PSIBLAST alignment of GI: 254780464 and protein with PDB id: 3go9

>gi|226438337|pdb|3GO9|A Chain A, Predicted Insulinase Family Protease From Yersinia Pestis Length = 492
 Score = 56.5 bits (134), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 49/439 (11%), Positives = 119/439 (27%), Gaps = 22/439 (5%)

Query: 4   RISKTSSGIT---VITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           +  K  +G +   + T   P D   +++ +  GS +E  +E G AH L  +    +   T
Sbjct: 27  QQGKLDNGFSWQLLATPQRPSDRIELRLIVNTGSLSENTQEVGFAHLLPRLALXSSASFT 86

Query: 61  AKEIVEEIEKVGGDIN-----AYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSD 115
             ++    ++ G D       A TS + T Y   +      L  + +  +   +      
Sbjct: 87  PAQLQSLWQQ-GIDNERPLPPAITSYDFTLYSLSLPNNRPDLLKDALAWLSDTAGNLAVS 145

Query: 116 IERERNVVLEEIGMSEDDSWDFLDARFSEM-VWKDQIIGRPILGKPETISSFTPEKIISF 174
            +     +            +  +  +         I   P     + +     ++    
Sbjct: 146 EQTVNAALNTATDPIATFPQNIQEPWWRYRLKGSSLIGHDPGQPVTQPVDVEKLKQFYQQ 205

Query: 175 VSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLA 234
                      V  V +      +S+  S       A    +    +      +     A
Sbjct: 206 WYTPDAXTLYVVGNVDSRSIAAQISKAFSELKGKRTAPAAVATLAPLPPEPVSLXNEQAA 265

Query: 235 EEH--MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           ++   +         Q          + +  + +   + Q + +       +        
Sbjct: 266 QDTLSLXWDTPWHPIQDSXALSRYWRSDLAREALFWHIKQVLEKNNQKNLKLGFDCRVQY 325

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLI------KSQ 346
                 I   T  EN+ A  + +   + +L  N   +             +       ++
Sbjct: 326 QRAQCAIHLNTPVENLTANXTFVARELAALRANGLSQAEFDALXTQKNDQLSKLFATYAR 385

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDT----ISAITCEDIVGVAKKIFSSTPTLAILG 402
             + +   +  +        +  E+        +S +T  ++    K+  S   TL +  
Sbjct: 386 TDTDILXSQRLRSQQSGVVDIAPEQYQKLRQAFLSGLTLAELNRELKQQLSQDTTLVLXQ 445

Query: 403 PPMDHVPTTSELIHALEGF 421
           P  +       L     G 
Sbjct: 446 PKGEPEVNVKALQEIYNGI 464