PSIBLAST alignment of GI: 254780464 and protein with PDB id: 3hgz

>gi|270346544|pdb|3HGZ|A Chain A, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amylin Length = 969
>gi|270346545|pdb|3HGZ|B Chain B, Crystal Structure Of Human Insulin-Degrading Enzyme In Complex With Amylin Length = 969
 Score = 99.6 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 66/131 (50%), Gaps = 2/131 (1%)

Query: 8   TSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK-EIV 65
            ++GI V+    P  D +   +++  GS ++     G++HFL+HMLF GT K   + E  
Sbjct: 27  LANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFLQHMLFLGTKKYPKENEYS 86

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           + + +  G  NA+TS EHT+Y+  V  EH+  AL+       +  F+ S  +RE N V  
Sbjct: 87  QFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLSPLFDESAKDREVNAVDS 146

Query: 126 EIGMSEDDSWD 136
           E   +  +   
Sbjct: 147 EHEKNVMNDAW 157