFA 396


>gi|12802327|gb|AAK07827.1|AF297643_1 mitochondrial processing peptidase beta subunit [Cucumis melo]
          Length = 528

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/420 (31%), Positives = 218/420 (51%), Gaps = 25/420 (5%)

Query: 4   RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++  S+G+ V TE  +   +A V V I AGSR E +E +G AHFLEHM+FKGT KR+A+
Sbjct: 95  RVTTLSNGLRVATESNLAARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEKRSAR 154

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VL + VP AL+I+ D+L NS F+   I RER+V
Sbjct: 155 QLEEEIENMGGHLNAYTSREQTTYYAKVLDKDVPKALDILADILQNSKFDEHRISRERDV 214

Query: 123 VLEEI----GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           +L E+    G +E+  +D L A      ++   +GR ILG  + I + T + + S++  +
Sbjct: 215 ILREMEEVEGQTEEVIFDHLHA----TAFQYTPLGRTILGPAQNIRTITKDHLQSYIQTH 270

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM----KPAVYVGGEY-IQKRDL 233
           YTA RM +   GAV HE  V QV+  F   S      +     +PA++ G E  I   D+
Sbjct: 271 YTAPRMVIAASGAVKHEDFVEQVKKLFTKLSAEPTTAAQLVAKEPAIFTGSEVRIVDDDV 330

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDG---------MSSRLFQEVREKRGLCYSI 284
                 + FNG ++   D     ++ ++LG           M S L Q V     +  S+
Sbjct: 331 PLAQFAIAFNGASWTDPDSIALMVMQAMLGSWNKSAGGGKHMGSELAQRVAINE-VAESM 389

Query: 285 SAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIK 344
            A + N+ D G+  + +    + +  L  +I+     L   + + ++ +   ++ + L+ 
Sbjct: 390 MAFNTNYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLL 449

Query: 345 SQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGP 403
             + +   A +I +Q++  G  +   ++   I A+    I  VA + I+     +A LGP
Sbjct: 450 HIDGTSPVAEDIGRQLLTYGRRIPFAELFARIDAVDASTIKRVANRFIYDRDIAIAALGP 509


>gi|147765656|emb|CAN71501.1| hypothetical protein VITISV_006460 [Vitis vinifera]
          Length = 523

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 220/419 (52%), Gaps = 23/419 (5%)

Query: 4   RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE  +   +A V V I AGSR E  E +G AHFLEHM+FKGT +RTA+
Sbjct: 90  RVTTLPNGLRVATESNLAARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTAQRTAR 149

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A V+ + VP AL+I+ D+L NS F+ + I RER+V
Sbjct: 150 DLEEEIENMGGHLNAYTSREQTTYYAKVMDKDVPKALDILSDILQNSKFDENRINRERDV 209

Query: 123 VLEEI----GMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           +L E+    G +E+  +D L A      ++   +GR ILG  + I + T   + +++S +
Sbjct: 210 ILREMEEVEGQTEEVIFDHLHA----TAFQYTPLGRTILGPAQNIKTITKAHLQNYISTH 265

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM----KPAVYVGGEY-IQKRDL 233