PSIBLAST alignment of GI: 254780464 and protein with PDB id: 3cwb

>gi|196049776|pdb|3CWB|B Chain B, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-D Length = 441
>gi|196049786|pdb|3CWB|O Chain O, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-D Length = 441
 Score =  125 bits (313), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 73/418 (17%), Positives = 154/418 (36%), Gaps = 6/418 (1%)

Query: 2   NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +L I+K  +G+ + +      ++ + V I+AGSR E     G AH L       T   ++
Sbjct: 25  DLEITKLPNGLIIASLENFSPASRIGVFIKAGSRYETTANLGTAHLLRLASPLTTKGASS 84

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I   IE VGG ++ Y++ E  +Y    L++HV   +E + ++ +   F P ++   + 
Sbjct: 85  FRITRGIEAVGGSLSVYSTREKMTYCVECLRDHVDTVMEYLLNVTTAPEFRPWEVTDLQP 144

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWK----DQIIGRPILGKPETISSFTPEKIISFVSR 177
            +  +  ++       +        +K    + +          T          +F S 
Sbjct: 145 QLKVDKAVAFQSPQVGVLENLHAAAYKTALANPLYCPDYRIGKITSEQLHHFVQNNFTSA 204

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
                 + V              + S     S        +     G   +    + E  
Sbjct: 205 RMALVGIGVKHSDLKQVAEQFLNIRSGAGTSSAKATYWGGEIREQNGHSLVHAAVVTEGA 264

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
            +      A+      L        G  ++S+L+Q V +     +  SA + N+SD+G+ 
Sbjct: 265 AVGSAEANAFSVLQHVLGAGPLIKRGSSVTSKLYQGVAKATTQPFDASAFNVNYSDSGLF 324

Query: 298 YIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
              + +   +   +  + +  +++  +  + + ++ K   ++ A  + S E +     EI
Sbjct: 325 GFYTISQAAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEI 384

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
             + +  G+      +   I ++T  D+V  AKK  S   ++A  G  +   P   EL
Sbjct: 385 GSEALLSGTHTAPSVVAQKIDSVTSADVVNAAKKFVSGKKSMAASG-DLGSTPFLDEL 441