PSIBLAST alignment of GI: 254780464 and protein with PDB id: 3cwb

>gi|196049775|pdb|3CWB|A Chain A, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-D Length = 446
>gi|196049785|pdb|3CWB|N Chain N, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-D Length = 446
 Score =  187 bits (473), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 87/432 (20%), Positives = 176/432 (40%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   +G+ V +E     +  V V I AGSR E ++ +G  +F+EH+ FKGT KR    
Sbjct: 15  NVTTLDNGLRVASEESSQPTCTVGVWIGAGSRYENEKNNGAGYFVEHLAFKGTKKRPCAA 74

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
             +E+E +G   N YTS E T+++   L + +P  +E++ D++ N +   S IE+ER V+
Sbjct: 75  FEKEVESMGAHFNGYTSREQTAFYIKALSKDMPKVVELLADVVQNCALEESQIEKERGVI 134

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E+   ++D  +          ++   + R + G  E I   T   + S++  ++ A R
Sbjct: 135 LQELKEMDNDMTNVTFDYLHATAFQGTALARTVEGTTENIKHLTRADLASYIDTHFKAPR 194

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G + H+  V     +F           +    +          +   L   H+ 
Sbjct: 195 MVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARDDALPVAHVA 254

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENF 291
           L   G  +   D  + ++  +I+G    +    +           +  LC+S    + ++
Sbjct: 255 LAVEGPGWADPDNVVLHVANAIIGRYDRTFGGGKHLSSRLAALAVEHKLCHSFQTFNTSY 314

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+          +I  +          L  +  + E+ +    + + ++   + +  
Sbjct: 315 SDTGLFGFHFVADPLSIDDMMFCAQGEWMRLCTSTTESEVKRAKNHLRSAMVAQLDGTTP 374

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
               I   ++  G  +  E+    ISA+    +  V  K      P LA +GP ++ +  
Sbjct: 375 VCETIGSHLLNYGRRISLEEWDSRISAVDARMVRDVCSKYIYDKCPALAAVGP-IEQLLD 433

Query: 411 TSELIHALEGFR 422
            + +   +   R
Sbjct: 434 YNRIRSGMYWIR 445