BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780464|ref|YP_003064877.1| M16 family peptidase
[Candidatus Liberibacter asiaticus str. psy62]
         (424 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040141|gb|ACT56937.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 424

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT
Sbjct: 1   MNLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER
Sbjct: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT
Sbjct: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML
Sbjct: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA
Sbjct: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV
Sbjct: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG 420
           MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG
Sbjct: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG 420

Query: 421 FRSM 424
           FRSM
Sbjct: 421 FRSM 424


>gi|58040297|ref|YP_192261.1| putative processing protease protein [Gluconobacter oxydans 621H]
 gi|58002711|gb|AAW61605.1| Putative processing protease protein [Gluconobacter oxydans 621H]
          Length = 421

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 146/418 (34%), Positives = 253/418 (60%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            + +++  +G+T+ITE M  +++      +  G+R+E  + +G++HFLEHM FKGT +R+
Sbjct: 4   TIEVTRLDNGLTIITERMDRVETVSFGAYVSIGTRDETADNNGVSHFLEHMAFKGTERRS 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I EEIE VGG INAYT+ E T+Y+  +LK  + L ++IIGD+L++S+F  ++IERER
Sbjct: 64  ASRIAEEIENVGGYINAYTARETTAYYVKLLKNDLALGVDIIGDILTHSTFLDAEIERER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +  +F E  + +Q +GRP LG  E +S+ T + ++S++  +YT
Sbjct: 124 GVILQEIGQANDTPDDIIFDQFQERAFPEQPMGRPTLGSEERVSTMTRDTLMSYMREHYT 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
              + +   G + H+  V  V+ +F      +     + A Y GGE    R+L + H+++
Sbjct: 184 THNITIAAAGNLHHQQVVDLVKDHFRDLPTHQTPRP-RAASYEGGELRTTRELDQAHLVM 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF   +Y   D Y   IL+++LG GMSSRLFQE+RE+RGL YS+ +    FSD+G+  + 
Sbjct: 243 GFPSVSYMHPDHYAVMILSTLLGGGMSSRLFQEIRERRGLVYSVYSFASPFSDSGLFGLY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T +E    L   +++ ++ L + +   E+ +  A++ + L+ S E +  R  ++++Q+
Sbjct: 303 AGTGEEQTAELVPVMIDELKRLQDGLSAEELSRARAQLKSSLLMSLESTGSRCEQLARQI 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
                 + + + +  I A+T EDI+ VA+ IFS TPT   +GP +D++P+  ++   L
Sbjct: 363 QVHNRPVPTAETVGKIDAVTEEDILRVARTIFSGTPTFTAIGP-IDNMPSLEDITARL 419


>gi|209966889|ref|YP_002299804.1| Peptidase, M16 family [Rhodospirillum centenum SW]
 gi|209960355|gb|ACJ00992.1| Peptidase, M16 family [Rhodospirillum centenum SW]
          Length = 419

 Score =  234 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 155/417 (37%), Positives = 242/417 (58%), Gaps = 3/417 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R++   +G+ V T+ MP   +A V V I  GSR+E +  +G+AH +EHMLFKGT +R A
Sbjct: 4   VRVTTLPNGLRVATDPMPGVQTASVGVWIGVGSRHEPEAANGVAHLVEHMLFKGTDRRDA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I  EIE VGG +NAYT  EHT+Y+A VLKE V LAL+++ DM+ +S F+P+D+++ER 
Sbjct: 64  FRISAEIEDVGGHLNAYTGREHTTYYAKVLKEDVALALDLLADMIQHSRFDPADLDKERQ 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV++EIG +ED   D +   +    ++ Q +GRPILG  E +++   E +  +V+ NYTA
Sbjct: 124 VVIQEIGQAEDTPDDIIYDHWLATAFRGQALGRPILGTAEVVAALPREALTGYVAANYTA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             M V   G V+H+  V  V   F         +S     + GG++ + RDL + H++LG
Sbjct: 184 ANMVVAAAGNVEHDRVVDLVARLFGGLPAG-TAQSAVRVDWNGGDFREDRDLEQLHILLG 242

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F+G      D+Y + +L+++LG GMSSRLFQEVREKRGL YS+ +     +D GV  I +
Sbjct: 243 FDGVPLPDPDYYASQVLSTLLGGGMSSRLFQEVREKRGLVYSVHSFAWPMTDAGVFGIYA 302

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T  E    L   + + V+++   +   E+ +  A++ A  + S E +  RA +++  ++
Sbjct: 303 GTGPERTEELVPVVCDQVRAIANGLSPEEVTRARAQLKASQLMSLESTTNRAEQLAHALL 362

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
                +  E+II  + A+  + +  VA +IF S P LA LGP +  +     L   L
Sbjct: 363 VFDRPVPPEEIIARVDAVDADALRRVAARIFGSRPVLAALGP-IGRLEPYERLAARL 418


>gi|149915662|ref|ZP_01904188.1| peptidase, M16 family, putative [Roseobacter sp. AzwK-3b]
 gi|149810554|gb|EDM70397.1| peptidase, M16 family, putative [Roseobacter sp. AzwK-3b]
          Length = 420

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 151/418 (36%), Positives = 229/418 (54%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++   +G  ++TE MP   SA + + + AG+R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVNLTTLDNGFRIVTEAMPGLQSAAIGIWVNAGARHERAEQNGIAHFLEHMAFKGTRTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A  I E IE VGG INAYTS E T+Y+A VLK+ VPLAL+++ D+L N  F   +IE E
Sbjct: 61  SALAIAEAIEDVGGYINAYTSREVTAYYARVLKDDVPLALDVVADILRNPLFEGREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + D  +GR ILG  E + +F+   +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEKAYPDHPLGRTILGPEERVGAFSRADLTRFVDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V   E  F   +  K   +   A + GGE  + + L + H  
Sbjct: 181 GPGQMVLAAAGAVDHDAIVRDAEKLFGDMT-PKAPYTPDAARFAGGESRRVKTLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y   D +   I AS LG  MSSRLFQE+RE+RGLCY+I A    +SD G+L I
Sbjct: 240 LAFEAPDYAHPDIFTAQIYASALGGSMSSRLFQEIREQRGLCYTIFAQAGAYSDTGMLTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    V+ ++   E+    EI++  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAAEMANLADITVDEMKRAAEDFTSEEIERARAQMKAGLLMGLESPSNRAERLARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +   G +    ++++ I A+T +D+  +A+   S  P    L  P++  P+   L   
Sbjct: 360 LQIWGRVPDLPEVVERIDAVTLQDVRRLAQTTISDAPVAMALYGPVEAAPSLEALQDR 417


>gi|315122087|ref|YP_004062576.1| M16 family peptidase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495489|gb|ADR52088.1| M16 family peptidase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 424

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 317/420 (75%), Positives = 371/420 (88%), Gaps = 1/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MNLRISKTSSGITVITEVMP + SAFV VNIR+GSR+ER+EEHGMAHFLEHMLFKGT++R
Sbjct: 1   MNLRISKTSSGITVITEVMPHLKSAFVGVNIRSGSRDEREEEHGMAHFLEHMLFKGTSRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+K+IVEEIEKVGGDINAYTS+EHTSYHA VLK+ VPLAL+IIGDMLSNSSFNPSDIERE
Sbjct: 61  TSKDIVEEIEKVGGDINAYTSVEHTSYHARVLKDDVPLALDIIGDMLSNSSFNPSDIERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+VVLEEIGMSED+ W FL   F E+VWK+QIIGRPILGKP+T++SF  EKIIS++SRNY
Sbjct: 121 RSVVLEEIGMSEDNPWSFLYDHFLEIVWKNQIIGRPILGKPDTVASFGSEKIISYISRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           TA+R+YVVCVG+VDH+ C+ QVE+YFNV      +E++KPAVYVGGEYIQKRDLAEEH+ 
Sbjct: 181 TANRIYVVCVGSVDHDACLRQVENYFNVYPAVTKEENIKPAVYVGGEYIQKRDLAEEHIA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF GCAYQSRDFY T IL SILG GMSSRLFQEVREKRGLCYSISAHH NFSDNGV  I
Sbjct: 241 LGFKGCAYQSRDFYPTKILTSILGGGMSSRLFQEVREKRGLCYSISAHHNNFSDNGVFCI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++ATAKEN++ L S+IVEV+ SLL+ IEQ EI K CAKI A+LI +QE S  RA EISKQ
Sbjct: 301 SAATAKENLVELISAIVEVIHSLLKGIEQSEISKVCAKIRAQLIINQEDSDFRASEISKQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           VMFCG +LC+E+IIDTISAITC DI+ +A++IFSS PT+AILGPP++ +P++SEL+H L+
Sbjct: 361 VMFCGHVLCNEEIIDTISAITCTDIIEIAERIFSSVPTIAILGPPINDIPSSSELMHNLK 420


>gi|307941655|ref|ZP_07657010.1| processing peptidase subunit beta [Roseibium sp. TrichSKD4]
 gi|307775263|gb|EFO34469.1| processing peptidase subunit beta [Roseibium sp. TrichSKD4]
          Length = 428

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 169/420 (40%), Positives = 269/420 (64%), Gaps = 4/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++R +   +G+TV+T+ MP + +A + + ++ GSR+ER E++G+ H LEHM FKGT +R
Sbjct: 1   MDVRTTVLDNGLTVVTDRMPHLKTAALGIWVKTGSRSERVEQNGITHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A++I EEIE VGG++NA TS+EHT+Y+A VL E VPLA++++ D+L NS F+  +++RE
Sbjct: 61  NARQIAEEIEAVGGELNAATSIEHTNYYARVLAEDVPLAVDMLSDILQNSVFDGEELKRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D     F    W DQ IGRPILG PE +  FTP+ +  ++   Y
Sbjct: 121 QHVILQEIGAAADTPEDKAFDLFQSTAWPDQSIGRPILGTPEGVLGFTPDALNQYLHERY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M +   GAVDH+  V      F   S  +     + A Y GGE   ++DL E  ++
Sbjct: 181 RGPDMVLAAAGAVDHDQLVELAAQKFGAISQ-EAAGQGEHASYKGGEVRIEKDLMEAQIL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G  Y+S+D+Y   ILASI+G GMSSRLFQE+REK GLCY+I + H  FSD G+  +
Sbjct: 240 IGFEGRPYKSKDYYAIQILASIMGGGMSSRLFQEIREKHGLCYAIYSFHWAFSDTGLFGL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT++E++ AL   I++ ++S  E I   E+++  A+I A L+ + E    RA +I++Q
Sbjct: 300 HAATSQEDLTALMPMILDELRSAGETISDAEVNRSRAQIRAGLMMALESPAARAGQIARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHAL 418
           ++  G +L  +++   I A+T  +I  VA++ F +  PTL  +GP +D + + +++ ++L
Sbjct: 360 ILVHGRVLPMDEVSAKIEAVTAAEIRRVAQETFLNAVPTLTAVGP-VDKLMSVNDIANSL 418


>gi|222147814|ref|YP_002548771.1| peptidase family M16 [Agrobacterium vitis S4]
 gi|221734802|gb|ACM35765.1| peptidase family M16 [Agrobacterium vitis S4]
          Length = 434

 Score =  230 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 288/426 (67%), Gaps = 5/426 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MN+  ++  SG+TV+TE MP ++S  + V +++GSR+E  EEHG+AH LEHM FKGT +R
Sbjct: 1   MNVECTRLPSGLTVVTEKMPHLESVALGVWVKSGSRDETAEEHGIAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+ VPLA++I+ D+L++S+F+  ++ RE
Sbjct: 61  SARQIAEEIENVGGELNAATSTETTSYYARVLKDDVPLAVDILADILTDSAFDDEELIRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++DQ +GR ILG P+T+  FT ++I ++++RNY
Sbjct: 121 KHVILQEIGAAFDTPDDVVFDRFAETAFRDQTVGRGILGTPQTVDGFTSDQIRAYLARNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDHE  V QVE  F+          +     Y GGE  + RDL +  +
Sbjct: 181 TTDRMFVVAAGAVDHESFVRQVEDRFSTLRTKPAVSPIITPARYTGGEVRESRDLMDTQL 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGRAYHARDFYASQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ ++   E IEQ+EID+   +I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELRKSAEQIEQQEIDRSRTQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF--SSTPTLAILGPPMDHVPTTSELIH 416
           Q+M  G  + + ++++ + +IT + +  +A ++F   S PTL+ +GP ++ +    +++ 
Sbjct: 361 QMMLYGRPISNPELMERLESITVDRLTDLAGRLFFDGSPPTLSAIGP-LEQLAPMEDILS 419

Query: 417 ALEGFR 422
           AL G R
Sbjct: 420 ALSGSR 425


>gi|254437767|ref|ZP_05051261.1| peptidase, M16 (pitrilysin) family [Octadecabacter antarcticus 307]
 gi|198253213|gb|EDY77527.1| peptidase, M16 (pitrilysin) family [Octadecabacter antarcticus 307]
          Length = 421

 Score =  229 bits (584), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 150/419 (35%), Positives = 232/419 (55%), Gaps = 1/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++    S+G  ++TE MP   SA + + + AG R+E   ++G+AHFLEHM FKGT +R
Sbjct: 1   MTVQQHTLSNGFRIVTEQMPGLKSASIGIWVMAGGRHETPAQNGIAHFLEHMAFKGTQRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N  F+PS+IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREMTAYYARVLENDVPLALDVIADILLNPVFDPSEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ IGR ILG  E +SSFT   +  F+   Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEEAYPDQAIGRTILGPSERVSSFTKADLSDFIGERY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAV+ +  ++  E  F          + + A +VGGE   K+DL + H  
Sbjct: 181 GPDQMILSAAGAVNPDELLALAEKLFGHLPRRSEPRAAEVAAFVGGERRVKKDLEQAHFT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+    Y   I A  +G GMSSRLFQE+RE RGLCY+I A    ++D G++ +
Sbjct: 241 LAFEGPNYRDPGIYAAQIHAITMGGGMSSRLFQELRENRGLCYTIFAQAGAYADTGMMTV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L +  ++ ++   +++   E+ +  A++ A ++   E    RA  +++ 
Sbjct: 301 YAGTSAEQLGELATLTIDELKRAADDMSAEEVARARAQMKAGMLMGLESPSSRAERLARM 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           V    ++   E  I+ I ++T  D+      + +   ++  L  P+D  P    L   L
Sbjct: 361 VAIWDTVPTIEDTIERIDSVTTGDVRAFGGSLITDAGSVMALYGPIDDAPALEALRQRL 419


>gi|89071033|ref|ZP_01158250.1| peptidase, M16 family protein [Oceanicola granulosus HTCC2516]
 gi|89043421|gb|EAR49638.1| peptidase, M16 family protein [Oceanicola granulosus HTCC2516]
          Length = 421

 Score =  229 bits (583), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 149/419 (35%), Positives = 233/419 (55%), Gaps = 1/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++     +G  ++TE+MP   SA + + + AG R+ER +++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKTHTLPNGFRIVTELMPSMKSAALGIWVNAGGRHERADQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I EEIE VGG INAYTS E T+Y+A VL+E V L L++I D+L N  F+  +IE E
Sbjct: 61  SALQIAEEIEDVGGYINAYTSREMTAYYARVLEEDVDLGLDLISDILLNPVFDEREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E+ + DQ +GR ILG PE +  F  + + SFV  +Y
Sbjct: 121 RGVILQEIGQSHDTPDDVVFDWLQEVAYPDQPMGRSILGLPERVQGFGRDDLTSFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V   E  F       +    +PA + GGE   K+ L + H  
Sbjct: 181 GPGQMILAAAGAVDHDHLVRLAEDLFGHLKPVNLTFQTEPARFGGGERRVKKRLEQVHFA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L  +G  Y+  + Y   + A+ LG GMSSRLFQE+RE RGLCY+I A    ++D G+  I
Sbjct: 241 LALDGPDYRDPEIYTAQVYATALGGGMSSRLFQELRENRGLCYTIFAQAGAYADAGMTTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + TA + I +     ++ ++   +++   EI +  A++ A ++   E    RA  +++ 
Sbjct: 301 YAGTAADQIESFAHLTIDEMKRAADDLSDAEIARARAQMKAGMLMGLESPSNRAERLARM 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +   G +   ++ ++ I A+  +D+     K+     T   +  P++  PT   L   L
Sbjct: 361 ISIWGRVPTIDETVERIDAVGRDDVRAFGAKMAGQAGTAMAIYGPIERAPTLQALRERL 419


>gi|85705122|ref|ZP_01036222.1| peptidase, M16 family protein [Roseovarius sp. 217]
 gi|85670444|gb|EAQ25305.1| peptidase, M16 family protein [Roseovarius sp. 217]
          Length = 420

 Score =  229 bits (582), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 151/411 (36%), Positives = 230/411 (55%), Gaps = 2/411 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++++   +G  +++E MP   SA + V + AG+R+E   ++G+AHFLEHM FKGT +R
Sbjct: 1   MSVQLTTLPNGFRIVSEYMPGLQSAAIGVWVLAGARHEEASQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+  VLKE VPLAL+++ D+L N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYVRVLKEDVPLALDVVADILRNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + D  +GR ILG  E +  F    +  FV + Y
Sbjct: 121 RGVILQEIGQAADTPDDIIFDWLQEKAYPDHPLGRTILGAEERVRGFDRPDLERFVDQYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDHE  V   E  F     +   E    A + GGE    +DL + H  
Sbjct: 181 RPGQMVLSAAGAVDHEALVRMAEGMFGDMIPSDAIEP-PVARFAGGETRHVKDLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y   D Y   I AS LG  MSSRLFQE+RE+RGLCYSI A    +SD G++ I
Sbjct: 240 LAFESPDYAHPDIYTAQIYASALGGSMSSRLFQEIRERRGLCYSIYAQAGAYSDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   +++   E+++  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLGDLAGITVDEMKRAADDMSVAEVERARAQMKAGLLMGLESPSNRAERLARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +   G +    ++++ I A+T  D+  +A+   +  P+   L  P++  PT
Sbjct: 360 LQIWGRVPDLPEVVERIDAVTLADVKRLAESTVARAPSALALYGPVEQAPT 410


>gi|255261299|ref|ZP_05340641.1| peptidase, M16 family [Thalassiobium sp. R2A62]
 gi|255103634|gb|EET46308.1| peptidase, M16 family [Thalassiobium sp. R2A62]
          Length = 421

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 156/419 (37%), Positives = 237/419 (56%), Gaps = 1/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + + + S+G  ++TE MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVELHRLSNGFRIVTEHMPGLQSASLGIWVLAGGRHERIEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A +I E IE VGG INAYTS E T+Y+A VL   VPLAL++I D++ N  F+P +IE E
Sbjct: 61  NALQIAEAIEDVGGYINAYTSREMTAYYARVLAGDVPLALDVISDIVLNPVFDPKEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ +GR ILG  E +SSF+ + +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDIVFDWLQEESYPDQALGRTILGPSERVSSFSWDDLSGFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V+  E  F      + + +  PA ++GGE    +DL + H  
Sbjct: 181 GPEQMVLSAAGAVDHDTLVAAAEKLFGHLPRTENRSTTVPAKFLGGERRVIKDLEQVHFA 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G  Y+  + Y   I +S  G GMSSRLFQEVRE+RGLCY+I A    + D G+  I
Sbjct: 241 LALEGPDYRDPEIYTAQIFSSAFGGGMSSRLFQEVRERRGLCYTIFAQAGAYEDTGMTTI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E I  L    ++ ++   +++  +E+ +  A++ A L+   E    RA  +++ 
Sbjct: 301 YAGTSAEQIGELAQITMDELKRSADDMSAQEVARARAQMKAGLLMGLESPSNRAERLARL 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +     I   E+ I  I+ ++  D+   A K+ +   T   L  P+D  P+  EL   L
Sbjct: 361 IAIWDRIPPLEETISNINDVSTGDVRAFAAKMATRAGTAMALYGPVDAAPSLDELRARL 419


>gi|325292170|ref|YP_004278034.1| M16 family peptidase [Agrobacterium sp. H13-3]
 gi|325060023|gb|ADY63714.1| M16 family peptidase [Agrobacterium sp. H13-3]
          Length = 432

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 196/423 (46%), Positives = 288/423 (68%), Gaps = 4/423 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ SSG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MRVNVTRLSSGLTVVTERMPHLESVALGVWIKSGSRNETTAEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESLFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+L+EIG + D   D +   FS + ++DQ IGRPILG PET+ SFT  +I  +++RNY
Sbjct: 121 KNVILQEIGAATDTPDDVIFDNFSGVAYRDQTIGRPILGTPETVQSFTSAQIRHYLARNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-KPAVYVGGEYIQKRDLAEEHM 238
           T DR++VV  GAVDH+  V QVE  F       +   + + A+Y GGE  + RDL +  +
Sbjct: 181 TTDRIFVVAAGAVDHQSFVKQVEERFASLPQLPVTTPVLEKAIYTGGEIRETRDLMDAQV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVRESRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT   ++  L   IV+ ++   + I Q EID+  A+I A+L+  QE    RA ++++
Sbjct: 301 VHAATGGNDLPELMPVIVDELRKSSQTIHQEEIDRARAQIRAQLLMGQESPAARAGQMAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E++++ ++ IT E +  +A ++F  T PTL+ +GP ++ +P  S++  A
Sbjct: 361 QMMLYGRPIPNEEMMERLNDITRERLTDLAGRLFFDTVPTLSAIGP-LEQLPPLSDITAA 419

Query: 418 LEG 420
           L  
Sbjct: 420 LSA 422


>gi|227821121|ref|YP_002825091.1| peptidase, family M16 protein [Sinorhizobium fredii NGR234]
 gi|227340120|gb|ACP24338.1| peptidase, family M16 protein [Sinorhizobium fredii NGR234]
          Length = 432

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 194/422 (45%), Positives = 293/422 (69%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE  +EHG+AH LEHM FKGT +R
Sbjct: 2   MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVDEHGIAHLLEHMAFKGTRRR 61

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F+  ++ RE
Sbjct: 62  SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAIDILADILTESTFDEEELRRE 121

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG ++D   D +  RF+E  ++DQ +GRPILG PET+ SFTP +I  ++ RNY
Sbjct: 122 KHVILQEIGAADDTPDDVVFDRFAETAYRDQTVGRPILGTPETVMSFTPGQIRQYLGRNY 181

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM++V  GAVDH+  V QV+  F+   VA +    +  A Y GG+  + RDL +  +
Sbjct: 182 TTDRMFIVAAGAVDHDSIVRQVQERFSSLPVAPLSPPVLDTARYTGGDSRESRDLMDAQV 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 242 LLGFEGRAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ ++    +I+Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 302 IHAATGGENLPELMPVIIDELRKSSTSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E++++ +S IT E +  +A ++ F + PTL+ +GP +D +   S+++ +
Sbjct: 362 QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTAPTLSAIGP-LDQLAPMSDILSS 420

Query: 418 LE 419
           L 
Sbjct: 421 LN 422


>gi|119387019|ref|YP_918074.1| peptidase M16 domain-containing protein [Paracoccus denitrificans
           PD1222]
 gi|119377614|gb|ABL72378.1| peptidase M16 domain protein [Paracoccus denitrificans PD1222]
          Length = 421

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 153/419 (36%), Positives = 236/419 (56%), Gaps = 4/419 (0%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +RIS   +G+ V++  MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R+
Sbjct: 3   QIRISTLPNGLRVVSRDMPGLHSAAIGIWVNAGCRDERAEQNGIAHFLEHMAFKGTARRS 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EIVE IE VGG INAYTS + TSY+A VL   V LAL++I D++ N  F+  +IE ER
Sbjct: 63  ALEIVESIENVGGYINAYTSRDVTSYYARVLAGDVELALDVISDIVMNPVFDQREIEVER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +     E  + DQ +GR ILG  E +S F  + +  F+  +Y 
Sbjct: 123 GVILQEIGQALDTPDDVIFDWLQEAAYPDQPMGRTILGPAERVSRFGRDDLSGFIGEHYG 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +RM V   GAV+H+  + QVE+ F       + +             + + L + H  L
Sbjct: 183 PERMIVSAAGAVEHDRILRQVEAIFGHLPARALTKREPARWQGAEAR-RVKGLEQAHFAL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            F G  YQ+ DFY   I  S LG GMSSRLFQ++RE++GLCYSI A      D G++ I 
Sbjct: 242 AFEGPGYQAPDFYAAQIWTSALGGGMSSRLFQKLREEKGLCYSIFAQSGFHDDTGMVTIY 301

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+ E I  L +  V+ ++   E++ + E+ +  A++ A L+   E    +A  +++ +
Sbjct: 302 AGTSGEQIADLATLTVDELKRSAEDMTETEVARARAQLKAGLLMGLESPTGQAERMARSL 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHAL 418
              G +    ++ + I A+T   I   A+++ + + P LA+ GP ++  P+   L   L
Sbjct: 362 SIWGRVPDPAEVAERIDAVTVAAIRAHAERLIAHARPALALYGP-VEGAPSREVLAERL 419


>gi|255601042|ref|XP_002537592.1| metalloprotease, putative [Ricinus communis]
 gi|223515808|gb|EEF24791.1| metalloprotease, putative [Ricinus communis]
          Length = 432

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 193/423 (45%), Positives = 288/423 (68%), Gaps = 4/423 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+T+ MP ++SA + V I++GSRNE ++EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTQTMPHLESAALGVWIKSGSRNETEDEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SARDIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAIDILADILTESAFEEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  +FSE  ++DQ +GRPILG PET+ SF+P++I +++SRNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDKFSETAYRDQTLGRPILGTPETVVSFSPQQIRTYLSRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV H+  V  VE  F     +      M+PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVAAGAVKHDEFVKMVEQRFASLPTSPSAPPVMEPARYIGGNVRETRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYSI A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREIRGLCYSIYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +     +IEQ+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSASSIEQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + ++++++ +  IT E +  +A ++F  T PTL+ +GP ++ +    ++  +
Sbjct: 361 QMMLYGRPISNQEMMERLEGITVERLTDLAGRLFFDTVPTLSAIGP-LEQLAPMEDIAAS 419

Query: 418 LEG 420
           L  
Sbjct: 420 LSA 422


>gi|254501728|ref|ZP_05113879.1| peptidase, M16 (pitrilysin) family [Labrenzia alexandrii DFL-11]
 gi|222437799|gb|EEE44478.1| peptidase, M16 (pitrilysin) family [Labrenzia alexandrii DFL-11]
          Length = 429

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 169/423 (39%), Positives = 254/423 (60%), Gaps = 4/423 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  +   +G+TV+T+ MP + +A + V +R GSR E  +++G+ H LEHM FKGT  R
Sbjct: 1   MKVETTVLENGLTVVTDQMPHLKTAALGVWVRTGSRAENADQNGITHLLEHMAFKGTKSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I EEIE VGG++NA TS+EHT+Y+A +L E +PLA++I+ D+L NS+F   ++ RE
Sbjct: 61  SARGIAEEIEAVGGELNASTSIEHTNYYARILAEDLPLAVDILADILQNSTFEAEELVRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG S D   D     F    W +Q IGRPILG PET+  F  + +  +++  Y
Sbjct: 121 QHVILQEIGASNDAPEDQAFDLFQATAWPEQAIGRPILGTPETVQGFGRDSLNDYLASRY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   GAVDH+  VS     F   +          A Y GGE +  +DL E  ++
Sbjct: 181 RAPDMVLSAAGAVDHDELVSLARQKFGAINSEPAA-PDPDARYSGGEKLLNKDLMEAQVL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G  Y+++D+Y   ILAS+LG GMSSRLFQE+REK GLCY+I + H  FSD G+  I
Sbjct: 240 IGFEGRPYKAKDYYAIQILASVLGGGMSSRLFQEIREKHGLCYAIYSFHWAFSDTGLFGI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT+ E++ AL   I + + S    I + E+ +  A+I A L+ + E    RA +I++Q
Sbjct: 300 HAATSHEDLGALMPMIADELVSAAHTITEDEVARSRAQIRAGLMMALESPAARAGQIARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVA-KKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G +L  ++I   I A+T  DI   A      +TPTL  +GP ++ + T  EL   L
Sbjct: 360 ILVHGRVLAPDEISAKIEAVTAADIREAAYNTFVGTTPTLTAIGP-INGIMTADELAARL 418

Query: 419 EGF 421
           +  
Sbjct: 419 QQA 421


>gi|110633116|ref|YP_673324.1| peptidase M16-like [Mesorhizobium sp. BNC1]
 gi|110284100|gb|ABG62159.1| peptidase M16-like protein [Chelativorans sp. BNC1]
          Length = 430

 Score =  227 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 179/413 (43%), Positives = 277/413 (67%), Gaps = 1/413 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +P ++S  + V +++GSRNER++EHG+AH LEHM FKGTTKR
Sbjct: 1   MGVEVSRLSNGLTVATETLPHLESVALGVWVKSGSRNEREDEHGIAHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+++A VL++ + LA++I+ D+L++S F+P ++ERE
Sbjct: 61  TALQIATDIEDVGGEINAATSVETTAFYARVLRDDMSLAIDILADILTDSKFDPHELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG P+T++SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDAVFDRFTETAFRHQAIGRSILGTPDTVASFTSQQLRRFMERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            ADRM VV  G V H+  V +VE+              + + YVGG+Y + RDL +  ++
Sbjct: 181 GADRMVVVAAGGVTHDEFVREVEARLGSFRDKADTAVPQYSNYVGGDYREHRDLMDAQII 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD GV  +
Sbjct: 241 LGFEGRAYHVRDFYASQMLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGVFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + ++  L   I+  +Q   E I+Q E+D+  A+  A L+ S+E    RA ++++Q
Sbjct: 301 HAATGQSDLGELMPVILGELQKAGERIDQAELDRARAQYRAGLMMSRESPASRASQVARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTS 412
           ++  G  + +E+++D ++ IT E +  ++ ++FSS PT+  +GP     P  +
Sbjct: 361 LLLYGRPIETEELMDRLAGITVERLADLSNRLFSSKPTVTAIGPVGSLAPFEA 413


>gi|23014797|ref|ZP_00054596.1| COG0612: Predicted Zn-dependent peptidases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 421

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 138/418 (33%), Positives = 252/418 (60%), Gaps = 2/418 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++ +SG+ ++T+ M  +++  + V + AG+R+E  E +G++H LEHM FKGT +R+A
Sbjct: 4   IRETRLNSGLKIVTDPMETVETVSLGVWVDAGTRHEPVEINGVSHLLEHMAFKGTARRSA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EE++ VGG +NAYT+ +HT+Y+A VLKE   LAL+II D+L NS+    ++ RE+ 
Sbjct: 64  LDIAEEMDAVGGHLNAYTARDHTAYYAKVLKEDAALALDIISDILQNSTLEAEELGREQA 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV++EI  + D   D +   F    + DQ +GRP+LG  E + + + ++++ ++  NY+A
Sbjct: 124 VVVQEINQAIDTPDDIIFDHFQATAYPDQPLGRPVLGSEELVRAMSRDQVMGYMRGNYSA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM +   G +DH+  V+   + F+         + +     G    ++ +L + H+++G
Sbjct: 184 PRMVLSASGRIDHDHLVATAGAAFSQLPPHHAAVTDQARYVGGDFREERSELEQVHVVVG 243

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F+G AY   D+Y  ++L+++LG GMSSRLFQEVREKRGL YSI +   +++D G+  + +
Sbjct: 244 FDGVAYDDPDYYSASVLSTLLGGGMSSRLFQEVREKRGLVYSIYSFASSYNDGGLFGVYA 303

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T ++ +  L   + + +  +   +   E+ +  A++ A ++ S E +  R  ++++QV+
Sbjct: 304 GTGEDEVAELIPVMCDEIVKVCGGVNDAEVQRARAQLKASILMSLESTTSRCEQLARQVV 363

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
             G  +   ++++ + AIT ED   VA+++F+ TPT A +GP +  V +   +   L 
Sbjct: 364 IYGRPVPVAEVVEKVEAITAEDCARVARRLFAGTPTFAAIGP-LGKVESFERVAERLR 420


>gi|163745865|ref|ZP_02153224.1| peptidase, M16 family, putative [Oceanibulbus indolifex HEL-45]
 gi|161380610|gb|EDQ05020.1| peptidase, M16 family, putative [Oceanibulbus indolifex HEL-45]
          Length = 420

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 152/418 (36%), Positives = 237/418 (56%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+L  +   +G  ++TE M    S+ + V + AG+R+E  +++G+AHFLEHM FKGT  R
Sbjct: 1   MSLNQTTLPNGFRIVTEHMEGLASSAIGVWVNAGARHETPQQNGIAHFLEHMAFKGTATR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           ++ +I E IE VGG INAYTS E T+Y+A VL+  V L L++I D+L N   +PS++E E
Sbjct: 61  SSLQIAEAIEDVGGYINAYTSREVTAYYARVLENDVALGLDVIADILRNPVLDPSEVEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ IGR ILG  E +S+F+ + +  F++ +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEQAYPDQPIGRTILGPSERVSAFSRDDLKLFIADHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   ES F      K+   +  A + GGE+ Q + L + H  
Sbjct: 181 GPEQMILSAAGAVDHDKIVKLAESLFGDMPSKKL-YQVDGARFGGGEFRQVKKLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y+S D Y+  I AS LG GMSSRLFQE+RE RGLCY+I A    ++D G+  I
Sbjct: 240 LGFESPGYRSDDIYIAQIYASALGGGMSSRLFQEIRENRGLCYTIFAQAGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L +  ++ ++    ++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLPELANITIDEMKRAATDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +     +   E+ +  I A+T  D+   A+++ +  P    L  P+D  PT  EL   
Sbjct: 360 IQIWDRVPPLEETVAQIDAVTTGDVRDFAERMATQAPAALALYGPVDGAPTLDELHSR 417


>gi|254471856|ref|ZP_05085257.1| peptidase, M16 family [Pseudovibrio sp. JE062]
 gi|211959058|gb|EEA94257.1| peptidase, M16 family [Pseudovibrio sp. JE062]
          Length = 423

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 166/425 (39%), Positives = 268/425 (63%), Gaps = 4/425 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++++K  +G+TV+T+ M  + +  + + ++AGSR+E ++E+G+ H LEHM FKGTTKR
Sbjct: 1   MAVKLTKLENGLTVVTDQMEYLKTTALGIWVKAGSRSEGEQENGITHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A+EI EEIE VGG++NA TS+EHT+Y+   L + VPL L+I+ D+L +S  +  ++ RE
Sbjct: 61  NAREIAEEIEAVGGEMNASTSVEHTNYYVRTLADDVPLGLDILSDILQDSIIDADELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG ++D   D +     E  W +Q +GRPILG PET++ F+ + I  +V R Y
Sbjct: 121 KHVILQEIGAAQDTPDDQVFDVLLETAWPNQPLGRPILGTPETVNGFSADAIRQYVERKY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           TA  M +   GAV+HE  V    + F+  S +   +    A YVGGE   +RDL E  ++
Sbjct: 181 TASDMVLAAAGAVEHEALVDLARANFSKLSNS-APDEDNLAQYVGGEGAIERDLQELQII 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y+  D+Y   +LASILG GMSSRLFQEVREKRGLCYS+ A H  F+D G   +
Sbjct: 240 LGFEGLPYEHEDYYAVQVLASILGGGMSSRLFQEVREKRGLCYSVYAFHWAFADTGFFGV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT  E+   LT  +V+ ++ + + + ++E+ +  A++ + L+ + E    RA ++++Q
Sbjct: 300 HAATGPEDAAELTEVLVDQLKEIAKGVSEKEVSRAKAQLRSGLLMALESPAARAGQLARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           VM  G  +  E++   ++A++ + +  +A+K+F +  PT   +GP    +   +EL   L
Sbjct: 360 VMIYGHPVAIEELEKRLNAVSADRLQVLAEKLFATDNPTFVKVGPKAPML-NYAELKERL 418

Query: 419 EGFRS 423
            G ++
Sbjct: 419 AGIKA 423


>gi|144899407|emb|CAM76271.1| Zn-dependent peptidases [Magnetospirillum gryphiswaldense MSR-1]
          Length = 420

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 142/402 (35%), Positives = 253/402 (62%), Gaps = 2/402 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +   SG+ V+T+ M  ++SA + + + AG+R+E  E +G++H LEHM FKGT +R+A
Sbjct: 4   VRETTLPSGLRVLTDPMDTVESASLGLWVDAGTRHEPAEINGISHLLEHMAFKGTERRSA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           + I EE++ VGG +NAYT+ +HT+Y+A VLKE   LAL+I+ D+L NS+ +  ++ RE+ 
Sbjct: 64  RAIAEEMDAVGGHLNAYTARDHTAYYAKVLKEDSALALDILADILQNSTVDAEELAREQA 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV++EI  S D   D +   F    + DQ +GRP+LG  E + + + + ++ +++ +Y+A
Sbjct: 124 VVVQEINQSFDTPDDIIFDHFQTTAFPDQPLGRPVLGTEELVRAMSRDTVLGYMATHYSA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM +   G +DH+  V      F     A       PA+Y GGEY ++RD+ + +++LG
Sbjct: 184 PRMVLSAAGRIDHDQLVELAGKAFADLPTAADVMP-APALYKGGEYREERDIEQVNLVLG 242

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G +Y   D+Y  ++L+++LG GMSSRLFQE+REKRGL YSI +   +++D G+  I +
Sbjct: 243 YGGVSYDDPDYYTASVLSTLLGGGMSSRLFQEIREKRGLVYSIYSFASSYADGGLFGIYA 302

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T ++ +  L   + + V  + + ++  E+ +  A++ A ++ S E +  R  ++++QV+
Sbjct: 303 GTGEDEVEELVPVLCDEVVKITQGVDADELQRARAQLKASILMSLESTSSRCEQLARQVL 362

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             G  + +++++D + AI    I  VA+++F++ PT+A +GP
Sbjct: 363 VYGRPIPTQEVVDKVEAIDGAQIARVARRLFATPPTIAAIGP 404


>gi|126733556|ref|ZP_01749303.1| peptidase, M16 family protein [Roseobacter sp. CCS2]
 gi|126716422|gb|EBA13286.1| peptidase, M16 family protein [Roseobacter sp. CCS2]
          Length = 422

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 153/420 (36%), Positives = 240/420 (57%), Gaps = 2/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +++   S+G  ++TE MP   SA + + ++AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTIQLHTLSNGFRIVTEDMPGLKSASIGIWVQAGGRHERVEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL++   L L++I D+L N  F+P++IE E
Sbjct: 61  SALQIAESIEDVGGYINAYTSREMTAYYARVLEDDTTLGLDVISDILLNPVFDPAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E+ + DQ +GR ILG  E +SSF+ + +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEVAYPDQALGRTILGPSERVSSFSRDDLQRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSV-AKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             ++M +   GA+DH+  ++Q E+ F      A+  + M+PA + GGE  + +DL + H 
Sbjct: 181 GPNQMILSAAGAIDHDAVIAQAEALFGHLPAVARAPDLMQPAAFGGGERRENKDLEQVHF 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G  Y     Y   I A+ +G GMSSRLFQE+RE RGLCY+I A    + D G+  
Sbjct: 241 ALALEGPTYLDPAIYTAQIYANAMGGGMSSRLFQEIRENRGLCYTIFAQAGAYEDTGLTT 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I + T+ E I  L +  ++ ++   +++   E+ +  A++ A L+   E    RA  +++
Sbjct: 301 IYAGTSAEQIGELANITIDEMKRAADDMSAAEVARARAQMKAGLLMGLESPSNRAERLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
            +   G I   ++ I+ I  +T  D+  +A ++     T   L  P +  PT   L   L
Sbjct: 361 LLSIWGRIPSIDETIEHIDDVTTGDVKDLAGQMAGQAGTALALYGPAEAAPTLDALRARL 420


>gi|256254523|ref|ZP_05460059.1| Insulinase-like peptidase, family M16 [Brucella ceti B1/94]
 gi|260168251|ref|ZP_05755062.1| processing protease [Brucella sp. F5/99]
 gi|261221700|ref|ZP_05935981.1| peptidase [Brucella ceti B1/94]
 gi|261757714|ref|ZP_06001423.1| processing peptidase [Brucella sp. F5/99]
 gi|260920284|gb|EEX86937.1| peptidase [Brucella ceti B1/94]
 gi|261737698|gb|EEY25694.1| processing peptidase [Brucella sp. F5/99]
          Length = 430

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGHAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|225626988|ref|ZP_03785027.1| Peptidase M16 domain protein [Brucella ceti str. Cudo]
 gi|225618645|gb|EEH15688.1| Peptidase M16 domain protein [Brucella ceti str. Cudo]
          Length = 432

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 3   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 62

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 63  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 122

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 123 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 182

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 183 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 243 IGFEGHAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 303 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 363 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 421

Query: 419 E 419
            
Sbjct: 422 S 422


>gi|256044197|ref|ZP_05447104.1| processing peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563556|ref|ZP_05834042.1| processing peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|265990612|ref|ZP_06103169.1| peptidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260153572|gb|EEW88664.1| processing peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|263001396|gb|EEZ13971.1| peptidase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 430

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|225852019|ref|YP_002732252.1| processing protease [Brucella melitensis ATCC 23457]
 gi|256264476|ref|ZP_05467008.1| peptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|225640384|gb|ACO00298.1| processing protease [Brucella melitensis ATCC 23457]
 gi|263094807|gb|EEZ18545.1| peptidase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408513|gb|ADZ65578.1| processing protease [Brucella melitensis M28]
 gi|326538230|gb|ADZ86445.1| processing protease [Brucella melitensis M5-90]
          Length = 430

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|17987734|ref|NP_540368.1| processing peptidase [Brucella melitensis bv. 1 str. 16M]
 gi|17983454|gb|AAL52632.1| zinc protease [Brucella melitensis bv. 1 str. 16M]
          Length = 490

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 61  MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 120

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 121 TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 180

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 181 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 240

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 241 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 300

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 301 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 360

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 361 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 420

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 421 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 479

Query: 419 E 419
            
Sbjct: 480 S 480


>gi|209548240|ref|YP_002280157.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533996|gb|ACI53931.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 432

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 189/422 (44%), Positives = 280/422 (66%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE  +EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETADEHGIAHLLEHMAFKGTGRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SARQIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE+ ++DQ +GR ILG PET+ SFTP++I  ++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEVAYRDQTLGRAILGTPETVVSFTPQQIRGYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV+H+  V  VE  F            M+ A Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVEHDEFVRMVEDRFASLPSEPSAPPVMEAARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +    + I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPQLVPVIIDELHKSADQIHQKEIERARAQIRAQLLMGQESPASRAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP ++ +    ++  +
Sbjct: 361 QMMLYGRPISNMEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGP-LEQLAPMEDITAS 419

Query: 418 LE 419
           L 
Sbjct: 420 LS 421


>gi|126725946|ref|ZP_01741788.1| peptidase, M16 family protein [Rhodobacterales bacterium HTCC2150]
 gi|126705150|gb|EBA04241.1| peptidase, M16 family protein [Rhodobacterales bacterium HTCC2150]
          Length = 421

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 162/420 (38%), Positives = 241/420 (57%), Gaps = 3/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +I    +G  ++TE MP   SA V V + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MKPQIHTLPNGFRIVTEAMPGMKSASVGVWVNAGGRHERIEQNGIAHFLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I EEIE VGG INAYT+ E T+++A VL+  VPLA+++I D+L N +F+  +IE E
Sbjct: 61  TALQIAEEIEDVGGYINAYTTREVTAFYARVLENDVPLAVDVIADILRNPTFDEKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     +  + DQ IGR ILG  E + SF    + +FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDLIFDWLQDAAYPDQPIGRTILGPAERVRSFDQADLANFVTDHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            AD+M +   GAVDH+  V Q E+ F        K   +PA +  GE  + +DL + H  
Sbjct: 181 RADQMILAAAGAVDHDEIVRQAEALFGDMPQRS-KLQFEPAKFHSGERREVKDLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L     +Y   D Y + I AS LG GMSSRLFQEVREKRGLCY+I A   +++D G++ I
Sbjct: 240 LALQCPSYMDDDVYTSQIYASALGGGMSSRLFQEVREKRGLCYTIFAQAGSYADTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ ++I  L +  V+ ++    +I + EI +   ++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGDDIDDLATLTVDELKRAATDISEVEIARARTQMKAGMLMGLESPSNRAERLARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHAL 418
           +     I   ++I++ I A+   D+ G A+K+       LA+ GP     P    L   L
Sbjct: 360 LAIWDRIPDLDEIVERIDAVNATDVRGFAEKMAHGNEIALALYGPMAADAPDLDGLKRRL 419


>gi|190890694|ref|YP_001977236.1| processing peptidase [Rhizobium etli CIAT 652]
 gi|218516806|ref|ZP_03513646.1| probable processing peptidase protein [Rhizobium etli 8C-3]
 gi|190695973|gb|ACE90058.1| probable processing peptidase protein [Rhizobium etli CIAT 652]
          Length = 432

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 191/422 (45%), Positives = 282/422 (66%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE ++EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETEDEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SAREIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE  ++DQ +GRPILG P+T+ SFTP++I +++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRPILGTPQTVVSFTPQQIRTYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDHE  +  VE  F     +      M+ A Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVDHEEFLRMVEDRFASLPTSPSAPPVMEAARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +      I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSANEIHQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP ++ +    ++  +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGP-LEQLAPMEDITAS 419

Query: 418 LE 419
           L 
Sbjct: 420 LS 421


>gi|237814951|ref|ZP_04593949.1| Peptidase M16 domain protein [Brucella abortus str. 2308 A]
 gi|237789788|gb|EEP63998.1| Peptidase M16 domain protein [Brucella abortus str. 2308 A]
          Length = 490

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 61  MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 120

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 121 TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 180

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 181 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 240

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 241 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 300

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 301 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 360

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 361 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 420

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 421 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 479

Query: 419 E 419
            
Sbjct: 480 S 480


>gi|62289464|ref|YP_221257.1| processing protease [Brucella abortus bv. 1 str. 9-941]
 gi|82699390|ref|YP_413964.1| insulinase-like peptidase [Brucella melitensis biovar Abortus 2308]
 gi|189023713|ref|YP_001934481.1| Insulinase-like peptidase, family M16 [Brucella abortus S19]
 gi|254688775|ref|ZP_05152029.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 6 str.
           870]
 gi|254693259|ref|ZP_05155087.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696905|ref|ZP_05158733.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254729808|ref|ZP_05188386.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 4 str.
           292]
 gi|256257022|ref|ZP_05462558.1| Insulinase-like peptidase, family M16 [Brucella abortus bv. 9 str.
           C68]
 gi|260545783|ref|ZP_05821524.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260754261|ref|ZP_05866609.1| processing peptidase [Brucella abortus bv. 6 str. 870]
 gi|260757481|ref|ZP_05869829.1| processing peptidase [Brucella abortus bv. 4 str. 292]
 gi|260761306|ref|ZP_05873649.1| processing peptidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883286|ref|ZP_05894900.1| peptidase [Brucella abortus bv. 9 str. C68]
 gi|261213508|ref|ZP_05927789.1| processing peptidase [Brucella abortus bv. 3 str. Tulya]
 gi|297247877|ref|ZP_06931595.1| processing protease [Brucella abortus bv. 5 str. B3196]
 gi|62195596|gb|AAX73896.1| processing protease [Brucella abortus bv. 1 str. 9-941]
 gi|82615491|emb|CAJ10465.1| Insulinase-like peptidase, family M16:Peptidase M16 inactive
           [Brucella melitensis biovar Abortus 2308]
 gi|189019285|gb|ACD72007.1| Insulinase-like peptidase, family M16 [Brucella abortus S19]
 gi|260097190|gb|EEW81065.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260667799|gb|EEX54739.1| processing peptidase [Brucella abortus bv. 4 str. 292]
 gi|260671738|gb|EEX58559.1| processing peptidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674369|gb|EEX61190.1| processing peptidase [Brucella abortus bv. 6 str. 870]
 gi|260872814|gb|EEX79883.1| peptidase [Brucella abortus bv. 9 str. C68]
 gi|260915115|gb|EEX81976.1| processing peptidase [Brucella abortus bv. 3 str. Tulya]
 gi|297175046|gb|EFH34393.1| processing protease [Brucella abortus bv. 5 str. B3196]
          Length = 430

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|327192552|gb|EGE59503.1| putative processing peptidase protein [Rhizobium etli CNPAF512]
          Length = 432

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 191/422 (45%), Positives = 282/422 (66%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE ++EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETEDEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SAREIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE  ++DQ +GRPILG P+T+ SFTP++I +++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRPILGTPQTVVSFTPQQIRTYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDHE  +  VE  F     +      M+ A Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVDHEEFLRMVEDRFAGLPTSPSAPPVMEAARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +      I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSANEIHQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP ++ +    ++  +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGP-LEQLAPMEDITAS 419

Query: 418 LE 419
           L 
Sbjct: 420 LS 421


>gi|254709627|ref|ZP_05171438.1| Insulinase-like peptidase, family M16 [Brucella pinnipedialis
           B2/94]
 gi|256031120|ref|ZP_05444734.1| Insulinase-like peptidase, family M16 [Brucella pinnipedialis
           M292/94/1]
 gi|261317159|ref|ZP_05956356.1| processing peptidase [Brucella pinnipedialis B2/94]
 gi|265988197|ref|ZP_06100754.1| processing peptidase [Brucella pinnipedialis M292/94/1]
 gi|261296382|gb|EEX99878.1| processing peptidase [Brucella pinnipedialis B2/94]
 gi|264660394|gb|EEZ30655.1| processing peptidase [Brucella pinnipedialis M292/94/1]
          Length = 430

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 272/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E+ ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTEIAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|182677714|ref|YP_001831860.1| peptidase M16 domain-containing protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633597|gb|ACB94371.1| peptidase M16 domain protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 421

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 157/419 (37%), Positives = 243/419 (57%), Gaps = 2/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + I+   SG+ +IT+ MP + +A + V I AGSR+ER EEHG++H LEHM FKGT +R
Sbjct: 1   MTVEITTLPSGLRIITDAMPHLATASLGVWIGAGSRHERPEEHGLSHLLEHMAFKGTHRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGGD+NA TS E T+Y+A VL +  PLAL+I+ D+L+ S F+P ++ERE
Sbjct: 61  SAREIAEEIESVGGDLNAATSTEQTAYYAHVLAQDTPLALDILADILTESLFDPRELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG  ED   D +   F+   + DQ +GRPILG P  ++SF P  I +++S +Y
Sbjct: 121 KDVILQEIGAVEDTPDDLVFDLFNARAFPDQPLGRPILGTPAHVTSFGPTMIGNYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            +  M +   GAV+H+  V +    F    V + +  +      G   ++++      ++
Sbjct: 181 RSAAMVIGAAGAVEHQKIVDEAARRFASLPVREAQILVPAHYQGGEIRLKRKLEQAHIVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
                  +    FY   I A+  G GMSSRLFQEVREKRGL YSISA H  ++D G+   
Sbjct: 241 GFEGLSYHDQDSFYAMQIFANATGGGMSSRLFQEVREKRGLAYSISAFHWGYADAGLFGF 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT   +I  L    ++ +      + + EI +  A++   L+ + E    R  +I++Q
Sbjct: 301 YAATGARDIAELMPVALDCLAEATTGLTEVEIRRAKAQMKVSLLAALESPSARVEQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           ++    +L  E+I++ I AIT ED+  V +    S PTLA +GP +  V +   +   +
Sbjct: 361 LIAFDRVLTHEEIVERIDAITLEDVCRVGQAALKSAPTLAAIGP-IAKVMSPERIAERV 418


>gi|110679417|ref|YP_682424.1| M16 family peptidase putative [Roseobacter denitrificans OCh 114]
 gi|109455533|gb|ABG31738.1| peptidase, M16 family, putative [Roseobacter denitrificans OCh 114]
          Length = 420

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 153/418 (36%), Positives = 233/418 (55%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M L   +  +G  ++TE MP   SA + V + AG+R+E  +++G+AHFLEHM FKGTT+R
Sbjct: 1   MTLNQHRLPNGFRIVTEHMPGLASASIGVWVTAGARHETPQQNGIAHFLEHMAFKGTTQR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N +   ++IE E
Sbjct: 61  TALQIAESIEDVGGYINAYTSREVTAYYARVLQNDVPLALDVIADILLNPTLEEAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E  + +  +GR ILG  E +S F+   +  F++++Y
Sbjct: 121 RGVILQEIGQSLDTPDDVIFDWLQEEAYPNHPMGRTILGPSERVSQFSRNDLQQFIAQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   E  F       +   +  A ++GGE  Q + L + H  
Sbjct: 181 GPEQMILSAAGAVDHDEIVRLAEQLFGSMQAKPM-FDVDAAQFLGGERRQSKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I AS LG GMSSRLFQE+RE RGLCYSI A    ++D G+  I
Sbjct: 240 LAFESPGYRDDCIYTAQIYASALGGGMSSRLFQEIRENRGLCYSIFAQAGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++  ++++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLGQLAEITIDEIKRAVDDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V     +   ++ +  I A+T  D+   A++I  S P    L  P+D  PT + L   
Sbjct: 360 VQIWDRVPPLDETVAMIDAVTTGDVREFAQRIAQSAPAALALYGPVDGAPTLAALQER 417


>gi|254712957|ref|ZP_05174768.1| Insulinase-like peptidase, family M16 [Brucella ceti M644/93/1]
 gi|254716689|ref|ZP_05178500.1| Insulinase-like peptidase, family M16 [Brucella ceti M13/05/1]
 gi|254718657|ref|ZP_05180468.1| Insulinase-like peptidase, family M16 [Brucella sp. 83/13]
 gi|256060617|ref|ZP_05450783.1| Insulinase-like peptidase, family M16 [Brucella neotomae 5K33]
 gi|256368936|ref|YP_003106442.1| processing protease [Brucella microti CCM 4915]
 gi|261218494|ref|ZP_05932775.1| processing peptidase [Brucella ceti M13/05/1]
 gi|261320656|ref|ZP_05959853.1| processing peptidase [Brucella ceti M644/93/1]
 gi|261324613|ref|ZP_05963810.1| peptidase [Brucella neotomae 5K33]
 gi|265983638|ref|ZP_06096373.1| processing peptidase [Brucella sp. 83/13]
 gi|306837794|ref|ZP_07470658.1| Insulinase-like peptidase, family M16 [Brucella sp. NF 2653]
 gi|306842233|ref|ZP_07474896.1| Insulinase-like peptidase, family M16 [Brucella sp. BO2]
 gi|255999094|gb|ACU47493.1| processing protease [Brucella microti CCM 4915]
 gi|260923583|gb|EEX90151.1| processing peptidase [Brucella ceti M13/05/1]
 gi|261293346|gb|EEX96842.1| processing peptidase [Brucella ceti M644/93/1]
 gi|261300593|gb|EEY04090.1| peptidase [Brucella neotomae 5K33]
 gi|264662230|gb|EEZ32491.1| processing peptidase [Brucella sp. 83/13]
 gi|306287613|gb|EFM59060.1| Insulinase-like peptidase, family M16 [Brucella sp. BO2]
 gi|306407135|gb|EFM63350.1| Insulinase-like peptidase, family M16 [Brucella sp. NF 2653]
          Length = 430

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|256113012|ref|ZP_05453909.1| processing protease [Brucella melitensis bv. 3 str. Ether]
 gi|265994444|ref|ZP_06107001.1| peptidase [Brucella melitensis bv. 3 str. Ether]
 gi|262765557|gb|EEZ11346.1| peptidase [Brucella melitensis bv. 3 str. Ether]
          Length = 430

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 168/421 (39%), Positives = 269/421 (63%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINATTSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +     +I   E+D+   +  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAANSIGIEEVDRARTQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|254465329|ref|ZP_05078740.1| Zn-dependent peptidase family protein [Rhodobacterales bacterium
           Y4I]
 gi|206686237|gb|EDZ46719.1| Zn-dependent peptidase family protein [Rhodobacterales bacterium
           Y4I]
          Length = 420

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 158/418 (37%), Positives = 242/418 (57%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++    ++G  +++E MP  +SA V + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVQQHTLANGFRIVSEHMPGLESAAVGIWVTAGGRHERLEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I EEIE VGG INAYTS E T+Y+A VLK+ VPLA+++IGD+L N  F+  +IE E
Sbjct: 61  SALQIAEEIEDVGGYINAYTSREVTAYYARVLKDDVPLAVDVIGDILLNPVFDQREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E  ++ Q +GR ILG  E + SF+ E +  FVS +Y
Sbjct: 121 RGVILQEIGQSLDTPDDVIFDWLQEESYRGQPLGRTILGPAERVRSFSREDLEGFVSEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   G VDH+  V   E  F     AK   + + A + GGE  Q +DL + H  
Sbjct: 181 GPGQMILAAAGGVDHDALVRLAEQLFGHM-AAKPDFTAEGATFTGGEARQVKDLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+ +  Y   I AS LG GMSSRLFQEVREKRGLCY+I +   +++D G + +
Sbjct: 240 LAFEGPGYRDQSMYTAQIYASALGGGMSSRLFQEVREKRGLCYTIFSQAGSYADTGSMTV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++   +++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGEQLAELAGITIDEMKRAADDMSDAEVERARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E+ I+ I A+T +D+  +A+ +  + P    L  P+   P    L   
Sbjct: 360 VQIWGKVPSLERTIERIDAVTTKDVRTLAEAMAVTAPAALALYGPVADAPALERLQER 417


>gi|294851859|ref|ZP_06792532.1| processing protease [Brucella sp. NVSL 07-0026]
 gi|294820448|gb|EFG37447.1| processing protease [Brucella sp. NVSL 07-0026]
          Length = 430

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEVPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|159184464|ref|NP_353810.2| M16 family peptidase [Agrobacterium tumefaciens str. C58]
 gi|159139776|gb|AAK86595.2| peptidase, family M16 [Agrobacterium tumefaciens str. C58]
          Length = 432

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 199/423 (47%), Positives = 286/423 (67%), Gaps = 4/423 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ SSG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MRVNVTRLSSGLTVVTERMPHLESVALGVWIKSGSRNETTAEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESLFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+L+EIG + D   D +   FS + ++DQ IGRPILG P+T+ SFT  +I  +++RNY
Sbjct: 121 KNVILQEIGAATDTPDDVIFDNFSGVAYRDQTIGRPILGTPDTVQSFTSGEIRHYLARNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCS-VAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DR++VV  GAVDHE  V QVE  F     V      M+ A+Y GGE  + RDL +  +
Sbjct: 181 TTDRIFVVAAGAVDHESFVKQVEERFASLPLVPAAPPVMEKAIYTGGEIRETRDLMDAQV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREARGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT   ++  L   IV+ ++   E I Q EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 VHAATGGNDLPELIPVIVDELRKSSETIHQDEINRARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E+++  +  IT E +  +A ++F  T PTL+ +GP ++ +P  S++  A
Sbjct: 361 QMMLYGRPIPNEEMMTRLEDITRERLTDLAGRLFFDTVPTLSAIGP-LEQLPPLSDITAA 419

Query: 418 LEG 420
           L  
Sbjct: 420 LSA 422


>gi|329114646|ref|ZP_08243405.1| Putative zinc protease [Acetobacter pomorum DM001]
 gi|326696126|gb|EGE47808.1| Putative zinc protease [Acetobacter pomorum DM001]
          Length = 436

 Score =  224 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 160/421 (38%), Positives = 255/421 (60%), Gaps = 5/421 (1%)

Query: 1   MN--LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           M   + I++  SG+TV+TE M  +++      +  G+R+E  EE+G++HFLEHM FKGTT
Sbjct: 16  MTDPINITRLPSGLTVVTERMERVETVSFGAYVATGTRHETAEENGVSHFLEHMAFKGTT 75

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            R+A  I EEIE VGG INAYT+ E T Y+  +LKE++ L ++IIGD+L+NS+F+P+++E
Sbjct: 76  SRSALRIAEEIENVGGHINAYTAREQTVYYVKLLKENLGLGVDIIGDILTNSTFDPAEME 135

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           RER V+L+EIG + D   D +   F E  + DQ +GRP LG    I   + E ++ ++  
Sbjct: 136 RERGVILQEIGQANDTPDDVIFDHFQETAFPDQPMGRPTLGTESLIRDMSRETLMRYMKA 195

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           +YT D M V   G + HE  V +V+ +F   S +    +   A Y GGE+ Q ++L + H
Sbjct: 196 HYTTDNMIVAAAGNLHHEDVVQRVQQHFANLSSSSAPVT-LSARYGGGEFRQVKELDQAH 254

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LGF    Y+  D++   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F+D G+ 
Sbjct: 255 VVLGFPSFGYEDPDYFPALLLSTVLGGGMSSRLFQEIREKRGLVYSVYSFNAPFTDGGIF 314

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T  +    L    +E +  +   + + E+ +  A++ A L+ S E +  R  +I+
Sbjct: 315 GIYAGTGAKECAELVPVTLEELNKIQRYVTEEELVRARAQLKASLLMSLESTGSRCEQIA 374

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +Q+   G I+ + + +  I A+   DI   A +IF+ TPTLA LGP ++H+P+   +   
Sbjct: 375 RQLQIFGRIIPTAETVRKIEAVNAGDICRAASRIFTGTPTLAALGP-IEHIPSLQIITEK 433

Query: 418 L 418
           L
Sbjct: 434 L 434


>gi|260460283|ref|ZP_05808535.1| peptidase M16 domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259033928|gb|EEW35187.1| peptidase M16 domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 430

 Score =  224 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 183/424 (43%), Positives = 275/424 (64%), Gaps = 2/424 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +P  +S  +   +++G+RNER +EHGMAH LEHM FKGT +R
Sbjct: 1   MGVEVSRLSNGLTVATETLPSIESVALGAWVKSGARNERDDEHGMAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A EI  EIE VGG+INA TS+E TSY+A VL + VPLA++I+ D+L  S F+P ++ERE
Sbjct: 61  SAFEIASEIEDVGGEINAATSVETTSYYARVLSDDVPLAVDILSDILQESEFDPQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG PET+ SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDIVFDRFTETAFRHQTIGRSILGTPETVKSFTSKQLHDFIERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A+RM +V  G + H+  V +VE               + A YVGG++ + RDL +  ++
Sbjct: 181 GAERMVIVAAGDIKHDNFVREVEKQLGGFRSKADSTIPQYAQYVGGDFREDRDLMDAQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  +
Sbjct: 241 LGFEGRAYHVRDFYASQVLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGIFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + +I  L   I++ +Q   E+I Q E+D+  A+  A LI S E    RA +I++Q
Sbjct: 301 HAATGQSDIAELVPVIIDELQKAGESILQEELDRARAQYRAGLIMSAESPASRASQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           ++  G  +  E++++ +SA+T E +  ++ ++FS+ PTL  +GP     P    ++ +L 
Sbjct: 361 LLLFGRPIAKEELMERLSALTIERLTDLSSRMFSTKPTLTAVGPVGTLAP-YEAILDSLP 419

Query: 420 GFRS 423
           G ++
Sbjct: 420 GTQT 423


>gi|306845111|ref|ZP_07477691.1| Insulinase-like peptidase, family M16 [Brucella sp. BO1]
 gi|306274526|gb|EFM56321.1| Insulinase-like peptidase, family M16 [Brucella sp. BO1]
          Length = 430

 Score =  224 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVGNSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|319784683|ref|YP_004144159.1| processing peptidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170571|gb|ADV14109.1| processing peptidase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 430

 Score =  224 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 184/424 (43%), Positives = 274/424 (64%), Gaps = 2/424 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +  I+S  +   +++G+RNER +EHGMAH LEHM FKGT +R
Sbjct: 1   MGVEVSRLSNGLTVATETLQSIESVALGAWVKSGARNERDDEHGMAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A EI  EIE VGG+INA TS+E TSY+A VL + VPLA++I+ D+L  S F+P ++ERE
Sbjct: 61  SAFEIASEIEDVGGEINAATSVETTSYYARVLSDDVPLAVDILADILQESEFDPQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG PET+ SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDIVFDRFTETAYRHQTIGRSILGTPETVKSFTSKQLHDFIERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A+RM +V  G + H+  V +VE               + A YVGG++ + RDL +  ++
Sbjct: 181 GAERMVIVAAGDIKHDNFVREVEKQLGGFRSKADSTIPQYAQYVGGDFREDRDLMDAQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD GV  +
Sbjct: 241 LGFEGRAYHVRDFYASQVLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGVFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + +I  L   I++ +Q   E I Q E+D+  A+  A LI S E    RA +I++Q
Sbjct: 301 HAATGQSDIAELVPVIIDELQKAGEKILQEELDRARAQYRAGLIMSAESPASRASQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           ++  G  +  E++++ +SA+T E +  ++ ++FS+ PTL  +GP     P    ++ +L 
Sbjct: 361 LLLFGRPIAKEELMERLSALTIERLTDLSSRLFSTKPTLTAVGPVGTLAP-YEAILESLA 419

Query: 420 GFRS 423
           G ++
Sbjct: 420 GTQT 423


>gi|254707789|ref|ZP_05169617.1| Insulinase-like peptidase, family M16 [Brucella pinnipedialis
           M163/99/10]
 gi|261315275|ref|ZP_05954472.1| processing peptidase [Brucella pinnipedialis M163/99/10]
 gi|261304301|gb|EEY07798.1| processing peptidase [Brucella pinnipedialis M163/99/10]
          Length = 430

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRKLMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|241203438|ref|YP_002974534.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857328|gb|ACS54995.1| peptidase M16 domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 432

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 192/422 (45%), Positives = 281/422 (66%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK++VPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  TARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE+ ++DQ +GR ILG PET+ SFTP++I  ++SRNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEVAYRDQTLGRAILGTPETVVSFTPQQIRGYLSRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV+HE  +  VE  F     A      M+PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVEHEEFLRMVEDRFANLPTAPSAPPVMEPARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +    + I Q+EI++  A+I A+L+   E    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSADAIHQKEIERARAQIRAQLLMGAESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP +D +    ++  +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITVERLTDLAGRLFYDTVPTLSAIGP-LDQLAPMEDITAS 419

Query: 418 LE 419
           L 
Sbjct: 420 LS 421


>gi|148559996|ref|YP_001258500.1| zinc protease [Brucella ovis ATCC 25840]
 gi|148371253|gb|ABQ61232.1| hypothetical zinc protease [Brucella ovis ATCC 25840]
          Length = 430

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 170/421 (40%), Positives = 272/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++SA + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESAALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|83312488|ref|YP_422752.1| Zn-dependent peptidase [Magnetospirillum magneticum AMB-1]
 gi|82947329|dbj|BAE52193.1| Predicted Zn-dependent peptidase [Magnetospirillum magneticum
           AMB-1]
          Length = 420

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 145/418 (34%), Positives = 258/418 (61%), Gaps = 3/418 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++ +SG+ ++T+ M  +++  + V + AG+R+E  E +G++H LEHM FKGT +R+A
Sbjct: 4   IRETRLNSGLKIVTDPMDTVETVSLGVWVDAGTRHEPAEINGVSHLLEHMAFKGTARRSA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EE++ VGG +NAYT+ +HT+Y+A VLKE   LAL+II D+L NS+    ++ RE+ 
Sbjct: 64  LDIAEEMDAVGGHLNAYTARDHTAYYAKVLKEDAALALDIISDILQNSTLEAEELGREQA 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV++EI  + D   D +   F    + DQ +GRP+LG  E + + + ++++ ++  NY+A
Sbjct: 124 VVVQEINQAIDTPDDIIFDHFQATAYPDQPLGRPVLGSEELVRAMSRDQVMGYLRGNYSA 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM +   G +DH+  V+   + F+         +   A YVGG+Y ++RDL + H+++G
Sbjct: 184 PRMVLSASGRIDHDHLVAAAGAAFSQLPPHHAAVT-DQARYVGGDYREERDLEQVHVVVG 242

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F+G AY   D+Y  ++L+++LG GMSSRLFQEVREKRGL YSI +   +++D G+  + +
Sbjct: 243 FDGVAYDDPDYYSASVLSTLLGGGMSSRLFQEVREKRGLVYSIYSFASSYNDGGLFGVYA 302

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T ++ +  L   + + +  +   + + E+ +  A++ A ++ S E +  R  ++++QV+
Sbjct: 303 GTGEDEVAELIPVMCDEIVKVCGGVNEPEVQRARAQLKASILMSLESTTSRCEQLARQVV 362

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
             G  +   ++++ + AIT ED   VA+++F+ TPT A +GP +  V     +   L 
Sbjct: 363 IYGRPVPVAEVVEKVEAITAEDCARVARRLFAGTPTFAAIGP-LGKVEDFQRVADRLR 419


>gi|163842764|ref|YP_001627168.1| hypothetical protein BSUIS_A0510 [Brucella suis ATCC 23445]
 gi|163673487|gb|ABY37598.1| hypothetical protein BSUIS_A0510 [Brucella suis ATCC 23445]
          Length = 430

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 167/421 (39%), Positives = 269/421 (63%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + DRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SVDRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF   AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEARAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNEPTIAGVGP-VGRLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|13476244|ref|NP_107814.1| processing proteinase [Mesorhizobium loti MAFF303099]
 gi|14027005|dbj|BAB53959.1| processing proteinase [Mesorhizobium loti MAFF303099]
          Length = 430

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 185/424 (43%), Positives = 275/424 (64%), Gaps = 2/424 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +S+ S+G+TV TE +P  +S  +   +++G+RNER EEHGMAH LEHM FKGT +R
Sbjct: 1   MGVEVSRLSNGLTVATETLPSIESVALGAWVKSGARNERDEEHGMAHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA EI  EIE VGG+INA TS+E TSY+A VL + VPLA++I+ D+L  S F+P ++ERE
Sbjct: 61  TAFEIASEIEDVGGEINAATSVETTSYYARVLSDDVPLAVDILADILQESEFDPQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  ++ Q IGR ILG P+T+ SFT +++  F+ R Y
Sbjct: 121 QHVILQEIGAAHDTPDDIVFDRFTETAFRHQTIGRSILGTPDTVKSFTSKQLHDFIERQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A+RM +V  G + H+  V +VE               + A YVGG++ + RDL +  ++
Sbjct: 181 GAERMVIVAAGDIKHDNFVREVEKQLGGFRSKADSTIPQYAQYVGGDFREDRDLMDAQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  +
Sbjct: 241 LGFEGRAYHVRDFYASQVLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGIFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT + +I  L   I++ +Q   ENI Q E+D+  A+  A LI S E    RA +I++Q
Sbjct: 301 HAATGQSDIAELVPVIIDELQKAGENILQEELDRARAQYRAGLIMSAESPASRASQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           ++  G  +  E++++ +SA+T E +  ++ ++FS+ PTL  +GP     P    ++ +L 
Sbjct: 361 LLLFGRPIAKEELMERLSALTVERLTDLSSRMFSTKPTLTAVGPVGTLAP-YEAILDSLP 419

Query: 420 GFRS 423
           G ++
Sbjct: 420 GTQT 423


>gi|328545004|ref|YP_004305113.1| peptidase M16-like protein [polymorphum gilvum SL003B-26A1]
 gi|326414746|gb|ADZ71809.1| Peptidase M16-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 428

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 175/420 (41%), Positives = 258/420 (61%), Gaps = 4/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R +   +G+TVIT+ MP + +A + V +R GSR+E  +E+G+ H LEHM FKGTT R
Sbjct: 1   MEVRRTTLDNGLTVITDRMPHLKTAALGVWVRTGSRSETPDENGITHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA+ I E+IE VGG++NA TS+EHT+Y+A VL E VPLAL+++ D+L NS F+P ++ RE
Sbjct: 61  TARAIAEQIEAVGGELNASTSVEHTNYYARVLAEDVPLALDLLSDILQNSVFDPEELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG ++D   D     F E  W DQ IGRPILG P T+S FT + + +++   Y
Sbjct: 121 QHVILQEIGAAQDSPEDRAFDLFQEAAWPDQAIGRPILGTPATVSGFTRDALDTYLKSRY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M +   GAVDH+  V + E  F+  S         P  Y GGE    +DL E  ++
Sbjct: 181 RGPDMVLAAAGAVDHDDIVRRAEDKFSGFSAEPAA-PCVPGFYRGGESRLAKDLMEAQIL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G  Y+S D+Y   ILAS+LG GMSSRLFQEVRE RGLCY+I + H  FSD G+  +
Sbjct: 240 IGFEGRPYKSDDYYAIQILASVLGGGMSSRLFQEVRETRGLCYAIYSFHWAFSDTGLFGL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E+I  L   ++  ++    +I + E+ +  A+I A L+ + E    RA +I++Q
Sbjct: 300 HAATGEEDIGELMPVVLGELERTAADITEEEVARARAQIRAGLMMALESPAARAGQIARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  L  E+I   I A++ + +  VA + F+ S PTL  +GP     P   ++   L
Sbjct: 360 ILIHGRTLSLEEISRKIDAVSADMVRRVAAETFAGSAPTLTGVGPVSGLAP-VGDIAARL 418


>gi|310815265|ref|YP_003963229.1| peptidase, M16 family protein [Ketogulonicigenium vulgare Y25]
 gi|308754000|gb|ADO41929.1| peptidase, M16 family protein [Ketogulonicigenium vulgare Y25]
          Length = 421

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 158/420 (37%), Positives = 241/420 (57%), Gaps = 3/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++I   S+G  + TEVMP   SA + + + AG R+E  +E+G+AHFLEHM FKGT  R
Sbjct: 1   MTVQIHTLSNGFRIATEVMPGLQSATIGIWVSAGGRHEAPQENGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL     LAL+I+ D+L N +F+ ++IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSRETTAYYARVLSGDTALALDIVADILLNPTFDLNEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E+ ++DQ IGR ILG  E +SSF    +  FV+++Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEVCYQDQAIGRSILGPAERVSSFQQADLRRFVAQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVG-GEYIQKRDLAEEHM 238
           T ++M +   G VDH+  V Q ES F     A    +++PA +        K+ L + H 
Sbjct: 181 TPEQMILCAAGGVDHDAIVRQAESLFGHLPPANRLSAIEPARFTVGERREIKKSLEQVHF 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G   ++ D Y   + ++ LG GMSSRLFQEVREKRGLCY+I A      D G   
Sbjct: 241 ALAIEGPGVRASDIYTAQLWSTALGGGMSSRLFQEVREKRGLCYTIFAQTGASEDTGATT 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I + T+ E I+ L+   +  +    +++ Q E+D+  A++ A L+  QE S  RA  +++
Sbjct: 301 IYAGTSSEQILDLSRITMTELARAADDLSQAELDRARAQMKAGLLMGQESSSNRAERLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
            +   G +    + +  I A+   ++ G A ++ ++  +LA+ GP  D  P+ ++L   L
Sbjct: 361 MLALWGRVPDLSEAVAKIDAVNLSELRGFAAQMAAAPMSLALYGP-ADQAPSLADLKARL 419


>gi|23501384|ref|NP_697511.1| processing protease [Brucella suis 1330]
 gi|161618454|ref|YP_001592341.1| hypothetical protein BCAN_A0490 [Brucella canis ATCC 23365]
 gi|254703832|ref|ZP_05165660.1| hypothetical protein Bsuib36_07882 [Brucella suis bv. 3 str. 686]
 gi|260566914|ref|ZP_05837384.1| processing peptidase [Brucella suis bv. 4 str. 40]
 gi|261754483|ref|ZP_05998192.1| processing peptidase [Brucella suis bv. 3 str. 686]
 gi|23347279|gb|AAN29426.1| processing protease [Brucella suis 1330]
 gi|161335265|gb|ABX61570.1| hypothetical protein BCAN_A0490 [Brucella canis ATCC 23365]
 gi|260156432|gb|EEW91512.1| processing peptidase [Brucella suis bv. 4 str. 40]
 gi|261744236|gb|EEY32162.1| processing peptidase [Brucella suis bv. 3 str. 686]
          Length = 430

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 167/421 (39%), Positives = 269/421 (63%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++ G+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKVGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + DRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SVDRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F ++ PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDLAGRLFLNNKPTIAGVGP-VGCLMSFDRLTDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|260431064|ref|ZP_05785035.1| processing peptidase subunit beta [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414892|gb|EEX08151.1| processing peptidase subunit beta [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 420

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 150/418 (35%), Positives = 239/418 (57%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R+ + ++G  +++E MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRLDQLTNGFRIVSEQMPGLQSAAIGIWVTAGGRHERIEQNGIAHFLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VLK+ V LA+++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLKDDVALAMDVIGDIVLNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  ++DQ +GR ILG  E +S+F+ + + +FV+ +Y
Sbjct: 121 RGVILQEIGQAHDTPDDVIFDWLQEESYRDQPLGRTILGPTERVSAFSRDDLSTFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAVDH+  +   E  F      K     +PA + GGE  + + L + H  
Sbjct: 181 APDQMILSAAGAVDHDQLMKLAEEMFGHLQPRKG-LPAEPARFTGGEARRDKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L      Y+  + Y   I ++ LG GMSSRLFQEVRE RGLCY+I A    ++D G   I
Sbjct: 240 LALESPGYRDDEIYTAQIYSTALGGGMSSRLFQEVRETRGLCYTIFAQTSAYADTGTTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L +  ++ ++   E++   E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSADQVGELATITIDEMKRAAEDMSPEEVARARAQMKAGILMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E+ +  I A++  D+   A+K+    P    L  P+   PT  +L   
Sbjct: 360 VQIWGRVPPLEETVAKIDAVSTADVRAFAEKMAVQAPAALALYGPVGGAPTLEQLQER 417


>gi|258542754|ref|YP_003188187.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633832|dbj|BAH99807.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636891|dbj|BAI02860.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639944|dbj|BAI05906.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643000|dbj|BAI08955.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646055|dbj|BAI12003.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649108|dbj|BAI15049.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652095|dbj|BAI18029.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655152|dbj|BAI21079.1| processing protease protein M16 family [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 421

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 160/421 (38%), Positives = 254/421 (60%), Gaps = 5/421 (1%)

Query: 1   MN--LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           M   + I++  SG+TV+TE M  +++      +  G+R+E  EE+G++HFLEHM FKGTT
Sbjct: 1   MTDPINITRLPSGLTVVTERMERVETVSFGAYVATGTRHETAEENGVSHFLEHMAFKGTT 60

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            R+A  I EEIE VGG INAYT+ E T Y+  +LKE++ L ++IIGD+L+NS+F+P+++E
Sbjct: 61  SRSALRIAEEIENVGGHINAYTAREQTVYYVKLLKENLGLGVDIIGDILTNSTFDPAEME 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           RER V+L+EIG + D   D +   F E  + +Q +GRP LG    I   + E ++ ++  
Sbjct: 121 RERGVILQEIGQANDTPDDVVFDHFQETAFPNQPMGRPTLGTENLIREMSRETLMRYMKA 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           +YT D M V   G + HE  V +VE +F   S +    +   A Y GGE+ Q ++L + H
Sbjct: 181 HYTTDNMIVAAAGNLHHEDVVQRVEQHFANLSSSSAPAT-LSARYGGGEFRQVKELDQAH 239

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LGF    Y   D++   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F+D G+ 
Sbjct: 240 VVLGFPSFGYGDPDYFPALLLSTVLGGGMSSRLFQEIREKRGLVYSVYSFNAPFTDGGIF 299

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T  +    L    +E +  +   + + E+ +  A++ A L+ S E +  R  +I+
Sbjct: 300 GIYAGTGAKECAELVPVTLEELNKIQRYVTEEELVRARAQLKASLLMSLESTGSRCEQIA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +Q+   G I+ + + +  I A+   DI   A +IF+ TPTLA LGP ++H+P+   +   
Sbjct: 360 RQLQIFGRIIPTAETVSKIEAVNAGDICRAASRIFTGTPTLAALGP-IEHIPSLQIITEK 418

Query: 418 L 418
           L
Sbjct: 419 L 419


>gi|147677613|ref|YP_001211828.1| Zn-dependent peptidase [Pelotomaculum thermopropionicum SI]
 gi|146273710|dbj|BAF59459.1| predicted Zn-dependent peptidases [Pelotomaculum thermopropionicum
           SI]
          Length = 424

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 127/404 (31%), Positives = 227/404 (56%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G+ ++TE +P + S  V   +  GSR+E  E +G++HF+EH++FKGT KRTA
Sbjct: 2   YQKVTLDNGVHILTEDVPHVRSVAVGYWVDVGSRDENPEINGISHFIEHLMFKGTEKRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E ++ VGG +NA+T+ E+T Y+A VL EH  LA++++ DML +S F   DIERERN
Sbjct: 62  KDIAEALDAVGGQLNAFTTKEYTCYYARVLDEHFDLAVDLLSDMLFSSKFAAHDIERERN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M ED   + +   F+  +W+   +GRPI+G  E I+  + + I++F + +Y  
Sbjct: 122 VIIEEIKMYEDAPDELVHDIFAGSLWQGHALGRPIIGTSEVIARLSRDDIVNFYNTHYKP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            ++ V   G + HE  V ++   F     +     M           + +D  + H+ +G
Sbjct: 182 GKIVVAVAGNIRHEEVVKKLRPIFESREGSVQSREMTSPAPSCEVTCRNKDTEQVHLCVG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G +      Y+  ++ ++LG G+SSRLFQE+REKRGL YS+ ++H ++ D G+  I +
Sbjct: 242 TPGLSLDHEKIYVFQVINTVLGGGLSSRLFQEIREKRGLVYSVYSYHTSYHDTGLFCIYA 301

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             ++ N+  +   I + V+      +++ E+ +   ++   L  S E    R   + K  
Sbjct: 302 GLSRHNVDEVLELIFKQVEDIQKNGVKEEELQRAKDQLKGNLYLSLENVSTRMSRLGKSQ 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP 403
           ++ G ++  E+I+  ++ +T +++  +A K+      +LA +GP
Sbjct: 362 LYLGKVVPPEEIVARVNMVTADEVQELAGKMLKPEYFSLAAIGP 405


>gi|89895252|ref|YP_518739.1| hypothetical protein DSY2506 [Desulfitobacterium hafniense Y51]
 gi|89334700|dbj|BAE84295.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 424

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 128/421 (30%), Positives = 228/421 (54%), Gaps = 4/421 (0%)

Query: 3   LRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            + +   +G+ +ITE    + S  V + + AGSR+E++   G++HF+EHM FKGT  RTA
Sbjct: 2   YQKTVLPNGVRIITEEIDYVRSVAVGIWVGAGSRDEKEGYEGISHFIEHMFFKGTKNRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E +E VGG +NA+T+ E+T Y+A VL E + LA++++ DM   S F+ ++IE+E+ 
Sbjct: 62  RDIAESLEAVGGQLNAFTTKEYTCYYAKVLDEDMDLAMDVLNDMFFESLFDENEIEKEKK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEI M ED   + +   FS+ VW D  +GRPILG  E++   + EKI++F+  +Y  
Sbjct: 122 VVIEEIKMYEDSPDELIHDLFSDHVWNDHPLGRPILGTEESVKGLSREKILTFMDHHYAP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G + H+  + ++   +        +   +       + +  +D  + H++LG
Sbjct: 182 DNLVIAVAGKIKHDEVLKKLAPLYGEFKRGGRRILEETPKGQQVQEMILKDTEQMHLILG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G   +  D Y  +IL +ILG G+SSRLFQE+RE+RG+ Y++ ++H  + D G+  I +
Sbjct: 242 VPGLGQEDEDLYPMHILNNILGGGLSSRLFQEIREQRGMAYTVFSYHSTYVDTGLFAIYA 301

Query: 302 ATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T   N   +   +  E++      I Q E+ +  ++I   L    E +  R   + K  
Sbjct: 302 GTTPSNSQEVVECVLAEILDIKKNGISQSELQRTKSQIKGGLYLGLESASSRMSRLGKTE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHALE 419
           +    ++  E++++ +  +T ED   V  +++     +L +LGP  + V     L   + 
Sbjct: 362 LTYNRVISPEEVVEKLERVTVEDTKRVINRLWKRDKISLLMLGPAGNEV-DMDALFEKIG 420

Query: 420 G 420
            
Sbjct: 421 W 421


>gi|146276673|ref|YP_001166832.1| processing peptidase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554914|gb|ABP69527.1| processing peptidase [Rhodobacter sphaeroides ATCC 17025]
          Length = 419

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 147/419 (35%), Positives = 236/419 (56%), Gaps = 3/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP   SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWITAGGRHERPEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I EEIE VGG INAYTS E T+++A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  TALQIAEEIEDVGGYINAYTSREMTAFYARVLEADTALALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +SSFT + +  FV   Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQSFGRTILGPEERVSSFTRDDLTRFVGEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH+  ++Q ++ F        +  M+ A ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHQKILAQAQALFGHLKPVG-RRPMQRADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F   +Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPSYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++   +++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTIDELRRATDDMSEAEVARARAQLKAGLLMGLESPSSRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +   G +   ++ ++ I ++T   +   A+++  +   LA+ GP  +  P   ++   L
Sbjct: 360 LAIWGRVPGVDEAVEKIDSVTVAAVRDYAERMAQARSALALYGP-AEQAPALQQIRERL 417


>gi|317121864|ref|YP_004101867.1| peptidase M16 domain protein [Thermaerobacter marianensis DSM
           12885]
 gi|315591844|gb|ADU51140.1| peptidase M16 domain protein [Thermaerobacter marianensis DSM
           12885]
          Length = 433

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 125/409 (30%), Positives = 218/409 (53%), Gaps = 2/409 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            RI+   +G+ V++E +P   S  V V  R GSR+E  E  G+AH LEHM FKGT  R+A
Sbjct: 19  YRITALPNGLRVVSETVPGVRSVTVGVWFRTGSRDEPDEHAGIAHLLEHMAFKGTQTRSA 78

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +E+ E +++VGG +NAYTS E TS++  VL +H  LA+E++ DML    F+P D+E+E+ 
Sbjct: 79  RELAELVDRVGGQMNAYTSKEDTSFYIRVLDDHFGLAMEVLADMLLRPRFDPGDLEKEKR 138

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M EDD  D +     +++W    +GRP++G+  T+ +     ++ F  ++Y  
Sbjct: 139 VILEELKMYEDDPEDVVQDMAVQILWPGHPLGRPVIGREATVGAVDRGVLVDFWRQHYEP 198

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            R  +   G V+H+  V +V+ +F        +   +P      +  +++ + + H+ + 
Sbjct: 199 GRAVIAVAGHVEHQRVVEEVQRWFGGWRRTGERVPYQPPAPQPADAWRQKAIEQVHLCVA 258

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
               AY S D Y   +LA+ILG   SSRLFQ +RE  GL YS+   H  +SD G+  I +
Sbjct: 259 APAAAYGSDDLYPELVLANILGGASSSRLFQVIREDHGLAYSVYTFHGGYSDAGLFGIYA 318

Query: 302 ATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           AT+ E    +      E  +   + + + E+ +   +I A L+   E +  R   + + +
Sbjct: 319 ATSPETARQVMELIARECRKVRQDGVTRDELARTRDQIKANLLMGLESTSQRMNRLGRTL 378

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +    ++  E+++  + A+T E ++  A+++            P + +P
Sbjct: 379 LMLDRVVTVEEVVARVEAVTAEQVMAAAERLLDPARWAVAGAGPAESMP 427


>gi|219669685|ref|YP_002460120.1| peptidase M16 domain protein [Desulfitobacterium hafniense DCB-2]
 gi|219539945|gb|ACL21684.1| peptidase M16 domain protein [Desulfitobacterium hafniense DCB-2]
          Length = 424

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 129/421 (30%), Positives = 227/421 (53%), Gaps = 4/421 (0%)

Query: 3   LRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            + +   +G+ +ITE    + S  V + + AGSR+ER+   G++HF+EHM FKGT  RTA
Sbjct: 2   YQKTVLPNGVRIITEEIDYVRSVAVGIWVGAGSRDEREGYEGISHFIEHMFFKGTKNRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E +E VGG +NA+T+ E+T Y+A VL E + LA++++ DM   S F+ ++IE+E+ 
Sbjct: 62  RDIAESLEAVGGQLNAFTTKEYTCYYAKVLDEDMDLAMDVLNDMFFESLFDENEIEKEKK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEI M ED   + +   FS+ VW D  +GRPILG  E++   + EKI+ F+  +Y  
Sbjct: 122 VVIEEIKMYEDSPDELIHDLFSDHVWNDHPLGRPILGTEESVKGLSREKILDFMDHHYAP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G + H+  + ++   +        +   +       + +  +D  + H++LG
Sbjct: 182 DNLVIAVAGKIKHDEVLKKLAPLYGEFKRGGRRILEETPKGQQVQEMILKDTEQMHLILG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G   +  D Y  +IL +ILG G+SSRLFQE+RE+RG+ Y++ ++H  + D G+  I +
Sbjct: 242 VPGLGQEDEDLYPMHILNNILGGGLSSRLFQEIREQRGMAYTVFSYHSTYVDTGLFAIYA 301

Query: 302 ATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T   N   +   +  E++      I Q E+ +  ++I   L    E +  R   + K  
Sbjct: 302 GTTPSNSQEVVECVLAEILDIKKNGISQSELQRTKSQIKGGLYLGLESASSRMSRLGKTE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHALE 419
           +    ++  E++++ +  +T ED   V  +++     +L +LGP  + V     L   + 
Sbjct: 362 LTYNRVISPEEVVEKLERVTVEDTKRVINRLWKRDKISLLMLGPAGNEV-DMDALFEKIG 420

Query: 420 G 420
            
Sbjct: 421 W 421


>gi|321470922|gb|EFX81896.1| hypothetical protein DAPPUDRAFT_302792 [Daphnia pulex]
          Length = 478

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 108/431 (25%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E     +A V + I AGSRNE +  +G+AHFLEHM FKGT KR+  +
Sbjct: 48  RLTVLDNGLRVASEDSGAPTATVGIWIDAGSRNETEANNGVAHFLEHMAFKGTGKRSQTD 107

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L E V  ++EI+ D++ NS     +IERER V+
Sbjct: 108 LELEIENMGAHLNAYTSREQTVFYAKCLSEDVGKSIEILSDIIQNSKLGEPEIERERGVI 167

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  + I S +   +++++  NY A R
Sbjct: 168 LREMQEVETNLQEVVFDHLHSTAYQGTPLGRTILGPTQNIKSLSRADLVTYIKNNYGASR 227

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           M +   G + HE  V   +      S    AKI    K         ++  D+   H+ +
Sbjct: 228 MVLAAAGGIKHEDLVELAQKSLGSLSNSFDAKITAPTKCRFTGSEIRVRDDDMPFAHIAI 287

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFS 292
              GC +   D +   +  +I+G    S+               +  LC+S  + +  + 
Sbjct: 288 AVEGCGWTDADNFPLMVANTIIGSWDRSQGGGANLASNLASYSAQSNLCHSFQSFNTCYK 347

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I          A+  +I      L       E+++    +   ++   + +   
Sbjct: 348 DTGLWGIYFVCEPMKCEAMLYNIQSEWMRLCTAPTPTEVERAKNLLKTSMLLQLDGTTPV 407

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             ++ +Q++  G  L   ++   I ++T  D+     K      P +A +GP ++ +P  
Sbjct: 408 CEDVGRQMLCYGRRLPLHELEARIDSVTPADVRDACNKYIYDRCPAVAAVGP-VEALPDY 466

Query: 412 SELIHALEGFR 422
           + +  ++   R
Sbjct: 467 NRIRSSMYWLR 477


>gi|126729106|ref|ZP_01744920.1| peptidase, M16 family protein [Sagittula stellata E-37]
 gi|126710096|gb|EBA09148.1| peptidase, M16 family protein [Sagittula stellata E-37]
          Length = 420

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 157/419 (37%), Positives = 241/419 (57%), Gaps = 4/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++IS  S+G  ++TE MP   SA + + + AG R+ER E++G+AHFLEHM FKGTT+R
Sbjct: 1   MTVQISTLSNGFRIVTEKMPGLQSAALGLWVTAGGRHERVEQNGIAHFLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VLK    LA++++ D+L N  F+  +I+ E
Sbjct: 61  TALQIAESIEDVGGYINAYTSREVTAYYARVLKADTALAVDVLADILRNPIFDEKEIDTE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  + +Q IGR ILG+ E + +F+   +  FV  +Y
Sbjct: 121 RHVILQEIGQAHDTPDDIIFDWLQEKAYPNQPIGRTILGEAERVEAFSRADLQQFVHEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V Q E  F        + + + A++ GGE  + +DL + HM 
Sbjct: 181 GPGQMILSAAGAVDHDALVKQAEGLFGDLLPRPGRNA-EGALFHGGEMRRVKDLEQAHMA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+   FY   I A  LG GMSSRLFQE+REKRGLCY+I A    ++D G+  I
Sbjct: 240 LAFEAPGYRDPGFYTAQIYAIALGGGMSSRLFQEIREKRGLCYTIFAQSGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    V+ ++   + +   EI++  +++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGSEMGELLDLTVDEMKRAADTMSDAEIERARSQMKAGLLMGLESPSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAK-KIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E+ +  I A+T E ++  A+ ++  S   LA+ GP +D  P+  +L   
Sbjct: 360 VQIWGKVPPIEETVARIDAVTREGVLAFAEAQVAQSAAALALYGP-VDGAPSLEKLQAR 417


>gi|86356624|ref|YP_468516.1| processing protease protein [Rhizobium etli CFN 42]
 gi|86280726|gb|ABC89789.1| probable processing protease protein [Rhizobium etli CFN 42]
          Length = 431

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 189/422 (44%), Positives = 280/422 (66%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE  +EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETADEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGG++NA TS E TSY+A VLK+HVPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  SAREIAEEIEDVGGEVNAATSTETTSYYARVLKDHVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  +FSE  ++DQ +GR ILG P+T+ SFTP++I +++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDKFSEAAYRDQTLGRAILGTPQTVVSFTPQQIRTYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCS-VAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDH+  +  VE  F            M+ A YVGG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVDHQEFLRMVEQRFASLPTQPSAPPVMEAARYVGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +      I Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSANEIHQKEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + + ++++ +  IT + +  +A ++F  T PTL+ +GP ++ +    ++I +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIQRLTDLAGRLFFDTVPTLSAIGP-LEQLAPMEDIIAS 419

Query: 418 LE 419
           L 
Sbjct: 420 LS 421


>gi|114328918|ref|YP_746075.1| M16 family peptidase [Granulibacter bethesdensis CGDNIH1]
 gi|114317092|gb|ABI63152.1| peptidase, M16 family [Granulibacter bethesdensis CGDNIH1]
          Length = 426

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 154/417 (36%), Positives = 250/417 (59%), Gaps = 3/417 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R+++  SG+TV+TE M  +++      +  G+R+E   E+G++HFLEHM FKGT +R+A
Sbjct: 10  VRLTRLPSGLTVVTERMERVETVSFGAYVGVGTRHETAAENGVSHFLEHMAFKGTERRSA 69

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EEIE VGG INAYT+ E T+Y+  VLKE+  LA +IIGD+L++S+F+ ++ ERER 
Sbjct: 70  AQIAEEIEAVGGHINAYTAREQTAYYVKVLKENTDLAADIIGDILTHSTFDAAEFERERG 129

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F E  +  Q +GRP LG    I     + +  ++ R+Y A
Sbjct: 130 VILQEIGQANDTPDDIIFDHFQETAFPGQPMGRPTLGTETIIRGLERDAVAGYMRRHYAA 189

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             M V   GA++H+  V  V+ +F     +       PA Y GGE+ + RDL + H++LG
Sbjct: 190 SNMVVAAAGALEHDRIVDLVQQHFADLPAS-TALDASPADYKGGEFRENRDLDQVHIVLG 248

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F   +Y   D++ T +L+++LG GMSSRLFQE+REKRGL YS+      F D G+  I +
Sbjct: 249 FPSVSYADPDYFPTMLLSTLLGGGMSSRLFQEIREKRGLVYSVYTFSLPFLDGGLFGIYA 308

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T ++    L    +  +  +  ++ ++E+ +  A++ A ++ S E +  R  +I++Q  
Sbjct: 309 GTGEQEAKELIPVTLAELLRVQNDVTEQELQRARAQVKASVLMSLESTGSRCEQIARQYQ 368

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
             G ++ + + +  I A+T +D+  VA  +F ++PTLA LGP   HVP  + +  +L
Sbjct: 369 IFGRLVPTSETVAKIDAVTLDDVRRVAAALFRASPTLATLGP-AGHVPDLARISGSL 424


>gi|304393517|ref|ZP_07375445.1| processing peptidase subunit beta [Ahrensia sp. R2A130]
 gi|303294524|gb|EFL88896.1| processing peptidase subunit beta [Ahrensia sp. R2A130]
          Length = 448

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 173/419 (41%), Positives = 275/419 (65%), Gaps = 4/419 (0%)

Query: 2   NLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+ +++ S+G+TV+T+ M  ++SA + V ++AGSR+ER  EHG+AH LEHM FKGT  RT
Sbjct: 23  NVEVTRLSNGLTVVTDRMQHLESAALGVWVKAGSRDERASEHGIAHLLEHMAFKGTASRT 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I  +IE VGGD+NA TS E TS++A VLK+ VPLA++I+ D+L+NS F+ +++ RE+
Sbjct: 83  ARDIAVQIENVGGDVNAATSAETTSFYARVLKDDVPLAVDILADILNNSLFDENELAREQ 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+EIG + D+  D +   F  + ++DQ +GRPI+G PET+SSF    I S++S +Y 
Sbjct: 143 HVILQEIGAAHDNPEDIVFDEFQAVAFRDQALGRPIMGTPETVSSFRANDIRSYLSDHYH 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
              M +   G VDH+  V   E  F      ++    +   Y GGE +  RD  E  +++
Sbjct: 203 GPNMVLAASGNVDHDAIVKMAEKRFAHFGN-QLAREPEKGFYTGGEALLVRDHQEAQIVM 261

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G AY +RDFY +N+L+ +LG GMSSRLFQE+REKRGLCYSI A H+ +SD G+  + 
Sbjct: 262 GFEGRAYHARDFYASNVLSMMLGGGMSSRLFQEIREKRGLCYSIYAFHQGYSDTGLFGVH 321

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           +AT + ++  L   I++ ++   E I Q E+D+  A+I A L+ S E    RA +I++Q+
Sbjct: 322 AATEESDLGELMPVIIDELKKAGEGISQDELDRARAQISAGLLMSLESPASRAGQIARQI 381

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHAL 418
           +  G  + ++++++ ++A+T E +  ++ ++F    PT+A +GP +  VP  + L  AL
Sbjct: 382 LLFGRPIPNDELMERLNALTIERLRDLSARLFIENMPTIAAIGP-VSGVPDQAALADAL 439


>gi|296132903|ref|YP_003640150.1| peptidase M16 domain protein [Thermincola sp. JR]
 gi|296031481|gb|ADG82249.1| peptidase M16 domain protein [Thermincola potens JR]
          Length = 414

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 129/400 (32%), Positives = 219/400 (54%), Gaps = 3/400 (0%)

Query: 7   KTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           +  +GI V+TE +P + S  + + +  GSR+E  E  G+AHF+EHM+FKGT  R+AK+I 
Sbjct: 6   QLPNGIRVVTEEIPHVRSVSIGLWVGVGSRDETDENSGIAHFIEHMMFKGTKNRSAKQIA 65

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           EE++ +GG +NA+T+ E+T Y+A  L EH P +L ++ DM  NS ++P +I++ERNV++E
Sbjct: 66  EELDAIGGQLNAFTAKEYTCYYAKTLDEHFPKSLNLLADMFFNSLYDPQEIDKERNVIIE 125

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M ED   + +   F+  +W +  +GR I+G  E +       IISF+   YT D++ 
Sbjct: 126 EINMYEDAPDELIHDLFASTLWNNHPLGRSIIGTREVVEKINRADIISFLKTFYTPDQLV 185

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
           +   G V H+  +  +   F+         +    V V     +K+D  + H+ +G  G 
Sbjct: 186 IAVAGNVKHDRVMELITPLFDRMEGKSTARNYAKPVPVYQVATKKKDTEQVHLCIGVPGL 245

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
                  Y   +L SILG G+SSRLFQE+RE+RGL YS+ ++H ++ D G+  I +  + 
Sbjct: 246 PLDHEQIYSLYVLNSILGGGISSRLFQEIREERGLAYSVYSYHNSYKDAGLFSIYTGLSL 305

Query: 306 ENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCG 364
           +NI  +   I   ++ +      + E+ +   ++   L    E    R   I K  +  G
Sbjct: 306 KNIGPVVELITRELKQIKAGKVTEEEVFRAKEQLKGSLYLGLENVSNRMSRIGKSELCLG 365

Query: 365 SILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
            I+  E+ ++ I+ +  +D+  +A+++F S    L  +GP
Sbjct: 366 RIITPEEAVEKINRVGIKDVQLLAEQLFASDKMVLTSIGP 405


>gi|150395759|ref|YP_001326226.1| processing peptidase [Sinorhizobium medicae WSM419]
 gi|150027274|gb|ABR59391.1| processing peptidase [Sinorhizobium medicae WSM419]
          Length = 434

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 189/424 (44%), Positives = 283/424 (66%), Gaps = 4/424 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R+A
Sbjct: 4   VECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTKRRSA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EEIE VGG++NA TS E TSY+A VLK+HVPLA+ I+ D+L+ S F   ++ RE+ 
Sbjct: 64  RQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAINILADILTESHFEADELRREKQ 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG ++D   D +  RF+E  ++ Q IGRPILG PET+ SF+ ++I  ++ RNYT 
Sbjct: 124 VILQEIGAADDTPDDVVFDRFAETAYRGQTIGRPILGTPETVMSFSADQIRQYLGRNYTT 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQKRDLAEEHMML 240
           DR ++V  GAVDH+  + QVE  F           +     Y GG+  + RDL +  ++L
Sbjct: 184 DRTFIVAAGAVDHDTILRQVEERFASLPAEPASAPVIETARYTGGDSRESRDLMDAQVLL 243

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  + 
Sbjct: 244 GFEGRAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFGVH 303

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           +AT  EN+  L   IVE ++    +IEQ+EI++  A+I A+L+  QE    RA +I++Q+
Sbjct: 304 AATGGENLPELMPVIVEELRKSSLSIEQQEIERARAQIRAQLLMGQESPAARAGQIARQM 363

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHALE 419
           M  G  + +E++++ +S IT E +  +A ++F  T PTL+ +GP ++H+   ++++ +L 
Sbjct: 364 MLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIGP-LEHLAPLNDILSSLT 422

Query: 420 GFRS 423
             ++
Sbjct: 423 TTKA 426


>gi|83943957|ref|ZP_00956414.1| peptidase, M16 family protein [Sulfitobacter sp. EE-36]
 gi|83845204|gb|EAP83084.1| peptidase, M16 family protein [Sulfitobacter sp. EE-36]
          Length = 420

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 158/418 (37%), Positives = 235/418 (56%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+L+  + S+G  ++TE MP   SA + V + AG+R+E   ++G+AHFLEHM FKGT KR
Sbjct: 1   MSLQQHRLSNGFRIVTEHMPGLASASIGVWVSAGARHETATQNGIAHFLEHMAFKGTAKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+ +I E IE VGG INAYTS E T+Y+  VL+  V L L++I D+L N   +  +IE E
Sbjct: 61  TSLQIAEAIEDVGGYINAYTSREVTAYYVRVLENDVSLGLDVIADILRNPVLDNGEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + +Q IGR ILG  E +S+F+ E +  F+S++Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEKAYPNQPIGRTILGPSERVSNFSREDLSGFISQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAVDH+  V   E  F       +   +  A + GGE  Q + L + H  
Sbjct: 181 GPDQMILAAAGAVDHDEIVRLAEQLFGDMPPKPL-FDVDAAKFSGGEVRQLKPLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y++ D Y+  I AS LG GMSSRLFQEVRE RGLCY+I A    ++D G++ I
Sbjct: 240 LGFEAPGYRADDIYVAQIYASALGGGMSSRLFQEVRENRGLCYTIFAQAGAYADTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++    ++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEQLPELAGITIDEMKRAASDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +     +   E+ I  I A+T  D+   A+ I +S P    L  P+D  PT  EL   
Sbjct: 360 IQIWDRVPPLEETIAQIDAVTTGDVRDFAQNIAASAPAALALYGPVDGAPTLEELQER 417


>gi|330993427|ref|ZP_08317362.1| Putative zinc protease [Gluconacetobacter sp. SXCC-1]
 gi|329759457|gb|EGG75966.1| Putative zinc protease [Gluconacetobacter sp. SXCC-1]
          Length = 421

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 151/421 (35%), Positives = 247/421 (58%), Gaps = 5/421 (1%)

Query: 1   MN--LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           M   + +++  SG+T++TE M  +++  +   + AG+ NE   E+G++HFLEHM FKGT+
Sbjct: 1   MTDLINVTRLDSGLTIVTERMDRVETVSLGAYVAAGTCNETTPENGVSHFLEHMAFKGTS 60

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            RTA  I EEIE VGG INAYT+ EHT+Y+  +LKE++ L  +IIGD+L++SS  P ++E
Sbjct: 61  TRTAAGIAEEIENVGGHINAYTAREHTAYYVKLLKENLDLGADIIGDILTHSSLAPDELE 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           RER V+L+EIG + D   D +   F E  + DQ +GRP LG    I   +   +++++  
Sbjct: 121 RERGVILQEIGQANDTPDDIVFDHFQETAFPDQAMGRPTLGTEAGIQGMSRATLVNYMGT 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           +YTA    +   G ++H   V  V+ +F       +        YVGG + ++RDL + H
Sbjct: 181 HYTAGNTIIAAAGNLEHARVVDLVQRHFADLPTGTVP-PQPAVNYVGGAFTRERDLDQAH 239

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LGF    Y   D+Y   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F   G+ 
Sbjct: 240 IVLGFPSMPYGDMDYYPALLLSTLLGGGMSSRLFQEIREKRGLVYSVYSFNAPFRQGGLF 299

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T +  +  L    +E ++ +   +   E+ +  A++ + L+ S E +  R  +++
Sbjct: 300 GIYAGTGEAQVADLVPVTLEELRKVRHTVNAAELARARAQLKSSLLMSLESTGSRCEQLA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +Q+     ++ + + +  I A+T  D+  VA +IFS  PTLA LGP + +VP+   +  A
Sbjct: 360 RQLQIFDRLIPTAETVRRIDAVTIADVQRVATRIFSGRPTLASLGP-VSNVPSLDSIAGA 418

Query: 418 L 418
           L
Sbjct: 419 L 419


>gi|116250834|ref|YP_766672.1| peptidase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255482|emb|CAK06558.1| putative peptidase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 432

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 190/421 (45%), Positives = 279/421 (66%), Gaps = 4/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA++I EEIE VGG++NA TS E TSY+A VLK++VPLA++I+ D+L+ S+F   ++ERE
Sbjct: 61  TARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  RFSE  ++DQ +GR ILG PET+ SFTP++I  ++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRAILGTPETVVSFTPQQIRGYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAV+HE  +  VE  F     A      M+PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVATGAVEHEEFLRMVEDRFASLPTAPSAPPVMEPARYIGGSVREPRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G  Y +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   I++ +    + I Q+EI++  A+I A+L+   E    RA +I++
Sbjct: 301 IHAATGGENLPELVPVIIDELHKSADAIHQKEIERARAQIRAQLLMGAESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + + ++++ +  IT E +  +A ++F  T PTL+ +GP ++ +    ++  +
Sbjct: 361 QMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGP-LEQLAPMEDITAS 419

Query: 418 L 418
           L
Sbjct: 420 L 420


>gi|163733561|ref|ZP_02141004.1| peptidase, M16 family, putative [Roseobacter litoralis Och 149]
 gi|161393349|gb|EDQ17675.1| peptidase, M16 family, putative [Roseobacter litoralis Och 149]
          Length = 420

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 152/418 (36%), Positives = 231/418 (55%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M L   +  +G  ++TE MP   SA + V + AG+R+E  +++G+AHFLEHM FKGT +R
Sbjct: 1   MTLNQHRLPNGFRIVTEHMPGLASASIGVWVTAGARHETPKQNGIAHFLEHMAFKGTKQR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VL+  VPLAL++I D+L N +   ++IE E
Sbjct: 61  TALQIAESIEDVGGYINAYTSREVTAYYARVLQNDVPLALDVIADILLNPTLEEAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG S D   D +     E  + D  +GR ILG  E +S F+   +  F+ ++Y
Sbjct: 121 RGVILQEIGQSLDTPDDVIFDWLQEEAYPDHPMGRTILGPTERVSQFSRADLQHFIGQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   E  F       +   +  A ++GGE  Q + L + H  
Sbjct: 181 GPEQMILSAAGAVDHDAIVRVAEELFGGMQAKPM-FDVDAAQFLGGERRQTKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I AS LG GMSSRLFQE+RE RGLCYSI A    ++D G+  I
Sbjct: 240 LAFESPGYRDDRIYTAQIYASALGGGMSSRLFQEIRENRGLCYSIFAQAGAYADTGMTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++  ++++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEQLGQLAEITIDEMKRAVDDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V     +   ++ +  I A+T  D+   A++I  S P    L  P++  PT + L   
Sbjct: 360 VQIWDRVPPLDETVAMIDAVTTGDVREFAREIAESAPAALALYGPVEGAPTLAALQER 417


>gi|259418020|ref|ZP_05741939.1| Peptidase M16 inactive domain family protein [Silicibacter sp.
           TrichCH4B]
 gi|259346926|gb|EEW58740.1| Peptidase M16 inactive domain family protein [Silicibacter sp.
           TrichCH4B]
          Length = 420

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 158/418 (37%), Positives = 240/418 (57%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++     +G  ++TE MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKQDTLPNGFRIVTEYMPGLQSAALGIWVSAGGRHERLEQNGVAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E IE VGG INAYTS E T+Y+A VLK+ V LAL++IGD++ NS F+  +IE E
Sbjct: 61  TALQIAEAIEDVGGYINAYTSREVTAYYARVLKDDVDLALDVIGDIVLNSVFDEREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  ++DQ IGR ILG  E + SFT E +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEESYRDQAIGRSILGPAERVRSFTKEDLRRFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V      F      K ++ ++ A +VGGE  + + L + H+ 
Sbjct: 181 GPGQMILSAAGAVDHDRLVKAATEMFGDLE-PKQQDVVETASFVGGEARRDKALEQAHVA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F   +Y++ D Y   I A+ LG GMSSRLFQEVREKRGLCY+I +    + D G++ I
Sbjct: 240 LAFESPSYRADDIYTAQIYAAALGGGMSSRLFQEVREKRGLCYTIFSQAGAYEDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + TA E +  L    V+ ++   +++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTAGEQVADLVGITVDELKRAADDMSDAEVERARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V     +   E  ++ I A+T  D+  +A +I    P    L  P+   P+  E+   
Sbjct: 360 VQIWDRVPSLEATVEKIDAVTTADVRAMAAQIAREAPAALALYGPVADAPSLEEIARR 417


>gi|217977436|ref|YP_002361583.1| peptidase M16 domain protein [Methylocella silvestris BL2]
 gi|217502812|gb|ACK50221.1| peptidase M16 domain protein [Methylocella silvestris BL2]
          Length = 421

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 164/421 (38%), Positives = 250/421 (59%), Gaps = 2/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ RI+   SG+ V+T+ MP +++A + V I AGSR+E + EHG++H LEHM FKGT +R
Sbjct: 1   MSARITTLPSGLRVVTDAMPHLETASLGVWIGAGSRHESRSEHGLSHLLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I EEIE  GGD+NA TS EHT+Y+A VL E  PLA++I+ D+L+ S+F+  ++ERE
Sbjct: 61  SARAIAEEIEAAGGDLNAATSTEHTAYYAHVLAEDAPLAVDILADILTESTFDKEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG  +D   D +   F+   +  Q IGRPILG P+ I+SF  E I +++  +Y
Sbjct: 121 KGVILQEIGAVDDTPDDLVFDLFNATAFPGQPIGRPILGTPDQIASFGREAIGAYLDSHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            +D   +   GA+DHE    +VE  F+  +      +   AVY GGE   KR L + H++
Sbjct: 181 ASDATVIGAAGAIDHEQICDEVERRFSALAPRAAAAAAPAAVYQGGEIRLKRRLEQAHIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G +Y S +FY   + A+ +G GMSSRLFQEVRE RGL YSI A H  +SD G+   
Sbjct: 241 IGFEGLSYASEEFYALQVFANAVGGGMSSRLFQEVRETRGLAYSIHAFHWGYSDTGLFGF 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT+ +++  L    ++ +     ++ + E  +  A++   L+ + E    R  +I++Q
Sbjct: 301 YAATSAKDVAELMPVALDCLAEAALSLSEDEARRAKAQMKVSLLTALESPSPRCEQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
           VM    +L  E+II  I  +   DI     +   S PT+A +GP +  VP    +   L 
Sbjct: 361 VMAFDRVLSREEIIGAIDRLDIADIRAAGAQALRSNPTVAAIGP-VSKVPAPDRVAQRLR 419

Query: 420 G 420
            
Sbjct: 420 A 420


>gi|167630370|ref|YP_001680869.1| peptidase, m16 family [Heliobacterium modesticaldum Ice1]
 gi|167593110|gb|ABZ84858.1| peptidase, m16 family [Heliobacterium modesticaldum Ice1]
          Length = 421

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 137/420 (32%), Positives = 224/420 (53%), Gaps = 7/420 (1%)

Query: 3   LRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +  +   +G+ V+ E    + S  + + +  GSR+E     G++HF+EHMLFKGT KRTA
Sbjct: 2   VHKTVLPNGVRVVMEPISHVRSVALGIWVATGSRDEEPALTGVSHFIEHMLFKGTDKRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K++ E +E VGG +NA+TS E+T YHA VL +H  LAL+++ DM  +S F   DIERER 
Sbjct: 62  KDLAEVLEAVGGQLNAFTSKEYTCYHAKVLDDHFDLALDVLADMFFHSRFEWEDIERERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED   + +    ++ +W    +GR ILG  E+I +   E ++S     Y+A
Sbjct: 122 VILEEIKMYEDSPDELVHDLLADAMWPFSPLGRSILGTVESIQAMQREGLLSHFQSEYSA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR  +   G++D +  + +V++YF+V   +K          +       +D+ +  + LG
Sbjct: 182 DRTVIAIAGSIDPDKALEKVKAYFSVMDASKQTYRRSRPDLLHKSVFLHKDVEQVQICLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G   + RD Y  ++L +++G G SSRLFQE+RE RGL YS+ + H  FSD+G+  + +
Sbjct: 242 TQGLPQEHRDIYAMHVLNNVIGGGTSSRLFQEIRENRGLAYSVYSFHSAFSDSGMFGLYA 301

Query: 302 ATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T+ +    +      E+ +   E I   E+ +   +I   L    E    R   + K  
Sbjct: 302 GTSPDFAEEVLEISLREMARIREEGICPEELRRTQEQIKGSLYLGLESVNSRMTRLGKSE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSELIHALE 419
           +     +  E++ID + A+T +D+  VA+ +++     LA++G      P   EL   L 
Sbjct: 362 ICYNRFVSPEEVIDRVYAVTLDDVTKVARDLWTPEQCALAVVG----AKPLAVELSEMLR 417


>gi|307304251|ref|ZP_07584003.1| processing peptidase [Sinorhizobium meliloti BL225C]
 gi|307320556|ref|ZP_07599971.1| processing peptidase [Sinorhizobium meliloti AK83]
 gi|306893832|gb|EFN24603.1| processing peptidase [Sinorhizobium meliloti AK83]
 gi|306902719|gb|EFN33312.1| processing peptidase [Sinorhizobium meliloti BL225C]
          Length = 433

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 187/421 (44%), Positives = 282/421 (66%), Gaps = 4/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 2   MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTRRR 61

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+H+PLA++I+ D+L+ S+F   ++ RE
Sbjct: 62  SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHLPLAVDILADILTESTFEADELRRE 121

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG ++D   D +  RF+E  ++ Q +GRPILG PET+ SF+ ++I  ++ RNY
Sbjct: 122 KQVILQEIGAADDTPDDVVFDRFAETAYRGQTVGRPILGTPETVMSFSADQIRQYLGRNY 181

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQKRDLAEEHM 238
           T DR ++V  GAVDH+  V QVE  F       +   +     Y GG+  + RDL +  +
Sbjct: 182 TTDRTFIVAAGAVDHDTIVRQVEERFASLPAEPVCAPVIETARYTGGDSRESRDLMDAQV 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 242 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT  EN+  L   IV+ ++    +I+Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 302 VHAATGGENLPELMPVIVDELRKSSLSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E++++ +S IT E +  +A ++F  T PTL+ +GP     P  ++++ +
Sbjct: 362 QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIGPLGQLAP-LNDILSS 420

Query: 418 L 418
           L
Sbjct: 421 L 421


>gi|195970190|ref|NP_385026.2| putative processing protease protein [Sinorhizobium meliloti 1021]
 gi|187904155|emb|CAC45492.2| Probable processing protease [Sinorhizobium meliloti 1021]
          Length = 432

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 187/421 (44%), Positives = 282/421 (66%), Gaps = 4/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++  SG+TV+TE MP ++S  + V I++GSRNE   EHG+AH LEHM FKGT +R
Sbjct: 1   MKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVNEHGIAHLLEHMAFKGTRRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VLK+H+PLA++I+ D+L+ S+F   ++ RE
Sbjct: 61  SARQIAEEIENVGGEVNAATSTETTSYYARVLKDHLPLAVDILADILTESTFEADELRRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG ++D   D +  RF+E  ++ Q +GRPILG PET+ SF+ ++I  ++ RNY
Sbjct: 121 KQVILQEIGAADDTPDDVVFDRFAETAYRGQTVGRPILGTPETVMSFSADQIRQYLGRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPA-VYVGGEYIQKRDLAEEHM 238
           T DR ++V  GAVDH+  V QVE  F       +   +     Y GG+  + RDL +  +
Sbjct: 181 TTDRTFIVAAGAVDHDTIVRQVEERFASLPAEPVCAPVIETARYTGGDSRESRDLMDAQV 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA+ILG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGKAYHARDFYCSQILANILGGGMSSRLFQEVREHRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           + +AT  EN+  L   IV+ ++    +I+Q+EI++  A+I A+L+  QE    RA +I++
Sbjct: 301 VHAATGGENLPELMPVIVDELRKSSLSIDQQEIERARAQIRAQLLMGQESPAARAGQIAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + +E++++ +S IT E +  +A ++F  T PTL+ +GP     P  ++++ +
Sbjct: 361 QMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTVPTLSAIGPLGQLAP-LNDILSS 419

Query: 418 L 418
           L
Sbjct: 420 L 420


>gi|163760348|ref|ZP_02167430.1| hypothetical protein HPDFL43_03556 [Hoeflea phototrophica DFL-43]
 gi|162282299|gb|EDQ32588.1| hypothetical protein HPDFL43_03556 [Hoeflea phototrophica DFL-43]
          Length = 432

 Score =  220 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 177/413 (42%), Positives = 284/413 (68%), Gaps = 4/413 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++ +  ++G+TV+TE M  ++S  + V +++GSR+E   EHG+AH LEHM FKGT KR
Sbjct: 1   MKVKTTSLANGVTVVTETMDHLESVALGVWVKSGSRDETANEHGIAHLLEHMAFKGTRKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E T+Y+A VL++HVPLA++I+ D+L++S F+ ++++RE
Sbjct: 61  SARQIAEEIENVGGELNAATSTETTAYYARVLRDHVPLAIDILHDILTDSVFDEAELQRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG + D   D +  RF+E  +++Q IGRPILG P+T+ SFTP++I  ++SR+Y
Sbjct: 121 KHVILQEIGAANDTPDDVVYDRFTEAAFREQTIGRPILGTPDTVKSFTPDQIRRYLSRHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNV--CSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           T DR+ VV  GAVDH+  V  V   F            ++  A Y GG+Y + RDL +  
Sbjct: 181 TGDRIVVVAAGAVDHDAFVKLVGERFGQSIQPTGTQLRAIPTASYTGGDYREDRDLMDAQ 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +++GF G AYQ RDFY + +LA+ILG GMSSRLFQEVREKRGLCYS+ A H  FSD+G+ 
Sbjct: 241 VLIGFEGRAYQVRDFYCSQLLANILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDSGIF 300

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I +AT  +++  L   I+  +    E ++++EI++  A++ + L+ SQE    RA +I+
Sbjct: 301 GIHAATGGDDLPELIPVILSELAKAAEGVDEQEINRSRAQVRSGLLMSQESPAARASQIA 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVP 409
           +Q++  G  + + ++++ +  IT E +  +A+++F +TP T++ +GP  + +P
Sbjct: 361 RQMLLFGRPVSNSELMERLENITPERLSDLAERLFFNTPVTVSAIGPVSNLMP 413


>gi|288957795|ref|YP_003448136.1| hypothetical protein AZL_009540 [Azospirillum sp. B510]
 gi|288910103|dbj|BAI71592.1| hypothetical protein AZL_009540 [Azospirillum sp. B510]
          Length = 419

 Score =  220 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 143/418 (34%), Positives = 239/418 (57%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R++   +G+ V T+ MP + S  +   +  G+RNE    +G+AH +EHMLFKGT +R+
Sbjct: 3   SIRVTTLPNGLRVATDTMPDVQSVSLGCWVGVGTRNEAASVNGVAHLVEHMLFKGTRRRS 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I EEIE VGG +NAYT+ E T+Y+A VL E  PLAL+I+ DM+ +S+ +  ++ RER
Sbjct: 63  AFRISEEIENVGGQLNAYTTREQTAYYAKVLHEDAPLALDILSDMIQHSTLDAEELVRER 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVL+EIG S D   D +   F    +  Q IGRP+LG  E + +   E ++ +++ +Y 
Sbjct: 123 TVVLQEIGQSADTPDDIIFDHFQATAYPGQAIGRPVLGSAEIVGALPREALVDYIAGHYG 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  M +   G ++HE  V      F     A   +  + A Y GG++ + RDL + H++L
Sbjct: 183 APGMVLSAAGRIEHERMVDLAMKAFGDLPSAAPPKP-EQARYAGGDFREDRDLEQMHLVL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF+G      DFY  ++L+++LG GMSSRLFQEVREKRGL YSI      + D G+  + 
Sbjct: 242 GFDGVGVHDPDFYAHSVLSTLLGGGMSSRLFQEVREKRGLVYSIYTFTGGYHDGGLFGVY 301

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T ++ +  L   + + +  +  ++ + E+ +  A++ A  + + E S  R  ++ +Q+
Sbjct: 302 AGTGEDEVAELVPVVCDEIAKVGVDVTEEEVARARAQLKAGTLMALESSMSRCEQLGQQM 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +     +  E+I+  I  +  + +V  A ++ +S PT+A LGP +  + +   +   L
Sbjct: 362 LIYDRPVPVEEIVAKIDGVDRDAVVKAASRLRASRPTVAALGP-IAKLESYDRIAERL 418


>gi|77462378|ref|YP_351882.1| M16 family peptidase [Rhodobacter sphaeroides 2.4.1]
 gi|77386796|gb|ABA77981.1| peptidase, M16 family [Rhodobacter sphaeroides 2.4.1]
          Length = 419

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 150/419 (35%), Positives = 234/419 (55%), Gaps = 3/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP   SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A  I EEIE VGG INAYTS E T+Y+A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  SALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +S+F    +  FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEERVSTFGRADLTRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH   V+Q ++ F        +  M+PA ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHGRIVAQAQALFGHLKPVG-QRPMQPADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F    Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +   G +   ++ ++ I A+T   +   A+++  +   LA+ GP  +  P  +++   L
Sbjct: 360 LAIWGRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALALYGP-AEAAPALAQIRERL 417


>gi|296532606|ref|ZP_06895310.1| possible peptidase [Roseomonas cervicalis ATCC 49957]
 gi|296267066|gb|EFH12987.1| possible peptidase [Roseomonas cervicalis ATCC 49957]
          Length = 421

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 159/417 (38%), Positives = 253/417 (60%), Gaps = 3/417 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R+++  +G+T+++E MP +++  +   + AG+R+E   E+G +HFLEHM FKGT +R A
Sbjct: 5   VRLTRLPNGLTIVSETMPRVETVSIGAYVHAGTRDESAAENGASHFLEHMAFKGTARRDA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I  EIE VGG +NAYT+ E+T+Y+A VLKE +PLA +IIGD+L++S+F P ++ERER 
Sbjct: 65  AAIAREIENVGGHLNAYTARENTAYYAKVLKEDMPLAADIIGDILTHSTFIPEEMERERG 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +   F    + +Q +GRP LG   T+     E +  ++ R+Y  
Sbjct: 125 VILQEIGQANDTPDDIVFDHFQATAFPEQPMGRPTLGTETTVGGMGREVLTGYMRRHYGP 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM V   GA++HE  V  V  +F    +       + A Y GGE+ ++RDL + H++LG
Sbjct: 185 SRMVVAAAGALEHEKLVELVGRHFADLPLVS-PSPAETARYGGGEFREERDLDQVHVVLG 243

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G A  +   Y   +L+++LG GMSSRLFQE+REKRGL YSI +  + F D+G+  + +
Sbjct: 244 FEGPAVATAGHYPAMLLSTLLGGGMSSRLFQEIREKRGLVYSIYSFTQMFRDSGLFALYA 303

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T +E    L    +E ++ +  ++ Q E+D+  A++ A ++ S E +  R  ++++Q+ 
Sbjct: 304 GTGEEQAAELVPVALEELRRVQHDVTQEELDRAKAQLRASVLMSLESTGSRCEQLARQIQ 363

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
             G I+  E+    I+A+T + +  VA +IF S PTLA LGP    VP    +   L
Sbjct: 364 VHGRIIPVEETKAKIAAVTVDQVQAVAAQIFRSRPTLAALGP-AGKVPGLPSIAEKL 419


>gi|260575704|ref|ZP_05843701.1| peptidase M16 domain protein [Rhodobacter sp. SW2]
 gi|259022102|gb|EEW25401.1| peptidase M16 domain protein [Rhodobacter sp. SW2]
          Length = 419

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 158/419 (37%), Positives = 242/419 (57%), Gaps = 3/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R+    +G+ V+TE MP   SA V + ++AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRLDTLPNGLRVVTEAMPGLQSASVGIWVQAGGRHERPEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I EEIE VGG INAYTS E T+Y+A VL   V LAL++I D++ N  F+P +IE E
Sbjct: 61  TALQIAEEIEDVGGFINAYTSKEMTAYYARVLSADVALALDVISDIVLNPVFDPKEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E+ + DQ  GR ILG  E +S+F    +  FV+ +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEVSYPDQPFGRTILGTAERVSAFARADLTGFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   G VDH+  ++Q ++ F          +++PA + G E  + +DL + H  
Sbjct: 181 GPDQMILAAAGGVDHDAILAQAQAIFGGLKPVGA-SAIQPARFSGAERREVKDLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F   +Y   D Y+  I A+ LG GMSSRLFQ++RE+RGLCYSI A    + D G + I
Sbjct: 240 LAFEAPSYLHPDVYIAQIYATALGGGMSSRLFQKIREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E I  LT   ++ ++    ++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEEIGDLTQLTIDELKRAAGDMAEAEVARARAQLKAGLLMGLESPSSRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +   G +    + +  I A+T  D+   A ++ +S   LA+ GP  D  PT   +   L
Sbjct: 360 LSIFGRVPDVAEAVAKIDAVTTADVRRYAGQMAASPAALALYGPVQD-APTLEVIRAGL 417


>gi|310641604|ref|YP_003946362.1| peptidase m16 domain-containing protein [Paenibacillus polymyxa
           SC2]
 gi|309246554|gb|ADO56121.1| Peptidase M16 domain-containing protein [Paenibacillus polymyxa
           SC2]
          Length = 419

 Score =  219 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 121/401 (30%), Positives = 216/401 (53%), Gaps = 3/401 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
              +  +G+ V+ E +P + S    + ++ GSRNE  +  G++HF+EHMLFKGT + +AK
Sbjct: 2   ERIQLKNGLRVVIEKIPTVRSVSFGIWVKTGSRNETSDNSGISHFIEHMLFKGTERFSAK 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI E+ + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM  NS  +  ++ RE+NV
Sbjct: 62  EIAEQFDAIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFNSKLDQEELAREKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M ED   D +    S   + +  +  PILG  + + +     +  ++  +YT D
Sbjct: 122 ILEEISMYEDTPDDMVHDLVSRAAYGEHPLAYPILGTEDHLLAMDSSHLSHYMKEHYTID 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G VD +  +  +E +F           +    + G     ++   + H+ L  
Sbjct: 182 NTVISVAGNVD-DRLLELLEQHFGHFDNHGTVSPLTVPAFNGQLLYHEKATEQNHICLSL 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G A      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +D+G+  I + 
Sbjct: 241 PGFAIGDDLQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADSGMFTIYAG 300

Query: 303 TAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA +    +    +E+++ +    ++  E+ K   ++   LI S E +  R   + K  +
Sbjct: 301 TAPKQTKDVLDLTLELLRDVAVNGLDANELRKGKEQLKGSLILSLESTGSRMNRLGKNEL 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G     +++I+ I  +T +D+  V  ++FS    L+++G
Sbjct: 361 MLGQHYTLDQMIEHIEQVTADDVNKVLDRMFSEPFALSMVG 401


>gi|316932384|ref|YP_004107366.1| processing peptidase [Rhodopseudomonas palustris DX-1]
 gi|315600098|gb|ADU42633.1| processing peptidase [Rhodopseudomonas palustris DX-1]
          Length = 429

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 150/404 (37%), Positives = 239/404 (59%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +SK  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT+R
Sbjct: 1   MTVEVSKLPSGLTVVTDTMPHLETASLGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EI EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N SF   ++ERE
Sbjct: 61  SSREIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPSFEAEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG S+D   D +    +E+ + +Q IGR +LG  +T+ +F+ EK+ S++S +Y
Sbjct: 121 KSVIVQEIGASQDTPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKNFSREKLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V +V   F     +   +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHARIVEEVSHRFASFDASPAPKPQPAMFGAGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G    +   +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  +SD G   +
Sbjct: 241 LALEGLPQGAPTLFSMQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+V+   ++ +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVIVDVINDAVDTLTDAEISRAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G  L  ++++  I A+T +      + + S S P +  LG
Sbjct: 361 ILAYGRPLPVDELVGRIDAVTIDTAREAGRTLLSRSRPAVVALG 404


>gi|294678611|ref|YP_003579226.1| M16 family peptidase [Rhodobacter capsulatus SB 1003]
 gi|294477431|gb|ADE86819.1| peptidase, M16 family [Rhodobacter capsulatus SB 1003]
          Length = 419

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 154/417 (36%), Positives = 233/417 (55%), Gaps = 2/417 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + ++   +G+ ++TE MP   SA V V + AG R+ER E++G+AHFLEHM FKGT  RTA
Sbjct: 2   IELTTLPNGLRIVTERMPGLASASVGVWVLAGGRHERLEQNGIAHFLEHMAFKGTKTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E IE VGG INAYTS E T+Y+A VLK  V LAL++I D++ NS F+P +IE ER+
Sbjct: 62  LQIAEAIEDVGGYINAYTSREATAYYARVLKADVGLALDVISDIVLNSVFDPREIEVERH 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIG + D   D +     E  + DQ +GR ILG  E I  F  E    FV+ +Y  
Sbjct: 122 VILQEIGQALDTPDDIIFDWLQEAAYPDQAMGRTILGPSENIERFGREDFERFVAEHYGP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D+M +   GAVDH   V Q E  F          +++ A + G E  + +DL + H  L 
Sbjct: 182 DQMILSAAGAVDHAAIVKQAERLFGHLRPIGAP-AVQLARWSGNERRELKDLEQVHFALA 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G  Y+  D Y   + A+ LG GMSSRLFQ++RE+RGLCYSI A    + D G++ I +
Sbjct: 241 FEGPGYRDADLYTAQVYATALGGGMSSRLFQKIREERGLCYSIFAQAGAYDDTGMITIYA 300

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T+ E +  L    ++ ++   E++ + E+ +  A++ A ++   E    RA  +++ + 
Sbjct: 301 GTSGEEVADLCGLTIDELKRAAEDMTEAEVARARAQMKAGMLMGLESPSSRAERMARNLA 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
             G +   +++   I  +T E +   A ++ +   T   L  P +  P  + L   L
Sbjct: 361 IWGRVPGLDEVSTLIDGVTVEAVRSYAGRMIAQDRTALALYGPAEAAPDLAGLRRRL 417


>gi|99082169|ref|YP_614323.1| peptidase [Ruegeria sp. TM1040]
 gi|99038449|gb|ABF65061.1| peptidase [Ruegeria sp. TM1040]
          Length = 420

 Score =  219 bits (557), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 152/418 (36%), Positives = 234/418 (55%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++     +G  ++TE MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKQDTLPNGFRIVTEYMPGLQSAALGIWVSAGGRHERLEQNGVAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A +LK+ V LAL++IGD++ NS F+  +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARILKDDVDLALDVIGDIVLNSVFDEREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  +++Q IGR ILG  E + SF  E +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDIIFDWLQEESYREQAIGRSILGPAERVRSFNKEDLTRFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V      F      K ++ ++ A + GGE    + L + H+ 
Sbjct: 181 GPGQMILSAAGAVDHDRLVKAATEMFGHLE-PKQQDVIECARFTGGEARHDKALEQAHVA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F   +Y++ D Y   I A+ LG GMSSRLFQEVREKRGLCY+I A    + D G++ I
Sbjct: 240 LAFESPSYRADDIYAAQIYAAALGGGMSSRLFQEVREKRGLCYTIFAQAGAYEDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    V+ ++   +++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGAQVSDLLGITVDELKRSADDMSDAEVERARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V     +   E  +  I A+T  D+  +A +I    P    L  P+   P   E+   
Sbjct: 360 VQIWDRVPSLEDTVAKIDAVTTADVRAMAARISREAPAALALYGPVAEAPRLEEIARR 417


>gi|304404301|ref|ZP_07385963.1| peptidase M16 domain protein [Paenibacillus curdlanolyticus YK9]
 gi|304347279|gb|EFM13111.1| peptidase M16 domain protein [Paenibacillus curdlanolyticus YK9]
          Length = 421

 Score =  219 bits (557), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 117/401 (29%), Positives = 222/401 (55%), Gaps = 2/401 (0%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +    S+G+ V+ E +P   S    + ++ GSR+E ++++G++HF+EHMLFKGT + TAK
Sbjct: 2   KKYTLSNGLRVVVEPIPTCRSVSFGIWVKTGSRHENEQDNGVSHFIEHMLFKGTERHTAK 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I +  + +GG++NA+TS E+T Y A VL +H+P+A++ + DM   S F+  ++ +E+NV
Sbjct: 62  DIADLFDGIGGNVNAFTSKEYTCYFAKVLDQHLPIAVDALADMFFESKFDADELAKEKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M ED   D +    S   + D  +   ILG  + +++ T + + +++   Y  D
Sbjct: 122 ILEEIAMYEDTPDDKVHDEASRAAYGDHPLAYSILGLEDRLTAMTGDDLRTYMRNQYRID 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            + +   G ++ +  +  +E +F   +    +  +    + G     ++   + H+ L F
Sbjct: 182 NVVISVAGNIEEQSLLVLLEQHFGAFANHGTEPVLSTPTFRGDYVFHQKQTEQNHICLSF 241

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            GC+    + Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +F+D+G+  I + 
Sbjct: 242 PGCSIADPNLYAMVLLNNALGGGMSSRLFQEIREKRGLAYSVYSYHTSFADSGLFTIYAG 301

Query: 303 TAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA +    +    +E++ +     +   E+ +   ++   LI S E +  R     K  +
Sbjct: 302 TAPKQTTEVLDITMELLGELAANGLTDAELHRGKEQLKGSLILSLESTSSRMNRNGKNEL 361

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G     ++++D I  ++  DIV + K++ +   ++A++G
Sbjct: 362 MLGRHYTLDEMLDRIDEVSMNDIVNMTKRMLNVPFSVAVVG 402


>gi|323701877|ref|ZP_08113547.1| peptidase M16 domain protein [Desulfotomaculum nigrificans DSM 574]
 gi|323533181|gb|EGB23050.1| peptidase M16 domain protein [Desulfotomaculum nigrificans DSM 574]
          Length = 422

 Score =  219 bits (557), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 128/425 (30%), Positives = 238/425 (56%), Gaps = 7/425 (1%)

Query: 1   MNLRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +     +G+ ++T+    + S  + + +  GSR+E     G++H++EHM+FKGT  R
Sbjct: 1   MFYQKETLPNGVRILTQQVSHVRSVAMGIWVDVGSRDEIDANAGISHYIEHMMFKGTKHR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TAK+I EE++ VGG +NA+T+ E+T Y+A VL EH  LA++I+ DML +S+ +  D+ERE
Sbjct: 61  TAKQIAEELDAVGGQLNAFTTKEYTCYYAKVLDEHFDLAVDILTDMLFHSNISEQDVERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+LEEI M ED   + +   F++ +W    +GRPI+G  ET+SS T + + S++ ++Y
Sbjct: 121 KNVILEEIKMYEDAPDELVHDMFAKTIWSGHALGRPIIGTSETVSSLTYKDLRSYMEQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           T +R+ +   G + H+  V ++   F      +    +   V+      + +D  + HM+
Sbjct: 181 TPNRIVISVAGNISHQQVVEKLSPLFASMPNKENIRQLVHPVHTSQVNCRNKDTEQVHMV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +G  G        Y+  ++ ++LG G+SSRLFQE+RE+RGL Y++ ++H ++ D G+  +
Sbjct: 241 IGTPGLRLDDDRVYIVQVINTVLGGGLSSRLFQEIREQRGLVYTVYSYHSSYYDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  +K+N+      I + +       I + E+ +   ++   L+ S E        + K
Sbjct: 301 YAGLSKQNVGKAMELIFKEISDIKKNGITKEELQRSKDQLKGNLLLSLESVNTHMSRLGK 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
             ++ G +   E+I++ ++ +T ED + +A ++F     +++ +GP  D      EL  A
Sbjct: 361 SELYLGRVYKPEEIVEKLNKVTIEDTIQMANELFKPESFSMSAIGPWQDC----GELKAA 416

Query: 418 LEGFR 422
           +E  +
Sbjct: 417 MEVLK 421


>gi|251797389|ref|YP_003012120.1| peptidase M16 domain protein [Paenibacillus sp. JDR-2]
 gi|247545015|gb|ACT02034.1| peptidase M16 domain protein [Paenibacillus sp. JDR-2]
          Length = 421

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 123/404 (30%), Positives = 216/404 (53%), Gaps = 4/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MN      S+G+ V+ E +P   S    + ++ GSRNE  E +G++HF+EHMLFKGT  R
Sbjct: 1   MN--KYTLSNGLRVVVEYLPTFRSVSFGIWVKTGSRNETPENNGISHFVEHMLFKGTNGR 58

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TAK+I +  + +GG++NA+TS E+T Y A VL EH+P+A++ + DM   S  +  ++ +E
Sbjct: 59  TAKDIADLFDGIGGNVNAFTSKEYTCYFAKVLDEHLPIAVDALSDMFFESKLDAEELAKE 118

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+LEEI M ED   D +    S   + D  +   ILG  E +++   E +  +++  Y
Sbjct: 119 KNVILEEISMYEDTPDDKVHDEASRAAYGDHPLAYSILGLEERLAAMNSESLRGYMNDTY 178

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           T +   +   G V+    ++ +E YF           +    + G     K+   + H+ 
Sbjct: 179 TIENTVISVAGNVEETKLLALLEQYFGRFKNKGKSGIVTAPTFHGDYVYFKKKTEQNHLC 238

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F GC+      Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +++D+G+  +
Sbjct: 239 LTFPGCSNSDPQLYAMILLNNALGGGMSSRLFQEIREKRGLAYSVYSYHTSYADSGLFTV 298

Query: 300 ASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + TA +    +    +E ++   ++ +   E+ +   ++   LI S E +  R   + K
Sbjct: 299 YAGTAPKQTKEVLDLTLEQMEELSVKGLSDEELHRGKEQLKGSLILSLESTSSRMNRLGK 358

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             +  G     ++++  I  +T +D+  V +++ S    +A++G
Sbjct: 359 NELMIGRHFTLDEMLQRIDNVTMKDVREVTERMLSVPFAVAMVG 402


>gi|308068708|ref|YP_003870313.1| zinc protease [Paenibacillus polymyxa E681]
 gi|305857987|gb|ADM69775.1| Hypothetical zinc protease [Paenibacillus polymyxa E681]
          Length = 421

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 122/401 (30%), Positives = 215/401 (53%), Gaps = 3/401 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
              +  +G+ V+ E +P + S    + ++ GSRNE  +  G++HF+EHMLFKGT +  AK
Sbjct: 2   ERIQLKNGLRVVIEKIPTVRSVSFGIWVKTGSRNETPDNSGISHFIEHMLFKGTERFNAK 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI E+ + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM  NS  +  ++ +E+NV
Sbjct: 62  EIAEQFDAIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFNSKLDQEELAKEKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M ED   D +    S   + +  +  PILG  + + +     +  ++  +YT D
Sbjct: 122 ILEEISMYEDTPDDMVHDLVSRAAYGEHPLAYPILGTEDHLLAMNSSHLSHYMREHYTID 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G VD +  V  +E +F           +   V+ G     ++   + H+ L  
Sbjct: 182 NTVISVAGNVD-DRLVELLERHFGHFDNHGTVSPLTVPVFNGELLYHEKATEQNHICLSL 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G A      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +D+G+  I + 
Sbjct: 241 PGFAVGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADSGMFTIYAG 300

Query: 303 TAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA +    +    +E+++ +    ++  E+ K   ++   LI S E +  R   + K  +
Sbjct: 301 TAPKQTKDVLDLTLELLRDVAVNGLDANELRKGKEQLKGSLILSLESTGSRMNRLGKNEL 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G     +++I+ I  +T  D+  V  ++FS    L+++G
Sbjct: 361 MLGQHYTLDQMIEHIEQVTANDVNKVLDRMFSEPFALSMVG 401


>gi|86137974|ref|ZP_01056550.1| peptidase, M16 family protein [Roseobacter sp. MED193]
 gi|85825566|gb|EAQ45765.1| peptidase, M16 family protein [Roseobacter sp. MED193]
          Length = 420

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 152/418 (36%), Positives = 237/418 (56%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++  + ++G  +++E MP   SA + + + AG RNER E++G+AHFLEHM FKGT +R
Sbjct: 1   MSVQQHQLANGFRIVSEAMPGLQSASIGIWVTAGGRNERLEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E +E VGG INAYTS E T+Y+A VLK+ VPLAL+++ D+L N  F+P +IE E
Sbjct: 61  SALQIAEAVEDVGGYINAYTSREVTAYYARVLKDDVPLALDVLADILRNPVFDPHEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ +GR ILG  E +S+F  E +  FVS +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEQSYHDQPLGRTILGPAERVSAFNREDLTQFVSEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH   V   E  F   +       M+PA + GGE    +DL + H  
Sbjct: 181 GPGQMILSAAGAVDHAALVKLAEDLFGDMTARPS-LVMEPAQFTGGEARHVKDLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I ++++G GMSSRLFQEVREKRGLCYSI A     +D G   I
Sbjct: 240 LSFESPGYRDEAIYTAQIYSAVMGGGMSSRLFQEVREKRGLCYSIFAQAGAHADTGSTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L    V+ ++    ++   E+++  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGDQVEELAHITVDEMKRAASDMSDAEVERARAQMKAGMLMGLESPTNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V     +   ++ +  I A++ ED+  +A+ +    P+   L  P++  P+ + L   
Sbjct: 360 VQIWDRVPALDETVKLIDAVSTEDVRAMAELLAVKAPSAMALYGPVEGAPSLTALQER 417


>gi|319406871|emb|CBI80506.1| processing protease protein [Bartonella sp. 1-1C]
          Length = 427

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 172/421 (40%), Positives = 261/421 (61%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  MP I+S  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHKMPQIESVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK+ +PLA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKKDIPLAIDILADIMTCSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG  +T+ SFT   + +F+ + Y
Sbjct: 121 KQVVFQEIGATCDVPDDIVFDYFTETAFRHQSLGRSILGTQKTVQSFTSADLHNFMKQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  G+V+HE  + QVES             +  A Y GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGSVEHESFLRQVESCLGTFQPHSTAPLVNLANYTGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGSPYHAHDFYAAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L    ++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKTLLPVTLDELCKISKNIHINELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   +I + +  IT E +  +AK +F +S PTLA +GP ++ +   ++L+  L
Sbjct: 361 MLLYGRPIPISEITECVELITLEQLTDLAKHLFINSKPTLAAVGP-IEPLMNFNDLVSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|319403859|emb|CBI77445.1| processing protease protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 427

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 171/421 (40%), Positives = 262/421 (62%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  MP I+S  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHKMPQIESVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK+ +PLA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKKDIPLAIDILADIMTCSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG  +T+ SFT   + +F+ + Y
Sbjct: 121 KQVVFQEIGATCDVPDDIVFDYFTETAFRHQSLGRSILGTQKTVQSFTSADLHNFMKQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  G+V+HE  + QVES  +          +  A Y GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGSVEHESFLRQVESCLSTFQPHSTAPLVNLANYTGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHAHDFYAAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L    ++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVTLDELYKISKNIHINELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   ++ + +  IT E +  +AK +F +S PTLA +GP ++ +   ++L+  L
Sbjct: 361 MLLYGRPIPISEMTECVELITLEQLTDLAKHLFINSKPTLAAVGP-IEPLMNFNDLVSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|261407928|ref|YP_003244169.1| peptidase M16 domain-containing protein [Paenibacillus sp.
           Y412MC10]
 gi|261284391|gb|ACX66362.1| peptidase M16 domain protein [Paenibacillus sp. Y412MC10]
          Length = 422

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 127/401 (31%), Positives = 224/401 (55%), Gaps = 3/401 (0%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +  + S+G+ V+ E +P   S    + ++ GSRNE ++ +G+ HF+EHM+FKGT +  A+
Sbjct: 2   KKIQLSNGLRVVMEQIPTSRSVSFGIWVKTGSRNESEDINGITHFIEHMMFKGTERFDAR 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I EE + +GG++NA+TS E+T Y+A VL EH P+A++++ DM  NS  +P ++ +E+NV
Sbjct: 62  AIAEEFDAIGGNVNAFTSKEYTCYYAKVLDEHFPIAVDVLSDMFFNSKLDPGELAKEKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M ED   D +    S  V+ D  +  PILG  E + S   + + S++ R+YT +
Sbjct: 122 ILEEIAMYEDTPDDLVHDLMSLSVYGDHPLAYPILGTKERLESMDSQALRSYMDRHYTIE 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G ++ +  ++ +E +F   +     E +    ++ G   +K+   + H+ + F
Sbjct: 182 NTVIALAGNIN-DEVIALLERHFGGFANHGTSEPLAVPAFLDGVQFRKKKTEQNHICMSF 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            GC+      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +DNG+  I + 
Sbjct: 241 PGCSIGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADNGMFTIYAG 300

Query: 303 TAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA +    +     E++  L +  + + E+ K   ++   LI S E +  R   + K  +
Sbjct: 301 TAPKQTKEVLQLTTEMLHDLAQNGMTEEELRKGKEQLKGSLILSLESTSSRMNRLGKNEL 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G     ++II  I  +  +D+  V  ++F +   LA++G
Sbjct: 361 MLGRHFSLDEIIKRIEQVDMKDVNAVLDRMFGTPYALAMVG 401


>gi|188586079|ref|YP_001917624.1| peptidase M16 domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350766|gb|ACB85036.1| peptidase M16 domain protein [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 417

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 124/406 (30%), Positives = 217/406 (53%), Gaps = 5/406 (1%)

Query: 3   LRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
                  +G+ ++ E M  + S  V + I++GSR E   + G++H LEHMLFKGT  RTA
Sbjct: 2   FEKHTLPNGLRIVAEPMESVRSVTVGIWIKSGSRFENLSQQGISHLLEHMLFKGTDSRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EEI+ +GG INA+TS E+T  +  V+  H   AL I+ DM  NS F+  D+E+E+ 
Sbjct: 62  QDIAEEIDSIGGHINAFTSKEYTCIYIKVIDSHFETALAILADMFFNSKFDQEDLEKEKQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+ EE+ M ED   +++     +  + +  +   ILG  E++S+ + E +I+   R +T 
Sbjct: 122 VIFEELKMYEDTPDEYVHDLLIQSCYGEHELAHNILGDRESVSNLSSEALINHHKRYFTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF--NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           ++  +   G V  +  V     YF   V         ++   Y     ++ +D  + H  
Sbjct: 182 EKTVISVSGNVSMDNVVETATKYFGSFVNINNNDNHPLRGPSYYTDSIVKGKDTEQVHFC 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G + ++   Y   +L +ILG  MSS+ FQE+REKRGLCYS+ +++ NF+D+G+  I
Sbjct: 242 LAFPGLSVENSQLYHLGLLNNILGGSMSSKFFQEIREKRGLCYSVYSYYLNFTDSGLFVI 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  +++N       I  ++  + +  I   E+++   ++   ++   E +  R   + +
Sbjct: 302 YAGFSQDNFNETYDLIWSILDEIKQGSITDEELNRSKEQVKGNILMGLESTSNRMARLGR 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP 403
             +  G IL  E+II+ I  IT ED++ +A+ +F     + A++GP
Sbjct: 362 DELLKGEILTYEQIIEKIENITKEDLLKLAQDLFQKNQMSSAVIGP 407


>gi|126737273|ref|ZP_01753008.1| peptidase, M16 family protein [Roseobacter sp. SK209-2-6]
 gi|126721858|gb|EBA18561.1| peptidase, M16 family protein [Roseobacter sp. SK209-2-6]
          Length = 420

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 157/418 (37%), Positives = 236/418 (56%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+LR     +G  +++E +P   SA + + + AG RNER E++G+AHFLEHM FKGT KR
Sbjct: 1   MSLRQDTLPNGFRIVSEDIPGLQSASIGIWVTAGGRNERLEQNGIAHFLEHMAFKGTKKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E +E VGG INAYTS E T+Y+A VLK+ VPLAL+++ D+L N  F+P +IE E
Sbjct: 61  SALQIAEAVEDVGGYINAYTSREVTAYYARVLKDDVPLALDVLADILLNPVFDPHEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  +++Q +GR ILG  E +S+F+ + +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEESYRNQPLGRTILGPAERVSAFSRDDLTQFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V      F          +M+PA + GGE  Q++ L + H  
Sbjct: 181 GPEQMILSASGAVDHDALVKMAGDLFGGMKSRPA-LAMEPARFTGGEARQEKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F    Y+    Y   I A I+G GMSSRLFQEVREKRGLCY+I A     +D G   I
Sbjct: 240 LSFESPGYRDDAIYTAQIYAGIMGGGMSSRLFQEVREKRGLCYTIFAQAGAHADTGCTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++   E+++  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEQLAELAHITVDEMKRAAEDLSDAEVERARAQMKAGLLMGLESPTNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E  +  I A+  ED+  +A+K+    P    L  P+   P  + L   
Sbjct: 360 VQIWGRVPSLEDTVRLIDAVQNEDVRALAEKLALQAPVAMALYGPVSGAPDLTALKER 417


>gi|254510793|ref|ZP_05122860.1| hypothetical protein RKLH11_1328 [Rhodobacteraceae bacterium KLH11]
 gi|221534504|gb|EEE37492.1| hypothetical protein RKLH11_1328 [Rhodobacteraceae bacterium KLH11]
          Length = 420

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 147/418 (35%), Positives = 234/418 (55%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R  +  +G  +++E MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRQDQLKNGFRIVSEHMPGLQSAAIGIWVTAGGRHERIEQNGIAHFLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VLK+ V LA+++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLKDDVALAMDVIGDIVLNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + +Q +GR ILG  E +S+F+ E +  FV+ +Y
Sbjct: 121 RGVILQEIGQAYDTPDDVIFDWLQEQSYHNQPLGRTILGPSERVSAFSREDLSGFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  +   E  F      K     + A + GGE  Q+++L + H  
Sbjct: 181 GPEQMILSAAGAVDHDALMKMAEDMFGHLQPRKGLIP-ETARFTGGEARQEKELEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L      Y+    Y   I ++ LG GMSSRLFQEVRE RGLCY+I A    ++D G   I
Sbjct: 240 LALESPGYRDDAIYTAQIYSTALGGGMSSRLFQEVRETRGLCYTIFAQTGAYADTGTTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L +  ++ ++   E++   E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSADQVAELAAITIDEMKRAAEDMSVEEVARARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E  +  I A+   D+   A+++    P    L  P+   P+ ++L   
Sbjct: 360 VQIWGRVPSLEDTVAKIDAVGIGDVRDFAEQMAVQAPAALALYGPVSGAPSLAQLQER 417


>gi|221638238|ref|YP_002524500.1| Processing peptidase [Rhodobacter sphaeroides KD131]
 gi|221159019|gb|ACL99998.1| Processing peptidase [Rhodobacter sphaeroides KD131]
          Length = 419

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 151/419 (36%), Positives = 234/419 (55%), Gaps = 3/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP   SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA  I EEIE VGG INAYTS E T+Y+A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  TALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +SSF    +  FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEERVSSFGRADLTRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH+  V+Q ++ F        +  M+PA ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHDRIVAQAQALFGHLKPVG-QRPMQPADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F    Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +     +   ++ ++ I A+T   +   A+++  +   LA+ GP  +  P  +++   L
Sbjct: 360 LAIWDRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALALYGP-AEAAPALAQIRERL 417


>gi|220920315|ref|YP_002495616.1| peptidase M16 domain-containing protein [Methylobacterium nodulans
           ORS 2060]
 gi|219944921|gb|ACL55313.1| peptidase M16 domain protein [Methylobacterium nodulans ORS 2060]
          Length = 431

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 164/421 (38%), Positives = 257/421 (61%), Gaps = 3/421 (0%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           +LRI++  +G+TV TE MP   +A + V + AGSR+ER +EHG++H +EHM FKGT +R+
Sbjct: 13  SLRITRLPNGLTVATEPMPGVATATLGVWVGAGSRHERPQEHGLSHLIEHMAFKGTCRRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I E+IE VGGDINA TS E TSY A VL E + +AL++IGD+L+NS F+  ++ RE+
Sbjct: 73  ARAIAEDIENVGGDINAATSAEQTSYTARVLGEDIGVALDVIGDILTNSVFDAGELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F+E  + DQ IGRPILG+PETI SF    I  +++R YT
Sbjct: 133 GVILQEYAAVEDTPDDVVYDAFTEAAFPDQPIGRPILGRPETIQSFDRRAIEVYLAREYT 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            DRM +   GAV+HE  V   E +F         ++ +  +Y+GGE    R L + +++L
Sbjct: 193 PDRMVLAAAGAVEHEAIVEAAERHFGALPARTAPDA-EAGLYLGGERRMLRKLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ A +LG G++SRL+ EVRE RGL Y I A H  FSD G+  I 
Sbjct: 252 GLPGLSFRDEGYYALHLFAQVLGGGLTSRLWHEVRETRGLAYEIHAFHWPFSDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + TA  ++ AL    V  + +   +IE+ E+ +  A++   L+ + E    R   I++Q+
Sbjct: 312 AGTAGADLPALVEVTVACLGNAAASIEETELARAKAQLKVSLLSALETPGGRIERIARQI 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG 420
           +  G ++ +E+II  + A+T E +    + + +  PTLA +GP +  +P+   + +AL+ 
Sbjct: 372 LAWGRVIPAEEIIAKVDAVTPEQVRAAGRAVMAGAPTLAAIGP-IRKLPSLDAVGNALKA 430

Query: 421 F 421
            
Sbjct: 431 A 431


>gi|126461255|ref|YP_001042369.1| processing peptidase [Rhodobacter sphaeroides ATCC 17029]
 gi|332560262|ref|ZP_08414584.1| processing peptidase [Rhodobacter sphaeroides WS8N]
 gi|126102919|gb|ABN75597.1| processing peptidase [Rhodobacter sphaeroides ATCC 17029]
 gi|332277974|gb|EGJ23289.1| processing peptidase [Rhodobacter sphaeroides WS8N]
          Length = 419

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 151/419 (36%), Positives = 235/419 (56%), Gaps = 3/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G  ++TE MP   SA + + I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVLLDTLPNGFRIVTEHMPGLHSASIGIWIAAGGRHERPEQNGIAHFLEHMAFKGTNTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA  I EEIE VGG INAYTS E T+Y+A VL+    LAL++I D++ N  F+P +IE E
Sbjct: 61  TALRIAEEIEDVGGYINAYTSREMTAYYARVLEADTGLALDVIADIVLNPVFDPKEIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +  Q  GR ILG  E +S+F    +  FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDIIFDWLQEASYPGQAFGRTILGPEERVSTFGRADLTRFVGEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D M +   G VDH+  V+Q ++ F        +  M+PA ++GGE  + + L + H  
Sbjct: 181 GPDHMILAAAGGVDHDRIVAQAQALFGHLKPVG-QRPMQPADFLGGERRELKSLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + F    Y++ D Y   + A  LG GMSSRLFQ+VRE+RGLCYSI A    + D G + I
Sbjct: 240 MAFEAPNYRAPDVYAAQVYAMALGGGMSSRLFQKVREERGLCYSIFAQSGAYEDTGQITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    V+ ++   E++ + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEEVADLAGLTVDELKRATEDMSEAEVARARAQLKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +   G +   ++ ++ I A+T   +   A+++  +   LA+ GP  +  P  +++   L
Sbjct: 360 LAIWGRVPGVDEAVEKIDAVTVGAVRDYAERMAQARSALALYGP-AEAAPALAQIRERL 417


>gi|329929289|ref|ZP_08283042.1| peptidase, M16 family [Paenibacillus sp. HGF5]
 gi|328936658|gb|EGG33101.1| peptidase, M16 family [Paenibacillus sp. HGF5]
          Length = 422

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 126/401 (31%), Positives = 223/401 (55%), Gaps = 3/401 (0%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +  + S+G+ V+ E +P   S    + ++ GSRNE ++ +G+ HF+EHM+FKGT +  A+
Sbjct: 2   KKIQLSNGLRVVMEQIPTSRSVSFGIWVKTGSRNESEDINGITHFIEHMMFKGTERFDAR 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I EE + +GG++NA+TS E+T Y+A VL EH P+A++++ DM  NS  +  ++ +E+NV
Sbjct: 62  AIAEEFDAIGGNVNAFTSKEYTCYYAKVLDEHFPIAVDVLSDMFFNSKLDAGELAKEKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M ED   D +    S  V+ D  +  PILG  E + S   + + S++ R+YT +
Sbjct: 122 ILEEIAMYEDTPDDLVHDLMSLSVYGDHPLAYPILGTKERLESMDSQALRSYMDRHYTIE 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G ++ +  ++ +E +F   +     E +    ++ G   +K+   + H+ + F
Sbjct: 182 NTVIALAGNIN-DEVIALLERHFGGFANHGTSEPLAVPAFLDGVQFRKKKTEQNHICMSF 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            GC+      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +DNG+  I + 
Sbjct: 241 PGCSIGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADNGMFTIYAG 300

Query: 303 TAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA +    +     E++  L +  + + E+ K   ++   LI S E +  R   + K  +
Sbjct: 301 TAPKQTKEVLQLTTEMLHDLAQNGMTEEELRKGKEQLKGSLILSLESTSSRMNRLGKNEL 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G     ++II  I  +  +D+  V  ++F +   LA++G
Sbjct: 361 MLGRHFSLDEIIKRIEQVDMKDVNAVLDRMFGTPYALAMVG 401


>gi|86751675|ref|YP_488171.1| peptidase M16-like [Rhodopseudomonas palustris HaA2]
 gi|86574703|gb|ABD09260.1| Peptidase M16-like [Rhodopseudomonas palustris HaA2]
          Length = 429

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 147/404 (36%), Positives = 239/404 (59%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ +SK  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTTKR
Sbjct: 1   MSVEVSKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           ++++I EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N  F   ++ERE
Sbjct: 61  SSRDIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPVFEAEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q IGR +LG  +T+  F  +K+ S+++ +Y
Sbjct: 121 KSVIVQEIGAAQDMPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKGFNRDKLQSYLATHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V +V   F         +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHKRVVEEVSHRFASFDATPAPKPQPAMFGAGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G     +  +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGLPQSDKSLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYADTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T  ++   +   IV+V+   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPDDAPEMMEVIVDVINDAVETLTDAEIARAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           V+  G  L  ++++  I A++ E     A+ + + S P +  LG
Sbjct: 361 VLAYGRPLSVDELVGKIDAVSIETTRQAARDLLTRSRPAVVALG 404


>gi|134299795|ref|YP_001113291.1| peptidase M16 domain-containing protein [Desulfotomaculum reducens
           MI-1]
 gi|134052495|gb|ABO50466.1| peptidase M16 domain protein [Desulfotomaculum reducens MI-1]
          Length = 422

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 128/423 (30%), Positives = 244/423 (57%), Gaps = 4/423 (0%)

Query: 1   MNLRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +     +G+ ++T+    + S  + + +  GSR+E  E  G++H++EHM+FKGT  R
Sbjct: 1   MFYQKEVLPNGVRILTQQVSHVRSVAMGIWVDVGSRDESDETAGISHYIEHMMFKGTKHR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T K+I EE++ VGG +NA+T+ E+T Y+A VL EH  LA++++ DML +S+ +  D+ERE
Sbjct: 61  TPKQIAEELDAVGGQLNAFTTKEYTCYYAKVLDEHFNLAVDVLTDMLFHSNISELDVERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+LEEI M ED   + +   F++ +W    +GRPI+G  ET+SSF+ + +  F+  NY
Sbjct: 121 KNVILEEIKMYEDAPDELVHDMFAKTIWAGHPLGRPIIGTTETVSSFSYQDLRLFMKENY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             +R+ V   G + H+  ++++   F   S  +++  ++   +      + ++  + HM+
Sbjct: 181 APNRIVVSVSGNITHQQVINKLAPLFGNMSGNQVRRQLEKPTHSIEVNCRSKETEQVHMV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +G  G        Y+  ++ ++LG G+SSRLFQE+RE+RGL YS+ ++H ++ D G+  +
Sbjct: 241 IGAPGLRLDDDSLYIAQVINTVLGGGLSSRLFQEIREQRGLVYSVYSYHSSYHDTGIFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  +K+N+      I + ++ + +  I Q+E+ +   ++   L+ S E        + K
Sbjct: 301 YAGLSKQNVNNAMELIFKEIKDIKQNGISQKELQRAKDQLKGNLLLSLESVNTHMSRLGK 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSELIHA 417
             ++ G +   E+I++ ++ +T ED V VA+++F     ++A +GP  D      +++  
Sbjct: 361 SELYLGKVYSPEEIVEKLNRVTLEDTVRVAEELFQPDKFSMAAIGPWQDCG-DLKKVLET 419

Query: 418 LEG 420
           L+ 
Sbjct: 420 LKD 422


>gi|83594564|ref|YP_428316.1| processing peptidase [Rhodospirillum rubrum ATCC 11170]
 gi|83577478|gb|ABC24029.1| processing peptidase [Rhodospirillum rubrum ATCC 11170]
          Length = 421

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 140/419 (33%), Positives = 256/419 (61%), Gaps = 3/419 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R+++   G+TV T+ +P ++S  +   +  G+R+E    +G++H LEHM FKGT KR+
Sbjct: 4   SVRVTRLPGGLTVATDFVPSVESLTLGAWVATGTRHEAPAVNGVSHLLEHMAFKGTRKRS 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I EEIE VGG +NAYTS E+T+Y+A VL+E   +AL+I+GD+L +S+F+P+++ RER
Sbjct: 64  ARQIAEEIEAVGGHLNAYTSRENTAYYARVLREDEDVALDILGDILQHSTFDPTELGRER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VV++EI  + D   D +   F E  + DQ +GRP+LG  + +   T E +  ++  +Y 
Sbjct: 124 EVVVQEIYQAIDTPDDIIFDHFQETAFPDQALGRPVLGTEKVVRGLTREIVDGYMRAHYA 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            +R  V   G +DH+  V++V  +F+      I  + +P  Y GG + ++RDL + H++L
Sbjct: 184 PERTVVAAAGRIDHDAFVAKVTEHFSALPGRGIP-AEEPGRYAGGVFREERDLEQVHIVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G  +   D+Y  ++L+++ G GMSSRLFQE+RE RGL YSI +   ++ D G+  I 
Sbjct: 243 GFEGICHGDDDYYAASVLSTLHGGGMSSRLFQEIRENRGLAYSIYSFSSSYQDTGLYAIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+++    L   + +    L +++ + E+ +  A++ A ++ + E +  R  ++++Q+
Sbjct: 303 AGTSEKEAAELIPVLCDETARLADSLTEVEVARARAQLKASILMALESTSSRCEQMARQI 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
              G  +  ++++  +  +T + +   A++IF+  PTLA +GP +  V    +++  L+
Sbjct: 363 QVYGRPIGIDEVVAKLDGVTIDQVAACARRIFTRPPTLAAIGP-LAGVEDYDKIVARLK 420


>gi|253573575|ref|ZP_04850918.1| peptidase M16 domain-containing protein [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251847103|gb|EES75108.1| peptidase M16 domain-containing protein [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 417

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 128/401 (31%), Positives = 222/401 (55%), Gaps = 3/401 (0%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           + ++  +G+ V+ E +P   S    + ++ GSRNER E  G++HF+EHMLFKGT + +AK
Sbjct: 2   KRTQLKNGLRVVMEKIPTCRSVSFGIWVKTGSRNERPERGGISHFIEHMLFKGTERYSAK 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I E+ + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM   S F+  ++ +E+NV
Sbjct: 62  DIAEQFDAIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFRSLFDKEELRKEKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           ++EEI M ED   D +    ++  + D  +  PILG  E + +   E +  ++  +YT +
Sbjct: 122 IVEEISMYEDTPDDMVHDLVTQAAYGDHPLALPILGTEEKLRAMESEHLREYMREHYTIE 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G +D E  +  +E YF   S       +    ++GG    ++   + H+ L F
Sbjct: 182 NTVISVAGNID-EQVIDLLEQYFGDFSNRGSSSPLAAPEFLGGLKFHRKKTEQNHICLSF 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G        Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +++D+G+  + + 
Sbjct: 241 PGLPIGDEKQYAMVLLNNALGGGMSSRLFQEIREKRGLAYSVYSYHSSYADSGLFTVYAG 300

Query: 303 TAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA      +     E++  + +  I   E+ K   ++   LI S E +  R   + K  +
Sbjct: 301 TAPRQTKEVLDLTKEILHDVSVNGITPNELSKGKEQLKGSLILSLESTGSRMNRLGKNEL 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G     +++I  I A+T +D+  V K +FS   +LA++G
Sbjct: 361 MIGKHYSLDEMIARIEAVTMDDVNQVLKGMFSQPFSLAMVG 401


>gi|254462339|ref|ZP_05075755.1| Zn-dependent peptidase family protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206678928|gb|EDZ43415.1| Zn-dependent peptidase family protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 420

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 150/417 (35%), Positives = 231/417 (55%), Gaps = 2/417 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++    ++G  ++TE MP   SA + + + AG RNER E++G+AHFLEHM FKGT  R
Sbjct: 1   MSVQTHSLANGFRIVTEKMPGLRSASIGIWVTAGGRNERIEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           ++ +I EEIE VGG INAYTS E T+Y+A VL   VPLAL++I D+L N  F+  +IE E
Sbjct: 61  SSLQIAEEIEDVGGYINAYTSREVTAYYARVLGGDVPLALDVISDILLNPVFDEDEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     +  + DQ IGR ILG  E + SF+ E +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQDEAYPDQPIGRTILGPEERVRSFSREDLRRFVHEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   G VDH+  V   E  F     +++      A++ GG   + + L + H  
Sbjct: 181 GPSQMILSAAGDVDHDAIVRAAEELFGGLE-SRVASVPTKALFQGGVRREIKSLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G +Y     Y   I +  LG GMSSRLFQEVREKRGLCY+I A    +SD G++ I
Sbjct: 240 LAFEGPSYCDNAIYTAQIYSVALGGGMSSRLFQEVREKRGLCYTIFAQTGAYSDTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L S  ++ +    +++ + E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGEQLPELASITMQELARAADDMNETEVARARAQMKAGMLMGLESPSSRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIH 416
           +     I   E+ +  I A+T + +   A  +    P    L  P++  P  ++L+ 
Sbjct: 360 MQIWNRIPPLEETVAQIDAVTMQGVRDFAASLADEAPAALALYGPVERAPDLADLLK 416


>gi|296115095|ref|ZP_06833736.1| processing peptidase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978196|gb|EFG84933.1| processing peptidase [Gluconacetobacter hansenii ATCC 23769]
          Length = 421

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 157/421 (37%), Positives = 250/421 (59%), Gaps = 5/421 (1%)

Query: 1   MN--LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           M   + +++  SG+TV+TE M  +++A     + AG+ +E   E+G++HFLEHM FKGT 
Sbjct: 1   MTDLINVTRLPSGLTVVTERMERVETASFGAYVAAGTCHEDARENGVSHFLEHMAFKGTA 60

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            RTA  I EEIE VGG INAYT+ EHT+Y+  +LKE +PL ++IIGD+L++SSF P ++E
Sbjct: 61  TRTAAGIAEEIENVGGHINAYTAREHTAYYVKLLKEDLPLGVDIIGDILTHSSFAPDELE 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           RER V+L+EIG + D   D +   F E  + +Q +GRP LG    I   T + +++++  
Sbjct: 121 RERGVILQEIGQANDTPDDIVFDHFQETAFPNQPMGRPTLGTEGGIREMTRKTLMTYMRT 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           +YTA    +   G + H+  V  VE +F       I        YVGGE+ Q+R+L + H
Sbjct: 181 HYTARNTIIAAAGNLHHDAVVEMVEKHFRDLPQTDIP-PCPGVTYVGGEFAQRRELDQAH 239

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LGF    Y   D+Y T +L+++LG GMSSRLFQE+REKRGL YS+ + +  F   G+ 
Sbjct: 240 IVLGFPSVGYGDPDYYPTLLLSTLLGGGMSSRLFQEIREKRGLVYSVYSFNAPFRQGGLF 299

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            I + T +  +  L    +E ++ +   + Q E+D+  A++ + L+ S E +  R  +++
Sbjct: 300 GIYAGTGESQVADLIPVTLEELRKVQGQVAQNELDRARAQLKSSLLMSLESTGSRCEQLA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +Q+     ++   + +  I A+T  D+  VA ++F  TPTL  LGP + H+P  + +   
Sbjct: 360 RQLQIFDRLVPIHETVQRIDAVTIADVQRVAARVFHGTPTLTSLGP-VRHMPPVATVAEI 418

Query: 418 L 418
           L
Sbjct: 419 L 419


>gi|222085146|ref|YP_002543676.1| processing protease protein [Agrobacterium radiobacter K84]
 gi|221722594|gb|ACM25750.1| processing protease protein [Agrobacterium radiobacter K84]
          Length = 432

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 185/422 (43%), Positives = 282/422 (66%), Gaps = 4/422 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  ++ +SG+TV T+ MP ++S  + V I++GSRNE + EHG+AH LEHM FKGT +R
Sbjct: 1   MTVECTRLASGLTVATQTMPHLESVALGVWIKSGSRNETEAEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS E TSY+A VL++ VPLA++I+ D+L+ S+F+  ++ RE
Sbjct: 61  SARQIAEEIENVGGEVNAATSTETTSYYARVLRDDVPLAVDILADILTESAFDEEELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EI  + D   D +  +FSE+ ++ Q +GR ILG PET+ SF+P +I  ++ RNY
Sbjct: 121 KQVILQEINAANDTPDDVVFDKFSEVAYRGQTLGRAILGTPETVVSFSPAQIRGYLDRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHM 238
           T DRM+VV  GAVDH+  V QVE  F+           ++PA Y+GG   + RDL +  +
Sbjct: 181 TTDRMFVVAAGAVDHDSFVRQVEERFSSLPTKPSAPPIIEPARYIGGNIRETRDLMDAQI 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LGF G AY +RDFY + ILA++LG GMSSRLFQEVRE RGLCYS+ A H  FSD G+  
Sbjct: 241 LLGFEGRAYHTRDFYCSQILANVLGGGMSSRLFQEVRELRGLCYSVYAFHWGFSDTGIFG 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I +AT  EN+  L   IV+ +      IEQ+EI++  A+I A+L+  QE    RA ++++
Sbjct: 301 IHAATGGENLPELVPVIVDELHKASHKIEQQEIERARAQIRAQLLMGQESPAARAGQVAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHA 417
           Q+M  G  + ++++ + +  IT E +  +A ++F  T PTL+ +GP ++ +    +++ +
Sbjct: 361 QMMLYGRPIPNQEMQERLQGITIERLTDLAGRLFFDTVPTLSAIGP-LEQLAPMEDIVTS 419

Query: 418 LE 419
           L 
Sbjct: 420 LS 421


>gi|49474007|ref|YP_032049.1| processing protease protein [Bartonella quintana str. Toulouse]
 gi|49239510|emb|CAF25866.1| Processing protease protein [Bartonella quintana str. Toulouse]
          Length = 424

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 181/421 (42%), Positives = 260/421 (61%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETFSQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS E T+Y A VLK  +PLA++I+ D+L  S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSTETTAYFARVLKNDIPLAIDILADILMYSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG P+T+ SFT   + SF+ + Y
Sbjct: 121 KQVVFQEIGAARDIPDDIVFDHFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMDKQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV+HE  + +VES+F       I      A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVEHENFLQEVESHFRTFRPHSIAPLTNLANYVGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRAYHARDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +    +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKELLPVILDELSKASKNIHANELQRARAQYRASLTMSQENPSSQANLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   + I+ +  IT   +  +A ++F +STPTLA +GP +  +    +L   L
Sbjct: 361 MLLYGRPIPLSETIERLELITPARLTDLAHRLFINSTPTLAAVGP-VGSLMNFDDLTSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|56697902|ref|YP_168273.1| M16 family peptidase [Ruegeria pomeroyi DSS-3]
 gi|56679639|gb|AAV96305.1| peptidase, M16 family [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 154/418 (36%), Positives = 238/418 (56%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R  + ++G  +++E MP   SA + + + AG R+ER +++G+AHFLEHM FKGT +R
Sbjct: 1   MTVRQDQLANGFRIVSENMPGLQSAAIGIWVTAGGRHERIDQNGIAHFLEHMAFKGTERR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VLKE V LAL++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLKEDVALALDVIGDIVLNPVFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  ++DQ +GR ILG  E +S+F+   + +FV+ NY
Sbjct: 121 RGVILQEIGQAHDTPDDVIFDWLQEESYRDQPLGRTILGPVERVSAFSRADLSAFVADNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH+  V   E  F   +  K   +  PA++ GGE  +++ L + H  
Sbjct: 181 GPEQMILSATGAVDHDLLVRLAEEMFGHLTPRKGALA-VPALFTGGEARREKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G  Y+    Y   I +S LG GMSSRLFQEVRE RGLCY+I A    ++D G   I
Sbjct: 240 LALEGPGYRDDAIYTAQIYSSALGGGMSSRLFQEVREVRGLCYTIFAQTGAYADTGTTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    ++ ++   E++ + E+ +  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSAGQVAELAGITIDEMKRAAEDMSEAEVARARAQMKAGMLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E  +  I A+T  D+   A+++    P    L  P+   P  +EL   
Sbjct: 360 VQIWGKVPSLEDTVARIDAVTTADVRAFAEQMAVEAPAALALYGPVSAAPNLAELQER 417


>gi|27376293|ref|NP_767822.1| mitochondrial processing peptidase-like protein [Bradyrhizobium
           japonicum USDA 110]
 gi|27349433|dbj|BAC46447.1| mitochondrial processing peptidase-like protein [Bradyrhizobium
           japonicum USDA 110]
          Length = 429

 Score =  216 bits (549), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 151/404 (37%), Positives = 240/404 (59%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ISK +SG+TV+T+ MP +++A + V    G R+E+  EHG++H LEHM FKGTTKR
Sbjct: 1   MSVEISKLASGLTVVTDKMPHLETAALGVWAGVGGRDEKPNEHGISHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EIVEEIE VGGD+NA TS E TSY+A VLK  VPLAL+++ D+L+N +F P ++ERE
Sbjct: 61  SSREIVEEIEAVGGDLNAGTSTETTSYYARVLKADVPLALDVLADILANPAFEPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG ++D   D +    +E+ + DQ +GR +LG  +T+ +F  + +  ++S +Y
Sbjct: 121 KNVIVQEIGAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTAKTLRAFNRDMLRGYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V++ E  F         +        GG  +  R+L + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHSQVVAEAEKRFASFEGTPGPKPQAAQFGKGGAKVVHRELEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVREKRGLCYSI + H  ++D G   +
Sbjct: 241 LALEGVPQNDLSLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYSFHAPYTDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVVVDVMNDSVETLTEAEIARAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           V+  G     ++++  I A++ E     A+ + S S P +  LG
Sbjct: 361 VLAYGRPQTVQELVARIDAVSVESTRDAARALLSRSRPAVVALG 404


>gi|254477226|ref|ZP_05090612.1| Zn-dependent peptidase family protein [Ruegeria sp. R11]
 gi|214031469|gb|EEB72304.1| Zn-dependent peptidase family protein [Ruegeria sp. R11]
          Length = 420

 Score =  215 bits (548), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 153/419 (36%), Positives = 233/419 (55%), Gaps = 4/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++  + ++G  V+TE MP   SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVKQHQLANGFRVVTETMPGLQSAAIGLWVTAGGRHERIEQNGIAHFLEHMAFKGTKRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A EI E IE VGG INAYTS E T+Y+A VLK+ VPLA++++ D++ N  F+  +IE E
Sbjct: 61  SALEIAEAIEDVGGYINAYTSREVTAYYARVLKDDVPLAMDVVADIVLNPIFDQREIEIE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ IGR ILG  E + +F    +  FV+ +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEESYHDQPIGRTILGPAERVRAFGRADLEGFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   GAVDH+  V   E          +   + PA + GGE   ++ L + H+ 
Sbjct: 181 GPGQMILAASGAVDHDAIVKLAEDLIGHMRPKPL-FEVAPARFTGGEARHEKALEQAHIA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+  D Y   I +S LG GMSSRLFQEVREKRGLCY+I A    ++D G L +
Sbjct: 240 LAFEGPGYRDDDIYTAQIYSSALGGGMSSRLFQEVREKRGLCYTIFAQTGAYADTGALTL 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   +  L    ++ ++   +++   E+D+  A++ A ++   E    RA  +++ 
Sbjct: 300 YAGTSGAQLDQLAQITIDEMKRAADDMSDAEVDRARAQMKAGMLMGLESPTNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSELIHA 417
           V     +   E+ +  I A+T  D+  +A+ +    P  LA+ GP  D       L   
Sbjct: 360 VQIWDKVPPLEETVARIDAVTTADVRAMAQAMAHEAPMALALYGPVGDAA-RLEALQER 417


>gi|260893499|ref|YP_003239596.1| peptidase M16 domain protein [Ammonifex degensii KC4]
 gi|260865640|gb|ACX52746.1| peptidase M16 domain protein [Ammonifex degensii KC4]
          Length = 418

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 138/403 (34%), Positives = 230/403 (57%), Gaps = 4/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++++   +G+T++TE +P + S  + + + AGSR+E   ++G++HF+EH LFKGT  R+A
Sbjct: 2   VKVTDLGNGVTILTEEIPHVRSVALGIWVAAGSRDEEANQNGISHFIEHALFKGTKNRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE+E VGG INA+T+ E+T Y+A VL E+  LA +++ D++ ++ F+P D+ERE+N
Sbjct: 62  RQIAEELESVGGQINAFTAKEYTCYYARVLDEYFELAADVLTDLVFHARFDPQDLEREKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED   + +   FS  +WKD  +GRP++G  ET+ + T E+I  +  R+Y  
Sbjct: 122 VILEEIRMYEDTPDELVHDLFSATLWKDHPLGRPVIGTEETVKNLTSEEIFRYYERHYLR 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM V   G V HE  V  +   F      + +          G     R   + H+ LG
Sbjct: 182 GRMVVAVAGNVTHERAVDLLAPRFAAVK-EESRSPGDQPRPWFGSNFFLRSTEQVHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G A    D Y   +L ++LG GMSSRLFQ+VRE+ GL YS+ ++H  + D G+  I +
Sbjct: 241 TPGLAMGDDDIYTFQVLNTLLGGGMSSRLFQKVREEGGLVYSVYSYHSAYRDTGLFCIYA 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             A EN+     +IVE ++     ++   E+++   ++    + S E    R   + K  
Sbjct: 301 GLAAENVPRALQAIVEELKKVCRSDLSPEEVERAKNQLKGSFLLSLESVTTRMSRLGKSW 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILG 402
           ++ G +L  E++ + I+A+T E +  +A++ F  +   L  LG
Sbjct: 361 LYLGRVLSPEEVAERITAVTLEQVQALARRFFHPSGLVLTTLG 403


>gi|319898537|ref|YP_004158630.1| processing protease protein [Bartonella clarridgeiae 73]
 gi|319402501|emb|CBI76044.1| processing protease protein [Bartonella clarridgeiae 73]
          Length = 427

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 172/421 (40%), Positives = 262/421 (62%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+++ T  MP I+S  + + ++ GSRNE  ++HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLSIATHKMPQIESVALGIWVKVGSRNETFKQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLKE +PLA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFKIATDIEDVGGEINATTSIETTAYFARVLKEDIPLAIDILADIMTCSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++ Q +GR ILG  +T+ SFT   + +F+++ Y
Sbjct: 121 KQVIFQEIGATCDVPDDIVFDHFTETAFRHQSLGRSILGTQQTVQSFTSADLHNFMNQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV+HE  + QVES             +  A Y+GG++ + RDL +  ++
Sbjct: 181 SADRMVVVATGAVEHEDFLRQVESCLGTFRSHSTAPLINLANYIGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHAHDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVILDELCKISKNIHTNELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   ++ + +  IT E +  +AK++F +S PT A +GP    +    +L+  L
Sbjct: 361 MLLYGRPIPISEMTECLELITLEQLTDLAKRLFINSNPTFAAVGP-TGPLMNFDDLVSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|84685595|ref|ZP_01013492.1| peptidase, M16 family protein [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666261|gb|EAQ12734.1| peptidase, M16 family protein [Rhodobacterales bacterium HTCC2654]
          Length = 420

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 146/419 (34%), Positives = 228/419 (54%), Gaps = 2/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +      +G  V+TE MP  +S  + V I AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTINYDTLPNGFRVVTEHMPGIESVSLGVWITAGGRHERVEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T  +I EEIE VGG +NAYT  E T+Y+A VL+E   LA++++ D+L N  F+P +IE E
Sbjct: 61  TPLQIAEEIEDVGGYLNAYTGREVTAYYARVLREDTALAIDVVSDILLNPVFDPHEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E+ +  Q IGRPILG  E + +F    +  FV  +Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEVAYPGQAIGRPILGPAERVQAFAQGDLAGFVDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             DRM     GAVDH+  + ++               ++PA +VGGE  + + L + H  
Sbjct: 181 GPDRMIFAAAGAVDHDE-IMRLCEQAFGGLQRPSSTLIQPAGFVGGERSEIKKLEQVHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G  Y+    Y   + A+ LG GMSSRLFQE REKRGLCY+I +    +SD G++ I
Sbjct: 240 LALEGPGYRDDAIYTAQVYANALGGGMSSRLFQEAREKRGLCYTIFSQAGAWSDTGLITI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+   I  L    ++ ++    ++ + E+ +  A++ A ++   E +  RA  +++Q
Sbjct: 300 YAGTSAGEIKGLAELTIDELRRATSDMTEAEVARARAQMRAGMLMGLESASSRAERLARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           V     ++  E+ ++ + A+T E +   A ++         +  P    P+ ++L   L
Sbjct: 360 VAIWNRVVPVEETVERLDAVTLEGVTDFATQVAGDPRAALAIYGPGKTAPSLAQLTERL 418


>gi|114706689|ref|ZP_01439590.1| hypothetical protein FP2506_13094 [Fulvimarina pelagi HTCC2506]
 gi|114538081|gb|EAU41204.1| hypothetical protein FP2506_13094 [Fulvimarina pelagi HTCC2506]
          Length = 436

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 178/428 (41%), Positives = 280/428 (65%), Gaps = 6/428 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +I++  +G+TV+++ M  ++SA +   ++ G+R+E + EHG+AH LEHM FKGT +R
Sbjct: 1   MTQQITRLDNGLTVVSDRMDNLESAALGFWVKTGARDEHEGEHGIAHLLEHMAFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS+E TSY+A VLK+ VPLAL+I+ D+L NS F+P ++ERE
Sbjct: 61  SARDIAEEIENVGGELNAGTSVESTSYYARVLKDDVPLALDILSDILLNSRFDPVELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+L+EIG +ED   D +   F E  + DQI+GRPILG  +++ SF+P  + +++ R Y
Sbjct: 121 QHVILQEIGAAEDTPDDIVFDHFQETAFTDQIVGRPILGTRDSVRSFSPSDLRAYLDRQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRDLAEE 236
             DR+ V   GAV+H+  V+QV S F                 A Y GGEY ++RDLA+ 
Sbjct: 181 GPDRIVVSAAGAVEHDAIVAQVSSLFEHRRSPILEPANVKRSAARYTGGEYRERRDLADA 240

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
            +++GF G  Y  RDFY + +L+ +LG GMSSRLFQE+RE+RGLCYSI A H +FSD+G+
Sbjct: 241 QLLIGFEGRPYYQRDFYSSQVLSMVLGGGMSSRLFQEIRERRGLCYSIYAFHWSFSDSGL 300

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
             I +AT +E +  L  +IVE +    E I   E+ +  A++ + L+  QE   +RA ++
Sbjct: 301 FGIHAATGEEELQELGETIVEELVKASEEISDTEVVRARAQMRSSLMMGQESPAVRAGQM 360

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELI 415
           ++Q+MF G+I+ SE++ D ++AI    +  +A ++F    PTLA +G  ++ + +   L 
Sbjct: 361 ARQLMFNGAIISSEELFDRLAAIDAARLKDLAGRLFIDGAPTLAAIGK-LERLASVDALA 419

Query: 416 HALEGFRS 423
             L+  ++
Sbjct: 420 MPLKAGQT 427


>gi|195143879|ref|XP_002012924.1| GL23853 [Drosophila persimilis]
 gi|194101867|gb|EDW23910.1| GL23853 [Drosophila persimilis]
          Length = 470

 Score =  215 bits (546), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 101/429 (23%), Positives = 197/429 (45%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E +  +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGAATATVGLWIDAGSRSENERNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS      I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLEEEKIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEIESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYNASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V HE  V    S       + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAAAGGVKHEDLVQLAGSSLGRLEASTLPPDITPCRFTGSEVRVRDDSLPLAHVAVAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  +I      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMIFNIQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++ + I+ ++  ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEERINNVSVSNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|39933917|ref|NP_946193.1| putative protease [Rhodopseudomonas palustris CGA009]
 gi|192289336|ref|YP_001989941.1| peptidase M16 domain protein [Rhodopseudomonas palustris TIE-1]
 gi|39647764|emb|CAE26284.1| putative protease [Rhodopseudomonas palustris CGA009]
 gi|192283085|gb|ACE99465.1| peptidase M16 domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 429

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 149/404 (36%), Positives = 238/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +SK  SG+T++T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT+R
Sbjct: 1   MTVEVSKLPSGLTIVTDTMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T++EI EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N SF   ++ERE
Sbjct: 61  TSREIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPSFEAEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q IGR +LG  +T+ SF+ EK+ S++S +Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKSFSREKLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V +V   F         +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHARIVEEVSHRFASFDGTPAPKPQPAMFGAGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G    +   +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  +SD G   +
Sbjct: 241 LALEGLPQSAPTLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+V+   ++ +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVIVDVINDAVDTLTDAEISRAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G  L  ++++  I A+T +      + + + S P +  LG
Sbjct: 361 ILAYGRPLPVDELVGRIDAVTIDTAREAGRTLLARSRPAVVALG 404


>gi|58697219|ref|ZP_00372620.1| mitochondrial processing peptidase-like protein [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225630488|ref|YP_002727279.1| peptidase, M16 family [Wolbachia sp. wRi]
 gi|58536454|gb|EAL59862.1| mitochondrial processing peptidase-like protein [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592469|gb|ACN95488.1| peptidase, M16 family [Wolbachia sp. wRi]
          Length = 424

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 138/425 (32%), Positives = 246/425 (57%), Gaps = 6/425 (1%)

Query: 1   MNL-RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ R++K  +G+ +ITE    IDS  + + +  GSR E  +++G++HFLEHM FKGT  
Sbjct: 1   MNVPRVTKLDNGLRIITEQVRDIDSVALSIRVGVGSRAESAKQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E T+Y+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGVFNASTGRESTTYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIVFDKYFEAAYKDQPFGRSILGTQDTVKSFTRGDLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + M     G V+HE  V+  + +F+     K+K+S     + GGEY++ R L + H+
Sbjct: 181 YFGENMLFAVAGNVEHEEVVALTKDFFSKIHSKKLKKSQNATSHTGGEYLEHRKLDQVHL 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + +++D G+  
Sbjct: 241 LIGLPSVSRHDDKYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTDTGMFS 300

Query: 299 IASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  SI   ++    +++ + E+++   ++ ++++ S+E    RA  + 
Sbjct: 301 IFAGTDSSNLDKLLKSITTELKKLSTDDLREEEVNRVKERVKSQILMSRESVSSRAETLG 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILGPPMDHVPTTSELI 415
                    +   ++I+ ISA+T  ++   A+++ S     TLA +G  +  +P+  +++
Sbjct: 361 HYYGNYNRYISKNELIEKISAVTTANVKKAAEELLSQHEKATLAAIG-EIKSLPSYDKVV 419

Query: 416 HALEG 420
             L+ 
Sbjct: 420 SMLKA 424


>gi|90426267|ref|YP_534637.1| peptidase M16-like [Rhodopseudomonas palustris BisB18]
 gi|90108281|gb|ABD90318.1| peptidase M16-like [Rhodopseudomonas palustris BisB18]
          Length = 429

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 150/404 (37%), Positives = 244/404 (60%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K  SG+TV+T+ MP + +A + V    G R+E+ +EHG++H LEHM FKGTTKR
Sbjct: 1   MSVEVTKLPSGLTVVTDTMPHLQTAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EIVEEIE VGGD+NA TS E T+Y+A V+K+ VPLAL+++ D+L+N SF P ++ERE
Sbjct: 61  SSREIVEEIEAVGGDLNAGTSTETTAYYARVMKDDVPLALDVLSDILANPSFVPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q +GR +LG P+T+  F  + +  ++S++Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEHLNELCYPEQPMGRSLLGTPQTLKGFDRDTLQGYLSKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V +V++ F     A     +      GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHQQIVDEVQNRFKSFDAAPAPAPLPALFGPGGSKVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  ++LG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGLPQTDPSLFSLQVFTNVLGGGMSSRLFQEVREKRGLCYSIYTFHAPYTDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVIVDVINDAVETLTEAEISRAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G  L  E+++  I A++ E     A+ + S S P +  LG
Sbjct: 361 MLAYGRPLPVEELVAKIDAVSVESTSKAARALLSRSRPAVVALG 404


>gi|125773947|ref|XP_001358232.1| GA17647 [Drosophila pseudoobscura pseudoobscura]
 gi|54637968|gb|EAL27370.1| GA17647 [Drosophila pseudoobscura pseudoobscura]
          Length = 470

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 101/429 (23%), Positives = 196/429 (45%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E +  +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGAATATVGLWIDAGSRSENERNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS      I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLEEEKIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEIESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V HE  V    S       + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAAAGGVKHEDLVQLAGSSLGRLEASTLPPEITPCRFTGSEVRVRDDSLPLAHVAVAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  +I      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMIFNIQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I+ ++  ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRINNVSVSNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|195501490|ref|XP_002097818.1| GE24263 [Drosophila yakuba]
 gi|194183919|gb|EDW97530.1| GE24263 [Drosophila yakuba]
          Length = 470

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 199/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E ++ +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V    +       + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAAAGGVKHDDLVKLACNSLGGLEASVLPAEITPCRFTGSEVRVRDDSLPLAHVAIAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMLYNVQSEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A++  ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVSVGNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|153007943|ref|YP_001369158.1| processing peptidase [Ochrobactrum anthropi ATCC 49188]
 gi|151559831|gb|ABS13329.1| processing peptidase [Ochrobactrum anthropi ATCC 49188]
          Length = 430

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 270/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ S+G+T+ T+ M  ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLSNGLTIATDTMSHVESVALGIWVKAGARNEAADRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  VPLA++I+ D+L+ S F+ +++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDVPLAIDILSDILTASKFDEAELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT   +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSADLRQYMDEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G VDH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGVDHDAFVKEVEKRLGGFRAHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ +LG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMVLGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   +++ +    ++I   E+D+  A+  A L+ SQE +  RA ++++Q
Sbjct: 301 HAATGRDELVELVPVLIDELHKAADSISLEEVDRARAQYRASLLMSQESAASRAGQVARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT E +  +A ++F  S PT+A +GP +  + +   L  AL
Sbjct: 361 FLLYGRPVENSELMDRLSLITPERLTDLAGRLFLDSKPTIAGVGP-VGRLMSFDGLSDAL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|83589907|ref|YP_429916.1| peptidase M16-like [Moorella thermoacetica ATCC 39073]
 gi|83572821|gb|ABC19373.1| Peptidase M16-like protein [Moorella thermoacetica ATCC 39073]
          Length = 421

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 130/417 (31%), Positives = 230/417 (55%), Gaps = 4/417 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +GI +++E +P ++S  + V +R GSRNE ++  G++HFLEH+LFKGTT+RTA
Sbjct: 2   YQKEILENGIRIVSEEIPFVNSVALGVWVRTGSRNEDEDNQGVSHFLEHLLFKGTTRRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE+E VGG INA+T+ E+T +++ VL EH+ LA++++ DM  NS   P DIE+E+ 
Sbjct: 62  RQIAEELEAVGGVINAFTTKEYTCFYSRVLAEHLDLAIDVLSDMFFNSLLAPEDIEKEKR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED   + +   F+  +W    +GR ILG  ET+++   + I  +    Y  
Sbjct: 122 VILEEIKMYEDSPDELIHDLFARTIWPGHPLGRAILGTYETVAALNRDLIYRYYQEQYNC 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             + +   G  +    + ++E+ F             P V      +Q +D  +  + LG
Sbjct: 182 ANIVLAAAGKFNTSELIVKLEASFGRQRRPGKAAQFHPPVNRAATSMQVKDTEQVQICLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G A      Y    L +ILG G+SSRLFQ +RE+R L YS+ ++H  F D+G+  + +
Sbjct: 242 VPGLAQDDPAIYAVQALNNILGGGLSSRLFQLIREERALAYSVYSYHAGFGDSGLFTVYA 301

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T+ +N   +   ++E + SL    + + E+ +   +I   L+  QE    R   + K  
Sbjct: 302 GTSPDNYRQVVQLVLEELASLKNNGVTEEELKRTKDQIRGNLLLGQESVSQRMSRLGKTE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIH 416
           +  G ++ +E++I+ ++ +T +D+  +A+++F     +L  LGP ++ +   + +  
Sbjct: 362 VSFGRVITAEEVIERLNQVTRDDVQALAQRLFRPEYLSLTALGPEVEPL-DLAAIAS 417


>gi|116626241|ref|YP_828397.1| peptidase M16 domain-containing protein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116229403|gb|ABJ88112.1| peptidase M16 domain protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 428

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 127/405 (31%), Positives = 216/405 (53%), Gaps = 4/405 (0%)

Query: 2   NLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++ ++  ++G+ VITE M  + S  V + I AGSR E  E++G++HF+EHMLFKGTT R+
Sbjct: 10  DIEMTTLANGVRVITEAMQHVRSVSVGIWIGAGSRRETTEQNGISHFIEHMLFKGTTTRS 69

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I   ++ +GG+++A+T+ E   ++  VL +H+  A E++ D++ N  F   DIE+E+
Sbjct: 70  AEDIARAVDALGGNLDAFTAKELVCFNTKVLDQHLSQAFEVLADLVLNPMFREEDIEKEK 129

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M  D     +   FS   WKD  +G+PILG P+++  F    I  F    Y+
Sbjct: 130 GVILEEIKMEADSPDYLVHEIFSSNFWKDHPLGKPILGTPQSVRRFDSTMIRDFYRSVYS 189

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-KPAVYVGGEYIQKRDLAEEHMM 239
              M V   G + HE   + V+ YF             +P+ +       K+ L + H+ 
Sbjct: 190 PANMVVTAAGHMTHEGLTALVQQYFASLPPGPAAPPDLQPSTHARIALRNKKSLEQVHLC 249

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG         + +   +L ++LG GMSSRLFQ +RE++GL Y++ +    + D G L I
Sbjct: 250 LGVPSYPLPHEERFACYVLNTLLGGGMSSRLFQNIRERQGLAYAVFSELNPYRDTGCLSI 309

Query: 300 ASATAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T+ E+   +  SI    + L  +     E+ +    +   L+   E +  R   +++
Sbjct: 310 YAGTSAESARQVVESITTEFRQLKGDRVGDEELRRAKDHLKGSLMLGLESTASRMSNLAR 369

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILG 402
           Q M+ G     ++++++I A+T ED+  +A+  F S    L ILG
Sbjct: 370 QEMYFGRFFTLDELVESIEAVTAEDVRRIAQTFFDSRQIALTILG 414


>gi|158287073|ref|XP_309120.3| AGAP000935-PA [Anopheles gambiae str. PEST]
 gi|157019733|gb|EAA04978.4| AGAP000935-PA [Anopheles gambiae str. PEST]
          Length = 449

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 100/431 (23%), Positives = 190/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   SG+ V +E     +A V + I AGSR E    +G+AHFLEHM FKGT KR+  +
Sbjct: 19  EVTTLDSGLRVASEDSGSQTATVGLWIDAGSRYENDSNNGVAHFLEHMAFKGTAKRSQTD 78

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ +S    ++IERER V+
Sbjct: 79  LELEVENMGAHLNAYTSREQTVFYAKCLSKDVPKAVEILSDIIQHSKLGEAEIERERGVI 138

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G  ILG  + I S     +  ++  +Y A R
Sbjct: 139 LREMQEVESNLQEVVFDHLHATAYQGTPLGNTILGPTKNIQSIGKSDLQQYIDAHYKAPR 198

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   V   E      S     K               ++   L   H+ +
Sbjct: 199 IVLAAAGGVRHGDLVRLAEQALGKVSSSVDGKAAALAPCRFTGSEVRVRDDSLPLAHVAI 258

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              GC +  +D     +  +++G    S+        +        GLC+S  + +  + 
Sbjct: 259 AVEGCGWTDQDNVPLMVANTLIGAWDRSQGGGANNASKLAMASATDGLCHSFQSFNTCYK 318

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I           +  ++      L   + + E+++    +   ++   + +   
Sbjct: 319 DTGLWGIYFVCDPLKCEDMLFNVQNEWMRLCTMVTEGEVERAKNLLKTNMLLQLDGTTPI 378

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I ++T +++  VA K  F   P +A +GP ++++P  
Sbjct: 379 CEDIGRQMLCYNRRIPLHELEQRIDSVTAQNVRDVAMKYIFDRCPAVAAVGP-VENLPDY 437

Query: 412 SELIHALEGFR 422
             +  ++   R
Sbjct: 438 VRIRSSMYWTR 448


>gi|195451318|ref|XP_002072862.1| GK13463 [Drosophila willistoni]
 gi|194168947|gb|EDW83848.1| GK13463 [Drosophila willistoni]
          Length = 470

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 196/429 (45%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E ++ +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS     +I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEGEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V            + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAGAGGVKHDELVKLATQNLGRLEASLLPPEVTPCRFTGSEVRVRDDSLPLAHVAVAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMIFNVQSEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A+   ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVNVSNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|68171230|ref|ZP_00544634.1| Insulinase-like:Peptidase M16, C-terminal [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88657608|ref|YP_507056.1| M16 family peptidase [Ehrlichia chaffeensis str. Arkansas]
 gi|67999350|gb|EAM85995.1| Insulinase-like:Peptidase M16, C-terminal [Ehrlichia chaffeensis
           str. Sapulpa]
 gi|88599065|gb|ABD44534.1| peptidase, M16 family [Ehrlichia chaffeensis str. Arkansas]
          Length = 421

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 144/421 (34%), Positives = 247/421 (58%), Gaps = 5/421 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ +I++ S+  T+IT+ MP ++S  + + +  GSR E     G++HFLEHM FKGT  R
Sbjct: 1   MSPKITQLSNNFTIITDTMPYVESVSINIWVNVGSRYENINITGISHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I +  + +GG+ NA+T  EHT YH   LK  + +A+E++ D++ NS F   +I +E
Sbjct: 61  TALDIAQIFDDIGGNFNAHTDREHTVYHVKTLKRDIKIAIEVLADIILNSQFPEEEIYKE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL+EI  + D     +  ++ E  + +QI G+ ILG PE+++S +   +  ++S  Y
Sbjct: 121 KGVVLQEIYQTNDSPTSIIFDKYIEAAYPNQIFGKSILGTPESVNSLSKADLHIYMSEYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   G + HE  +  V  YF+    ++ K +  P++Y  GEY + R+L + H++
Sbjct: 181 HAGNMLLSVAGNISHEEVIDLVSQYFSHMKKSQRKIA-DPSIYRSGEYREIRNLEQVHLV 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF   +Y+   FY   IL SILG+GMSSRLFQ++RE+ GL Y+IS+ + ++SDNG+  I
Sbjct: 240 IGFPSVSYKDDLFYTIQILDSILGNGMSSRLFQKIREQLGLVYTISSFNSSYSDNGIFSI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT K N+  L S+I   V++++ N+++ EI +   K+ ++++ S+E +  RA  +   
Sbjct: 300 YAATDKSNLSQLLSTIASEVKNIITNLQENEITRAKGKLTSEILMSRESTTARAESLGYY 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSELIHA 417
                  +  E++I  IS IT  DI      +  S    TLA +G  ++++P+  ++   
Sbjct: 360 YSHYNRYISKEELIKKISTITVTDIQNCINNLLGSNNKITLAAIG-QIENLPSYDDIAQM 418

Query: 418 L 418
            
Sbjct: 419 F 419


>gi|194900870|ref|XP_001979978.1| GG16882 [Drosophila erecta]
 gi|190651681|gb|EDV48936.1| GG16882 [Drosophila erecta]
          Length = 470

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 199/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E ++ +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V    +       + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAAAGGVKHDDLVKLACNSLGGLEASVLPAEVTPCRFTGSEVRVRDDSLPLAHVAIAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMLFNVQSEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A++  ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVSVGNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|239831352|ref|ZP_04679681.1| processing peptidase [Ochrobactrum intermedium LMG 3301]
 gi|239823619|gb|EEQ95187.1| processing peptidase [Ochrobactrum intermedium LMG 3301]
          Length = 432

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 168/421 (39%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++ S+G+T+ T+ M  ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 3   MGVEVTRLSNGLTIATDTMSHVESVALGIWVKAGARNEAADRHGIAHLLEHMAFKGTENR 62

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  VPLA++I+ D+L+ S F+ +++ERE
Sbjct: 63  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDVPLAIDILSDILTASKFDEAELERE 122

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 123 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMDEQY 182

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G VDH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 183 SADRMVVTAAGGVDHDAFVREVEKRLGGFRAHNTAPTLDLAHYVGGDFRENRELMDAQVL 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ +LG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 243 IGFEGRAYHVRDFYASQLLSMVLGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   +++ +    ++I   E+D+  A+  A L+ SQE +  RA ++++Q
Sbjct: 303 HAATGRDELVELVPVLIDELHKAADSISLEEVDRARAQYRASLLMSQESAASRAGQVARQ 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
            +  G  + + +++D +S IT + +  +A ++F  S PT+A +GP +  + +   L  AL
Sbjct: 363 FLLYGRPVENSELMDRLSLITPQRLTDLAGRLFLDSKPTIAGVGP-VGRLMSFDGLSDAL 421

Query: 419 E 419
            
Sbjct: 422 S 422


>gi|21357875|ref|NP_650401.1| CG3731, isoform B [Drosophila melanogaster]
 gi|24646943|ref|NP_731954.1| CG3731, isoform A [Drosophila melanogaster]
 gi|195328891|ref|XP_002031145.1| GM24191 [Drosophila sechellia]
 gi|195570810|ref|XP_002103397.1| GD18983 [Drosophila simulans]
 gi|16182307|gb|AAL13472.1| GH01077p [Drosophila melanogaster]
 gi|23171295|gb|AAF55110.2| CG3731, isoform A [Drosophila melanogaster]
 gi|23171296|gb|AAN13622.1| CG3731, isoform B [Drosophila melanogaster]
 gi|194120088|gb|EDW42131.1| GM24191 [Drosophila sechellia]
 gi|194199324|gb|EDX12900.1| GD18983 [Drosophila simulans]
 gi|220945206|gb|ACL85146.1| CG3731-PA [synthetic construct]
 gi|220955020|gb|ACL90053.1| CG3731-PA [synthetic construct]
          Length = 470

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 100/429 (23%), Positives = 199/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E ++ +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKADLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V    S       + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAAAGGVKHDDLVKLACSSLGGLEASVLPAEVTPCRFTGSEVRVRDDSLPLAHVAIAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A++  ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVSVGNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|73981963|ref|XP_533104.2| PREDICTED: similar to Mitochondrial processing peptidase beta
           subunit, mitochondrial precursor (Beta-MPP) (P-52)
           [Canis familiaris]
          Length = 513

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 99/431 (22%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R+++  +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 83  RVTRLDNGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 142

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 143 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 202

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 203 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 262

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 263 IVLAAAGGVSHDELLELAKFHFGDSLSTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAV 322

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 323 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 382

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        I  +   + +    L  +I + E+ +    +   ++   + S   
Sbjct: 383 DTGLWGIYMVCEPATIADMLHVVQKEWMRLCTSITESEVARAKNLLKTNMLLQLDGSTPI 442

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K     +P LA +GP ++ +P  
Sbjct: 443 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIQEVCTKYIYDKSPALAAVGP-IEQLPDF 501

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 502 NQIRRNMCWLR 512


>gi|92115894|ref|YP_575623.1| peptidase M16-like [Nitrobacter hamburgensis X14]
 gi|91798788|gb|ABE61163.1| peptidase M16-like protein [Nitrobacter hamburgensis X14]
          Length = 429

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 147/404 (36%), Positives = 237/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K  SG+TV+T+ MP +++A + V    G R+E+  EHG++H LEHM FKGTT R
Sbjct: 1   MSVDVTKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPNEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGGD+NA T +E T+Y+A V+K  VPLAL+++ D+LSN +F   ++ERE
Sbjct: 61  SAREIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLSDILSNPNFAADELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+ +EIG ++D   D +    +E+ + DQ +GR +LG PET+  F  + +  +++ +Y
Sbjct: 121 KSVIEQEIGAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTPETLKRFNGDSLHGYLATHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAV+H+  V++VE  F     A   +        GG  +  RDL + H+ 
Sbjct: 181 RGPNMVVAAAGAVEHKAVVAEVERRFASFDAAPAPKPQAAKFGKGGSKVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G     R  +   +   ++G GMSSRLFQEVREKRGLCYSI A H  ++D G   +
Sbjct: 241 LALEGLPQTDRSLFSLQVFTHLIGGGMSSRLFQEVREKRGLCYSIYAFHAPYADTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+V+   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVVVDVINEAVETLTDTEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G      +++  I A++ E    VA+ I + S P +  LG
Sbjct: 361 ILVYGRPQSVAELMARIDAVSIESTRDVARDILTRSRPAVVALG 404


>gi|194743290|ref|XP_001954133.1| GF16898 [Drosophila ananassae]
 gi|190627170|gb|EDV42694.1| GF16898 [Drosophila ananassae]
          Length = 470

 Score =  212 bits (540), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 100/429 (23%), Positives = 198/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E ++ +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENEKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++I RER+V+
Sbjct: 102 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGEAEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V    S       + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAAAGGVKHDDLVKLACSNLGGLEASVLPPEVTPCRFTGSEVRVRDDSLPLAHVAVAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMIFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A+   ++  VA K      P +A +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVNVGNVRDVAMKYIYDRCPAVAAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|301786595|ref|XP_002928710.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Ailuropoda melanoleuca]
          Length = 489

 Score =  212 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 98/431 (22%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R+++  +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTRLDNGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLELAKFHFGDSLSTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAV 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        I  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGIYMVCEPATIADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K     +P LA +GP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIQEVCTKYIYDKSPALAAVGP-IEQLPEF 477

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 478 NQIRRNMCWLR 488


>gi|84516615|ref|ZP_01003974.1| peptidase, M16 family [Loktanella vestfoldensis SKA53]
 gi|84509651|gb|EAQ06109.1| peptidase, M16 family [Loktanella vestfoldensis SKA53]
          Length = 422

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 152/420 (36%), Positives = 229/420 (54%), Gaps = 2/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M ++    S+G+ ++TE MP   S  + + + AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTIQQHTLSNGLRIVTEQMPGLKSTSIGIWVLAGGRHERIEQNGIAHFLEHMAFKGTKSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I E+IE VGG INAYTS E T+Y+A VL++ V L L+II D+L N  F  ++IE E
Sbjct: 61  TALQIAEQIEDVGGYINAYTSREMTAYYARVLEDDVALGLDIIADILLNPLFEDAEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + DQ +GR ILG+   +S+F    +  FV+ +Y
Sbjct: 121 RGVILQEIGQTLDTPDDIIFDWLQEEAYPDQPLGRSILGEAARVSTFAKGDLDRFVAEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSV-AKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             ++M +   GAVDH+  V Q E+ F       +    ++PA ++GGE    + L + H 
Sbjct: 181 GPNQMILAAAGAVDHDAIVRQAEALFGHLPRVERAAGLLQPAKFIGGERRATKALEQVHF 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G  Y+    Y   I A+ LG GMSSRLFQE+RE RGLCY+I A    + D G+  
Sbjct: 241 ALALEGPTYRDPAIYTAQIYATALGGGMSSRLFQEIRENRGLCYTIFAQAGAYEDTGMTT 300

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           I + T+ E I  L    ++ ++   +++   E+ +  A++ A ++   E    RA  +++
Sbjct: 301 IYAGTSAEQIAELAHLTIDEMKRAADDMSDAEVARARAQMKAGMLMGLESPSNRAERLAR 360

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
            +     I   E+ I  I  +T  D+   A ++     T   L  P D  PT   L   L
Sbjct: 361 LLSIWDRIPGIEETIAHIDDVTTGDVKTFAAQMAGQVGTALALYGPADQAPTLDALKARL 420


>gi|291243428|ref|XP_002741599.1| PREDICTED: mitochondrial processing peptidase beta subunit-like
           [Saccoglossus kowalevskii]
          Length = 481

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 98/431 (22%), Positives = 189/431 (43%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +I+   +G+ V +E   I +  V + I AGSR E    +G+AHFLEHM+FKGT  R+  E
Sbjct: 51  KITTLDNGLRVASEDSGIPTCTVGLWIDAGSRYENAGNNGVAHFLEHMIFKGTKHRSQME 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++I RER V+
Sbjct: 111 LELEIENMGAHLNAYTSREQTVYYAKSFSKDLPKAVEILADIVQNSTLGETEINRERGVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S   + +++++S +Y   R
Sbjct: 171 LREMEEVETNLQEVIFDHLHTTAYQGTALGRTILGPTENIKSLVRDDLLTYISTHYKGPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G +DH   V+    +          +I              ++   +   H+ +
Sbjct: 231 IVLSGAGGIDHNELVALANKHLGKIGSEYENEIPVLPPCRFTGSEIRVRDDSMPLAHIAI 290

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     I  +++G    S                   LC+S  + +  ++
Sbjct: 291 AVESVGWSHPDTIPLMIANTLIGTWDRSHGGGTNVASKLASVCGGSNLCHSFQSFNTCYT 350

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +   T   NI  +   +      L  ++ + E+ +    +   ++   + S   
Sbjct: 351 DTGLWGMYFVTDNMNIDDMLFYVQNEWMRLCTSVTESEVTRAKNLLKTNMLLQLDGSTPI 410

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++  G  +   ++   I A+T + +     +      P +A +GP ++ +P  
Sbjct: 411 CEDIGRQMLCYGRRMSLPELDARIEAVTAKTVRDACTRYIYDKCPAVAGVGP-IEQLPEY 469

Query: 412 SELIHALEGFR 422
           + +   +   R
Sbjct: 470 NRIRGGMYWVR 480


>gi|254488946|ref|ZP_05102151.1| protease [Roseobacter sp. GAI101]
 gi|214045815|gb|EEB86453.1| protease [Roseobacter sp. GAI101]
          Length = 420

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 153/418 (36%), Positives = 237/418 (56%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+L+  + S+G  ++TE MP   SA + V + AG+R+E  +++G+AHFLEHM FKGT KR
Sbjct: 1   MSLQQHRLSNGFRIVTEHMPGLASASIGVWVTAGARHETPQQNGIAHFLEHMAFKGTAKR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+ +I E IE VGG INAYTS E T+Y+  VL+  V L L++I D+L N   + ++IE E
Sbjct: 61  TSLQIAEAIEDVGGYINAYTSREVTAYYVRVLENDVSLGLDVIADILRNPVLDNNEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +     E  + +Q +GR ILG  E +S F+ E +  F+ ++Y
Sbjct: 121 RGVILQEIGQALDTPDDVIFDWLQEEAYPNQPLGRTILGPSEAVSRFSREDLSGFIDQHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             D+M +   GAVDH+  V   E  F       +   +  A + GGE  Q + L + H  
Sbjct: 181 GPDQMILAAAGAVDHDEIVRLAEQLFGDMPKKPM-FDVDAAKFTGGELRQVKTLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y++ D Y+  I AS LG GMSSRLFQEVRE RGLCY+I A    ++D G++ I
Sbjct: 240 LGFESPGYRADDIYVAQIYASALGGGMSSRLFQEVRENRGLCYTIFAQAGAYADTGMMTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++    ++   E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSGEQLPELAGITIDEMKRAASDMSPAEVARARAQMKAGLLMGLESPSNRAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +     +   E+ I  I A+T  D+   A+ + ++ P    L  P+++ PT +EL   
Sbjct: 360 IQIWDRVPPLEETIAQIDAVTTGDVRDFAQTMAATAPAALALYGPVENAPTLAELQER 417


>gi|162147873|ref|YP_001602334.1| M16 family peptidase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542492|ref|YP_002274721.1| processing peptidase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786450|emb|CAP56032.1| Peptidase, family M16 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530169|gb|ACI50106.1| processing peptidase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 421

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 147/403 (36%), Positives = 243/403 (60%), Gaps = 2/403 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            + +++  SG+TV+TE M  +++      + AG+ NE  EE+G++HFLEHM FKGT  RT
Sbjct: 4   QINVTRLPSGLTVVTERMERVETVSFGAYVAAGTCNEHAEENGVSHFLEHMAFKGTDSRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I EEIE VGG INAYT+ EHT+Y+  +LKE + L  +IIGD+L++SSF P ++ERER
Sbjct: 64  AAGIAEEIENVGGHINAYTAREHTAYYVKLLKEDLALGADIIGDILTHSSFAPDEVERER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +   F E  + +Q +GRP LG    I   + E ++ ++  +YT
Sbjct: 124 GVILQEIGQANDTPDDIIFDHFQETAFPEQPMGRPTLGTEPLIQDMSRETLMRYMRTHYT 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
                +   G + H   V+  E +F          +   + Y+GGE+ ++++L + H++L
Sbjct: 184 TANTVIAAAGNLHHADVVALAERHFRDLPALDS-STGFDSRYLGGEFRKEKELDQAHVVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF    Y   D+Y   +L+++LG GMSSRLFQE+REKRGL YS+ + +  F D G+  I 
Sbjct: 243 GFPSVGYGDPDYYPVLLLSTLLGGGMSSRLFQEIREKRGLVYSVYSFNAPFRDGGLFGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T ++    L    +E ++ +  ++ Q E+++  A++ + L+ S E +  R  ++++Q+
Sbjct: 303 AGTGEDQADELIPVTLEELRKVQGHVGQDELNRARAQLKSSLLMSLESTGSRCEQLARQL 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              G ++ + + ++ I+A+T  D+  VA ++F   PTLA LGP
Sbjct: 363 QVFGRLIPTAETVERINAVTIADVRRVATRLFRGKPTLASLGP 405


>gi|91975303|ref|YP_567962.1| peptidase M16-like [Rhodopseudomonas palustris BisB5]
 gi|91681759|gb|ABE38061.1| peptidase M16-like [Rhodopseudomonas palustris BisB5]
          Length = 429

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 151/404 (37%), Positives = 244/404 (60%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ +SK  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT+R
Sbjct: 1   MSVEVSKLPSGLTVVTDTMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T+++I EEIE VGGD+NA TS E T+Y+A V+K  VPLAL+++ D+L+N SF   ++ERE
Sbjct: 61  TSRDIAEEIEAVGGDLNAGTSTETTAYYARVMKADVPLALDVLSDILANPSFAADELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q IGR +LG  +T+ SF  +K+ S++S +Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEYLNELCYPEQPIGRSLLGTAKTLKSFNRDKLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V +V   F     A   +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHKRVVEEVSHRFASFDAAPAPKPQPAMFGAGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G     +  +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGLPQSDKSLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYTDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T  ++   +   IV+V+   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPDDAPEMMEVIVDVINDAVETLTDAEIARAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G  L  ++++  I A++ +    VA+++ S S P +  LG
Sbjct: 361 ILAYGRPLSVDELVAKIDAVSIDTTRHVARELLSRSRPAVVALG 404


>gi|85715320|ref|ZP_01046303.1| peptidase M16 [Nitrobacter sp. Nb-311A]
 gi|85697966|gb|EAQ35840.1| peptidase M16 [Nitrobacter sp. Nb-311A]
          Length = 429

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 146/404 (36%), Positives = 235/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K SSG+TVIT+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MSVDVTKLSSGLTVITDDMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI EEIE VGGD+NA T +E T+Y+A V+K  VPLAL+++ D+LSN SF   ++E E
Sbjct: 61  SAREIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLSDILSNPSFETKELECE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG ++D   D +    +E+ + DQ IGR +LG PET+  F  + +  ++  +Y
Sbjct: 121 KGVIEQEIGAAQDTPDDVVFEHLNELCYPDQPIGRSLLGTPETLKRFNSDMLHGYLKAHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GA++H+  V++VE  F         +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAIEHKAVVAEVEQRFASFDDTPAPQPPSAKFGGGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G +      +   +  +ILG GMSSRLFQEVREKRGLCYSI   H  ++D G   +
Sbjct: 241 LALEGVSQTDASLFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHAPYADTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVVVDVISEAVETLTEAEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G      +++  I A++ E     A+ + + S P +  LG
Sbjct: 361 MLVYGRPQSVPELMARIDAVSVESTCDAARILLARSRPAVVALG 404


>gi|117928714|ref|YP_873265.1| peptidase M16 domain-containing protein [Acidothermus
           cellulolyticus 11B]
 gi|117649177|gb|ABK53279.1| peptidase M16 domain protein [Acidothermus cellulolyticus 11B]
          Length = 451

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 124/414 (29%), Positives = 214/414 (51%), Gaps = 10/414 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ VITE MP + S    + +  GSR+E  +  G +H+LEH+LFKGT +R+A
Sbjct: 30  VRRTVLPGGLRVITEAMPTVRSVAFGIWVGVGSRDETPDIAGSSHYLEHLLFKGTQRRSA 89

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I   ++ VGG++NA+T+ E+T ++A VL   +PLA++++ DM+++S      +E ER 
Sbjct: 90  LDISAALDAVGGELNAFTTKEYTCFYARVLDRDLPLAVDVLADMVTSSLLRSEHVEAERG 149

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   F+E ++ D  +GRP+LG  ++IS+   + I +   R Y  
Sbjct: 150 VILEEIAMRDDDPGDAVHDMFAETLFGDTPLGRPVLGTVQSISAVQRDAIDAHYRRWYRP 209

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF--------NVCSVAKIKESMKPAVYVGGEYIQKRDL 233
           + M V   G + H+  V+ V + F                   + P    G   +  R  
Sbjct: 210 EFMVVAAAGNLVHDEVVALVRNAFAAVLEENSGRTPAPPRIGGVPPQSRAGVVNVVSRPT 269

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + H +LG    A   +      +L   LG GMSSRLFQEVREKRGL YS+ ++  + ++
Sbjct: 270 EQAHFVLGMPALARTDKGRVALGVLNGALGGGMSSRLFQEVREKRGLAYSVYSYAAHHAE 329

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQ-SLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
            G+  + +         +     E +   + + +   E+ +   ++    +   E +  R
Sbjct: 330 TGIFGVYAGCQPGRAREVLDICREQLHAVVRDGLTDDELARGKGQLAGSFVLGLEDTGSR 389

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
              + K  +  G +   ++++  I A+T +DI  VA ++ +  PTLA++GP  D
Sbjct: 390 MSRLGKAELVYGELPTVDELLARIEAVTHDDIRAVAARVLAVPPTLALIGPFDD 443


>gi|126340495|ref|XP_001371284.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           [Monodelphis domestica]
          Length = 560

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/431 (22%), Positives = 190/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 130 RVTTLENGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 189

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 190 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 249

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 250 LREMQEIETNLQEVVFDHLHATAYQKTALGRTILGPTENIKSINRKDLVEYITTHYKGPR 309

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ L
Sbjct: 310 IVLAAAGGVSHDELLDLAKFHFGNSLSRCEGEIPALPACKFTGSEIRVRDDKMPLAHIAL 369

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 370 AVEAIGWSHPDTISLMVANTLIGNWDRSFGGGMNLSSKLAQIACHGNLCHSFQSFNTSYT 429

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +          L  ++ + E+ +    +   ++   + S   
Sbjct: 430 DTGLWGLYMVCEPATVADMIHFAQREWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 489

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  ++I  V  K      P +A +GP ++ +P  
Sbjct: 490 CEDIGRQMLCYNRRIPIPELEARIDAVDAQNIRDVCTKYIYDKHPAVAAVGP-IEQLPDY 548

Query: 412 SELIHALEGFR 422
           + +   +   R
Sbjct: 549 NRICSGMHWLR 559


>gi|146343463|ref|YP_001208511.1| putative zinc protease (mpp-like) [Bradyrhizobium sp. ORS278]
 gi|146196269|emb|CAL80296.1| putative zinc protease (mpp-like) [Bradyrhizobium sp. ORS278]
          Length = 429

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 145/404 (35%), Positives = 238/404 (58%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++K  +G+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MGVEVTKLPTGLTVVTDTMPHLETAALGVWAGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EIVE IE VGGD+NA TS E T+Y+A VLK  VPLAL+++ D+L+N SF P ++ERE
Sbjct: 61  SAREIVEAIEAVGGDLNAGTSTETTAYYARVLKADVPLALDVLSDILANPSFVPEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG ++D   D +    +E+ + DQ +GR +LG  +T+ +F  +K+  ++S +Y
Sbjct: 121 KNVIVQEIGAAQDTPDDVVFEHLNELCFPDQPMGRSLLGTAKTLEAFDRDKLHGYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V  V   F   +  +  +    A   GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHHRVVEDVSRRFASFNGGEGPKPQPAAFGKGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVRE RGLCYS+   H  +SD G   +
Sbjct: 241 LALEGVPQADPSLFSLQVFTNILGGGMSSRLFQEVRENRGLCYSVYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+++ + +E + + E+ +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVVVDIIGNAVETLSEAEVARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G     ++++  I A++ E     A+ + + S P +  LG
Sbjct: 361 ILAYGRPQTLQEMVAKIEAVSVESTRDAARALLARSKPAVVALG 404


>gi|21224084|ref|NP_629863.1| protease [Streptomyces coelicolor A3(2)]
 gi|256784837|ref|ZP_05523268.1| protease [Streptomyces lividans TK24]
 gi|289768730|ref|ZP_06528108.1| protease [Streptomyces lividans TK24]
 gi|6686160|sp|O86835|Y5738_STRCO RecName: Full=Uncharacterized zinc protease SCO5738
 gi|3413821|emb|CAA20289.1| putative protease [Streptomyces coelicolor A3(2)]
 gi|289698929|gb|EFD66358.1| protease [Streptomyces lividans TK24]
          Length = 459

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 127/416 (30%), Positives = 217/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTRKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIQEEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNALGRPVLGTVDTVNALTADRIRRFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV + F      K   +   A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHNKVVRQVRAAFEKSGALKDPAAQPLAPRAGRRTVRAAGRVELIGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVILGMPGLARTDERRWAMGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDHVAEHGLTDDEIGRAVGQLQGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+++T +D+  VA+ +    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLARIASVTPDDVRAVARDVLGRRPSLSVIGPLKDK 449


>gi|149639271|ref|XP_001507859.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           [Ornithorhynchus anatinus]
          Length = 495

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/431 (22%), Positives = 188/431 (43%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 65  RVTSLENGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 124

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A      +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 125 LELEIENMGAHLNAYTSREQTVYYAKAFSRDLPRAVEILADIIQNSTLGEAEIERERGVI 184

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 185 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRNDLVEYITTHYKGSR 244

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   +   + +F                         +    +   H+ +
Sbjct: 245 IVLAAAGGVCHNELLDLAKFHFGNLLPAHEGGTPALPGCKFTGSEIRVNGDKMPLAHIAV 304

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S            ++     LC+S  + +  ++
Sbjct: 305 AVEAVGWSHPDTIPLMVANTLIGNWDRSFGGGVNLSSRLAQITCHGNLCHSFQSFNTCYT 364

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   I +    L  N+ + E+ +    +   ++   + S   
Sbjct: 365 DTGLWGLYMVCEPTTVADMLDCIQKEWIRLCTNVTENEVARAKNLLKTNMLLQLDGSTPI 424

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I AI  +++  V  +     +P +A +GP ++ +P  
Sbjct: 425 CEDIGRQMLCYNRRIPIPELEARIEAIDAQNVRDVCTRYIYDKSPAIAAVGP-IEQLPDY 483

Query: 412 SELIHALEGFR 422
             +   L   R
Sbjct: 484 DRIRSGLVWLR 494


>gi|148260781|ref|YP_001234908.1| processing peptidase [Acidiphilium cryptum JF-5]
 gi|146402462|gb|ABQ30989.1| processing peptidase [Acidiphilium cryptum JF-5]
          Length = 421

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 153/418 (36%), Positives = 243/418 (58%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            ++++K  SG+T++TE M  +++         G+R+E   E+G++HFLEHM FKGT +R+
Sbjct: 4   TVQVTKLDSGLTILTERMDRVETVSFGAYAGVGTRHETAAENGVSHFLEHMAFKGTERRS 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I E IE VGG INAYTS E T+Y+  +LKE + L ++IIGD+L +S+F+P++ ERER
Sbjct: 64  AAAIAEAIEDVGGHINAYTSREQTAYYVKLLKEDLSLGIDIIGDILCHSTFDPAEFERER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +   F    + DQ +G P LG  E I +  P+ +  ++  +YT
Sbjct: 124 GVILQEIGQANDTPDDIVFDHFQLAAYPDQPMGWPTLGTEEIIRAIGPDALRRYMKAHYT 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            + + +   G ++H   V  V  +F     A   E +    Y GGEY + RDL + H++L
Sbjct: 184 PENLVIAASGNLEHARVVDLVAKHFADLPAATRAEPLPAD-YAGGEYRELRDLDQAHLVL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF    Y   DF+   +L+++LG GMSSRLFQE+REKRGL YSI +      D G+  I 
Sbjct: 243 GFPAVGYADPDFHAAMLLSTLLGGGMSSRLFQEIREKRGLVYSIYSFALPARDAGLFGIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T +     L    +  +  + +++ + E+ +  A++ A L+ S E +  R  +I++Q 
Sbjct: 303 AGTGEAEAAELVPVTLGELAKVRQSVSEAELRRARAQVKAGLLMSLESTGSRCEQIARQW 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
              G I+ + + +  I A+T +DI  VA +IF + PTLA +GP +  VP   ++I  L
Sbjct: 363 QIFGRIVPTAETVAKIDAVTVDDITNVATRIFRAKPTLAAIGP-VGRVPQMPKIIERL 419


>gi|315648087|ref|ZP_07901188.1| peptidase M16 domain protein [Paenibacillus vortex V453]
 gi|315276733|gb|EFU40076.1| peptidase M16 domain protein [Paenibacillus vortex V453]
          Length = 422

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 125/401 (31%), Positives = 218/401 (54%), Gaps = 3/401 (0%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +  + S+G+ V+ E +P   S    + ++ GSRNE  E +G+ HF+EHM+FKGT +  A+
Sbjct: 2   KKIQLSNGLRVVMEQIPTSRSVSFGIWVKTGSRNESLEINGITHFIEHMMFKGTERFDAR 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I EE + +GG++NA+TS E+T Y+A VL EH P+A++++ DM  NS  +  ++ +E+NV
Sbjct: 62  AIAEEFDAIGGNVNAFTSKEYTCYYAKVLDEHFPIAVDVLSDMFFNSKLDAGELAKEKNV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M ED   D +    S  V+ D  +  PILG  E + S   + + S++  +YT +
Sbjct: 122 ILEEIAMYEDTPDDLVHDLMSLSVYGDHPLAYPILGTKERLESMDSQALKSYMDTHYTIE 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
              +   G ++ +  +  +E +F   +     E +    ++ G   +K+   + H+ L F
Sbjct: 182 NTVIALAGNIN-DEVIELLERHFGGFTNHGTAEPLAVPAFLDGVQFRKKKTEQNHICLSF 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            GC+      Y   +L + +G GMSSRLFQE+REKRGL YS+ ++H + +DNG+  I + 
Sbjct: 241 PGCSIGDELQYAMVLLNNAIGGGMSSRLFQEIREKRGLAYSVYSYHSSHADNGMFTIYAG 300

Query: 303 TAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           TA +    +     E++  +    + + E+ K   ++   LI   E +  R   + K  +
Sbjct: 301 TAPKQTKEVLQLTTEMLHDVATNGMTEEELRKGKEQLKGSLILGLESTSSRMNRLGKNEL 360

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
             G      +II  I  ++ +D+  V  ++F +   LA++G
Sbjct: 361 MLGHHFSLNEIIKRIEQVSMKDVDAVLDRMFGTPYALAMVG 401


>gi|295696177|ref|YP_003589415.1| peptidase M16 domain protein [Bacillus tusciae DSM 2912]
 gi|295411779|gb|ADG06271.1| peptidase M16 domain protein [Bacillus tusciae DSM 2912]
          Length = 415

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 121/406 (29%), Positives = 215/406 (52%), Gaps = 5/406 (1%)

Query: 7   KTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
           + S+G+TV+ E +P   S  V + +  GSR+E  E +G++H +EHMLFKGT  R+AKE+ 
Sbjct: 6   QLSNGLTVVVEEIPGIRSISVGIWVGTGSRHETPEINGISHLIEHMLFKGTETRSAKELA 65

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           E  + VGG +NA+T+ E+T ++A VL  H   A+E + DM  +S F P ++ +ER V++E
Sbjct: 66  EVFDHVGGQVNAFTAKEYTCFYAKVLDLHFRRAMETLADMFFHSRFAPEELAKERKVIVE 125

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M ED   + +    + +VW D  +G  ILG  +T+ +F  + ++ ++S+ Y      
Sbjct: 126 EIRMYEDTPDELVHDLLASVVWGDHPLGFNILGTEQTLQTFERQNLVDYLSQRYVETNTV 185

Query: 186 VVCVGAVDHEFCVSQVES-YFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
           +   G V  +  ++ VE  +    +    +   +P  +      + +   +EH  L   G
Sbjct: 186 ITVAGHVRTDEVMAIVEELFGGPWNRRAERVITEPPTFTPERGTRVKQTEQEHFCLAVPG 245

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
                 D +   +L + LG  MSSRLFQ +RE++G+ YSI ++H  + D G+L I +  A
Sbjct: 246 LPVDHEDLHAMILLNNTLGGTMSSRLFQSIREEKGMAYSIYSYHTAYRDTGLLGIYAGMA 305

Query: 305 KENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            E    +   +  + + + E  I + E+++   ++   L+ S E +  R   + K  +  
Sbjct: 306 PEYTGEVVREVRRIFEDVAESGITEGELERGKEQVKGSLMLSLESTTSRMTRLGKNELLL 365

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP-PMDHV 408
           G     ++ ++ I A+T ED+  VA+    + P +A +GP P + +
Sbjct: 366 GRHYTLDETLERIDAVTLEDVRRVAQ-CLRNVPAVAAVGPVPGEEL 410


>gi|332976844|gb|EGK13669.1| M16 family peptidase [Desmospora sp. 8437]
          Length = 428

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 124/411 (30%), Positives = 218/411 (53%), Gaps = 3/411 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++  +  +G+ V+ E +P + S    + I AGSR E +E +G++HFLEHMLFKGT KRTA
Sbjct: 11  IQRHQLPNGVRVVAESIPHVRSVAFGLWIGAGSRWETEENNGISHFLEHMLFKGTKKRTA 70

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +++ E  +++GG +NA+TS E T Y+A VL EH+ +A++++ DM   S F P +IE+E+ 
Sbjct: 71  RQLAETFDEIGGQVNAFTSKEMTCYYAKVLDEHLEIAIDVLADMFFESLFEPEEIEKEQK 130

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S    +   +G  +LG  E + SF    ++ +  ++Y  
Sbjct: 131 VVEEEIRMVEDTPDDVVHEYLSAAAMEKNPLGYAVLGNVENVRSFHRSLLLDYKGKHYRP 190

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D++ +   G +   +     E +        I       ++  G  I+ +   + H  +G
Sbjct: 191 DQLVIALAGNLPEHYLEWIAERFGGFQREGNIGSRGGGPLFTAGTSIRHKATEQSHFCIG 250

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G A      Y  N+L ++LG  MSSRLFQEVRE+RGL YS+ ++H  +SD G+  I +
Sbjct: 251 LPGVAVGDPQIYSYNLLNNLLGGNMSSRLFQEVREERGLAYSVFSYHSAYSDTGLFTIYA 310

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            TA      +   ++ +++    + + + E+ K   ++   ++ S E +  R   + K  
Sbjct: 311 GTAPGQENEVIEILLRIMKELREDGVSEEELRKGKEQLKGSMMMSLESTNNRMSRLGKNE 370

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
           +  G     ++++  + ++T +D++  A+ IFS     +I+ P    +PT 
Sbjct: 371 LLLGCHKSLDEVVAAVESLTRQDLLKAAQAIFSHPMAFSIISPEGA-LPTA 420


>gi|312378736|gb|EFR25229.1| hypothetical protein AND_09630 [Anopheles darlingi]
          Length = 494

 Score =  210 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 97/430 (22%), Positives = 191/430 (44%), Gaps = 12/430 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   SG+ V +E     +A V + I AGSR E    +G+AHFLEHM FKGT KR+  +
Sbjct: 65  EVTTLDSGLRVASEDSGSQTATVGLWIDAGSRYENNANNGVAHFLEHMAFKGTAKRSQTD 124

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + V  ++EI+ D++ +S    ++IERER V+
Sbjct: 125 LELEVENMGAHLNAYTSREQTVFYAKCLAKDVSRSVEILSDIIQHSKLGEAEIERERGVI 184

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G  ILG  + I S     + +++S +Y A R
Sbjct: 185 LREMQEVESNLQEVVFDHLHATAYQGTPLGNTILGPTKNIQSIGKSDLQAYISTHYKAPR 244

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA--KIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + +   G V H   V   E +    S       +            ++   L   H+ + 
Sbjct: 245 IVLAASGGVQHGELVKLAEQHLGKISATVDGAAQLSPCRFTGSEVRVRDDSLPLAHVAIA 304

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSD 293
             GC +  +D     +  +++G    S+        +         LC+S  + +  + D
Sbjct: 305 VEGCGWTDQDNVPLMVANTLIGAWDRSQGGGANNASQLAVASATDNLCHSYQSFNTCYKD 364

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
            G+  I           +  ++      L   + + E+++    +   ++   + +    
Sbjct: 365 TGLWGIYFVCDPLRCEDMLFNVQGEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPIC 424

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTTS 412
            +I +Q++     +   ++   I ++T +++  VA K  F   P +A +GP ++++P   
Sbjct: 425 EDIGRQMLCYNRRIPLHELEQRIDSVTAQNVRDVAMKYIFDRCPAVAAVGP-VENLPDYV 483

Query: 413 ELIHALEGFR 422
            +  ++   R
Sbjct: 484 RIRSSMHWVR 493


>gi|311264699|ref|XP_003130289.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Sus scrofa]
          Length = 489

 Score =  210 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLENGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLELAKFHFGDSLSPDEGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGIYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K     +P +A +GP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYDKSPAVAAVGP-IEQLPDF 477

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 478 NQIRSNMCWLR 488


>gi|291391269|ref|XP_002712070.1| PREDICTED: mitochondrial processing peptidase beta subunit
           [Oryctolagus cuniculus]
          Length = 490

 Score =  210 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 92/429 (21%), Positives = 195/429 (45%), Gaps = 13/429 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R+++  +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 60  RVTRLENGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 119

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 120 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 179

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 180 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 239

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F          +              ++   +   H+ +
Sbjct: 240 IVLAAAGGVSHDELLELAKFHFGDSLCTHTGDVPALPPCKFTGSEIRVRDDKMPLAHLAI 299

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 300 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 359

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  + +      +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 360 DTGLWGLYTVCEPGTVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 419

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E +  V  +     +P +A +GP ++ +P  
Sbjct: 420 CEDIGRQMLCYNRRIPIPELEARIDAVNAETVREVCTRYIYDKSPAIAAVGP-IEQLPDF 478

Query: 412 SELIHALEG 420
           +++ H +  
Sbjct: 479 NQICHNMRW 487


>gi|195395272|ref|XP_002056260.1| GJ10322 [Drosophila virilis]
 gi|194142969|gb|EDW59372.1| GJ10322 [Drosophila virilis]
          Length = 470

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 200/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++K  +G+ V +E     +A V + I AGSR+E  + +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTKLDNGLRVASEDSGASTATVGLWIDAGSRSENDKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    S+I RER+V+
Sbjct: 102 LELEVENMGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGESEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V   +        + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAGAGGVKHDELVKLADQSLGRLEASLLPAEVTPCRFTGSEVRVRDDSLPLAHVAVAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMIFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A++ +++  V  K I+   P ++ +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVSVQNVRDVGMKYIYDRCPAVSAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|158320568|ref|YP_001513075.1| peptidase M16 domain-containing protein [Alkaliphilus oremlandii
           OhILAs]
 gi|158140767|gb|ABW19079.1| peptidase M16 domain protein [Alkaliphilus oremlandii OhILAs]
          Length = 412

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 127/406 (31%), Positives = 226/406 (55%), Gaps = 4/406 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G+ V+TE +P + S  + V I AG++NE    +G++HF+EHMLFKGT KR+A
Sbjct: 2   YKRYTLENGLRVVTEHIPYVKSISIGVWIEAGAQNESSLNNGISHFIEHMLFKGTEKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E I+ +GG +NA+TS E T Y+  VL  H  LAL+++ DM+ +S F+P++IE+ER+
Sbjct: 62  KDIAEVIDSIGGQMNAFTSKECTCYYTKVLDSHYNLALDVLADMVFHSKFDPTEIEKERS 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED   D +    S+ ++K+  +G PILG  ET+++ T E I+ ++   Y +
Sbjct: 122 VILEEINMYEDSPEDLVHDIASQTLFKNDPLGMPILGTKETLNNITREMILDYIKEYYVS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           +   +   G  +    + +++  F +     ++K+  KPA +      + +D+ + H+ +
Sbjct: 182 NNAVLSIAGNFNETTLLEEIQRQFGIWTPNNQLKKVKKPADFNFENIYKNKDIEQTHICM 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            F G    + + Y   +L +ILG  MSSRLFQ +RE+RGL YSI ++   + + G L I 
Sbjct: 242 AFKGFELDNENTYPLLVLNNILGGSMSSRLFQSIREERGLAYSIYSYPSVYKNGGNLVIY 301

Query: 301 SATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +      +  +   + E + + +  +I   E++K   ++    I   E +  R   I K 
Sbjct: 302 AGANPNQVEEIIRIVREEINEIVTNSISDEELNKSKEQLKGNYILGLESTSGRMTSIGKS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPP 404
            +    I   ++I+D I ++   DI  + +K+F+ +  ++  +G  
Sbjct: 362 ELLLNRIYSPKEILDKIESVKSADIERIIQKVFNFAEMSITAVGKN 407



 Score = 39.1 bits (89), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/99 (17%), Positives = 37/99 (37%), Gaps = 2/99 (2%)

Query: 322 LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSIL--CSEKIIDTISAI 379
                +  EI+KE + I  ++   ++       +I+ Q +F    L        +T++ I
Sbjct: 107 FHSKFDPTEIEKERSVILEEINMYEDSPEDLVHDIASQTLFKNDPLGMPILGTKETLNNI 166

Query: 380 TCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           T E I+   K+ + S   +  +    +      E+    
Sbjct: 167 TREMILDYIKEYYVSNNAVLSIAGNFNETTLLEEIQRQF 205


>gi|220929128|ref|YP_002506037.1| peptidase M16 domain protein [Clostridium cellulolyticum H10]
 gi|219999456|gb|ACL76057.1| peptidase M16 domain protein [Clostridium cellulolyticum H10]
          Length = 411

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 132/410 (32%), Positives = 216/410 (52%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +  + S+G+ ++ E +P + S  V + +  GSRNE  E +G++HF+EHMLFKGT KR+A
Sbjct: 2   FKKVQLSNGLRLVYEKIPYVRSVSVGLWVGTGSRNETSENNGISHFIEHMLFKGTAKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E I+ +GG INA+T  E T Y+   L  H+ +A++++ DM  NSSF   DI  E+ 
Sbjct: 62  KDIAECIDSIGGQINAFTGKECTCYYTKTLDTHLDIAMDVLSDMFFNSSFASDDISVEKR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEIGM ED   + +   FSEMVW    +G PILG  + I+ F  + I+ ++   YT 
Sbjct: 122 VVVEEIGMYEDTPEELVHDIFSEMVWDGNPLGYPILGTEKCINKFDKDMILKYMEEFYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHMML 240
               +   G  D    +  V +YF      +    +  PA Y   + ++++D  + H+ +
Sbjct: 182 YNTVISVAGNFDEGKLIELVNNYFQNWKSKETYNNNFSPAQYKVNKIVREKDTEQVHLCM 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G  + S   Y    L +ILG GMSSRLFQ +REKRGL YSI ++   +  +G+  + 
Sbjct: 242 GFEGIGHGSDKLYSLLSLNNILGGGMSSRLFQNIREKRGLVYSIYSYPSTYQGSGLFVVY 301

Query: 301 SATAKENIMALTSSIVEVVQ-SLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +    E    +       ++  + E I + E+ K   ++    I   E +  R   I K 
Sbjct: 302 AGMNPEYFQTVIDLTKAELETIIKEGITKDELAKTKEQLKGNYILGLESTSSRMNSIGKS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHV 408
            +  G I   E+I+  I  +  + I  + K++F+    +++ +G   + +
Sbjct: 362 ELLTGKIKTPEEILQKIDRVDMDSIDEMIKRVFNFEKMSISAVGNIKNKL 411


>gi|319405300|emb|CBI78914.1| processing protease protein [Bartonella sp. AR 15-3]
          Length = 427

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 169/421 (40%), Positives = 264/421 (62%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  MP I+S  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHKMPQIESVALGIWVKVGSRNETFIQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK+ +PLA++I+ D+++ S F+  +++RE
Sbjct: 61  TAFKIATDIEDVGGEINATTSIETTAYFARVLKKDIPLAIDILADIMTCSKFDEDELDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++DQ +GR ILG  +T+ SFT   + +F+++ Y
Sbjct: 121 KQVIFQEIGATCDAPDDIVFDHFTETAFRDQSLGRSILGTQKTVQSFTSADLRNFMNQQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  G+++HE  + QVES             +  A Y+GG++ + R+L +  ++
Sbjct: 181 SADRMIVVAAGSIEHESFLRQVESCLGTFRPHSTAPLVNLANYIGGDFREYRNLMDTQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y + DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHAHDFYTAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +  A+  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVILDELYKISKNIHTNELQRAQAQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   ++ + +  IT E +  +AK +F +S+PTLA +GP +  +    +L+  L
Sbjct: 361 MLLYGRPIPISEMTECLELITLEQLTDLAKHLFINSSPTLAAVGP-IGPLMNFDDLVSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|195108833|ref|XP_001998997.1| GI23318 [Drosophila mojavensis]
 gi|193915591|gb|EDW14458.1| GI23318 [Drosophila mojavensis]
          Length = 470

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 98/429 (22%), Positives = 199/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++++  +G+ V +E     +A V + I AGSR+E  + +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTRLDNGLRVASEDSGASTATVGLWIDAGSRSENDKNNGVAHFLEHMAFKGTAKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    S+I RER+V+
Sbjct: 102 LELEVENMGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGESEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  V            + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAGAGGVKHDELVKLAGQNLGSLESSVLPAEITPCRFTGSEVRVRDDSLPLAHVAIAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A++ +++  V  K I+   P ++ +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVSVQNVRDVGMKYIYDRCPAVSAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|95113671|ref|NP_082707.1| mitochondrial-processing peptidase subunit beta precursor [Mus
           musculus]
 gi|14548119|sp|Q9CXT8|MPPB_MOUSE RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP; AltName: Full=P-52; Flags:
           Precursor
 gi|12851603|dbj|BAB29105.1| unnamed protein product [Mus musculus]
 gi|148671248|gb|EDL03195.1| mCG6419, isoform CRA_b [Mus musculus]
 gi|148671252|gb|EDL03199.1| mCG6419, isoform CRA_f [Mus musculus]
          Length = 489

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 94/431 (21%), Positives = 191/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  QVTCLENGLRVASENSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A      +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSRDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   +   + +F          I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVCHNELLELAKFHFGDSLCSHKGAIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +     +  +  +   +    + L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEQATVADMLHVVQNEWKRLCTDVTESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E +  V  K      P +A LGP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVDAETVRRVCTKYIHDKSPAIAALGP-IERLPDF 477

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 478 NQICSNMRWIR 488


>gi|90420102|ref|ZP_01228010.1| processing protease, M16 family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335436|gb|EAS49186.1| processing protease, M16 family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 438

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 186/429 (43%), Positives = 284/429 (66%), Gaps = 7/429 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K S+G+T+ TE MP ++SA + + ++AG+R+E  +EHG+AH LEHM FKGT++R
Sbjct: 1   MSVEVTKLSNGLTIATETMPHLESACLGIWVKAGARDEAPQEHGIAHLLEHMAFKGTSRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I EEIE VGG++NA TS+E TSY+A VLK  VPLAL+I+ D+L +S F+  ++ERE
Sbjct: 61  SARQIAEEIEDVGGEMNAATSVETTSYYARVLKNDVPLALDILTDILIDSRFDEQELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+L+EIG +ED   D +   F E  +  QIIGRPILG  ET+ SF+P+ +  +++R+Y
Sbjct: 121 QQVILQEIGAAEDTPDDIVFDHFQEAAFHKQIIGRPILGTRETVKSFSPDDLRGYLARHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI----KESMKPAVYVGGEYIQKRDLAE 235
           + D+M V   GAV H   V Q+E+ F   +            + A Y GGE+ Q+RDL +
Sbjct: 181 SPDKMIVSAAGAVSHRAIVDQIEAAFGGTASVSPLPLESSPRQAASYTGGEFRQERDLMD 240

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
             M+LGF G AY +RDFY + +L+ ILG GMSSRLFQE+RE+RGLCY+I A H +FSD+G
Sbjct: 241 AQMVLGFEGRAYYARDFYASQVLSLILGGGMSSRLFQEIRERRGLCYAIYAFHWSFSDSG 300

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           +  I +AT +E +  L   I + +      I + E+++  A++ A L+ SQE    RA +
Sbjct: 301 IFGIHAATGEEELAELAPVIADELTRAAAGISEPEVNRARAQMRASLLMSQESPAARAAQ 360

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSEL 414
           I++Q++F G+ + +E++I  + AIT   +  +A++ F  T PTLA +GP +  +P+   L
Sbjct: 361 IARQMLFNGATITNEELIARLEAITAPRLADLAERTFVGTVPTLAAIGP-VSRLPSRDVL 419

Query: 415 IHALEGFRS 423
              L G  S
Sbjct: 420 AERLAGASS 428


>gi|74151629|dbj|BAE41163.1| unnamed protein product [Mus musculus]
          Length = 480

 Score =  210 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 94/431 (21%), Positives = 191/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 50  QVTCLENGLRVASENSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 109

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A      +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 110 LELEIENMGAHLNAYTSREQTVYYAKAFSRDLPRAVEILADIIQNSTLGEAEIERERGVI 169

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 170 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 229

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   +   + +F          I              ++   +   H+ +
Sbjct: 230 IVLAAAGGVCHNELLELAKFHFGDSLCSHKGAIPALPPCKFTGSEIRVRDDKMPLAHLAI 289

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 290 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 349

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +     +  +  +   +    + L  ++ + E+ +    +   ++   + S   
Sbjct: 350 DTGLWGLYMVCEQATVADMLHVVQNEWKRLCTDVTESEVARAKNLLKTNMLLQLDGSTPI 409

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E +  V  K      P +A LGP ++ +P  
Sbjct: 410 CEDIGRQMLCYNRRIPIPELEARIDAVDAETVRRVCTKYIHDKSPAIAALGP-IERLPDF 468

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 469 NQICSNMRWIR 479


>gi|163867887|ref|YP_001609091.1| processing protease protein [Bartonella tribocorum CIP 105476]
 gi|161017538|emb|CAK01096.1| processing protease protein [Bartonella tribocorum CIP 105476]
          Length = 424

 Score =  210 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 175/421 (41%), Positives = 260/421 (61%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ + + S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MDVDVCRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK  +PLA++I+ D+L +S F+  ++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKSDIPLAIDILADILMHSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++ Q +GR ILG  +TI SFT   +  F+++ Y
Sbjct: 121 KQVIFQEIGAAHDTPDDIVFDHFTETAFRHQSLGRSILGTAKTIRSFTSADLHDFINKQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VE+                A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVKHESFLKEVENRLGTFRSYSTASPTNLANYVGGDFREYRDLMDTQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY +RDFY T IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRAYHARDFYATQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +    +NI+  E+ +   +  A LI SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKELLPVILDELSKTSKNIQANELQRAQTQYRANLIMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   + I+ ++ IT + +  +A ++F SSTPTL  +GP +  +    +L   L
Sbjct: 361 ILLYGRPIPMSETIERLNLITPKRLTDLAHRLFTSSTPTLTAVGP-VGPLMNFDDLTSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|329936627|ref|ZP_08286334.1| protease [Streptomyces griseoaurantiacus M045]
 gi|329303857|gb|EGG47740.1| protease [Streptomyces griseoaurantiacus M045]
          Length = 459

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 125/416 (30%), Positives = 219/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTARRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I++VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISAAIDEVGGEMNAFTAKEYTCYYARVLDSDLPLAIDVVCDMLTGSLIREEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNALGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V C G VDH   V QV + F      +   ++      G   ++         R 
Sbjct: 214 PTHLVVACAGNVDHAKVVRQVRAAFERADAFRRPAALPVEPRSGRRALRAAGRVEVLGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   E+ +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDHVAEHGLSDEEVGRAIGQLRGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+ +T +D+  VA++I    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGDQMSVDDMLARITEVTPDDVRAVAREILGRRPSLSVIGPLKDK 449



 Score = 38.4 bits (87), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 38/94 (40%), Gaps = 2/94 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++    MF  +         +DT++A+T + I 
Sbjct: 146 EEDVDVERGAILEEIAMTEDDPGDCVHDLFAHTMFGDNALGRPVLGTVDTVNALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
              KK +  T  +      +DH     ++  A E
Sbjct: 206 RFYKKHYDPTHLVVACAGNVDHAKVVRQVRAAFE 239


>gi|23012724|ref|ZP_00052739.1| COG0612: Predicted Zn-dependent peptidases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 431

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 144/418 (34%), Positives = 243/418 (58%), Gaps = 3/418 (0%)

Query: 5   ISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++  +G+TV TE +P   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+A++
Sbjct: 16  VTRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTASRSARQ 75

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+ V+
Sbjct: 76  IAEDIENVGGEINAATSTECTSYTARVLGEDTGVALDVLGDILTRSVFDDGELAREKGVI 135

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E    ED   D +   F E  + DQ IGRPILG+PETI+ F    I ++++R Y  +R
Sbjct: 136 LQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETITRFDRAAIEAYIAREYVPER 195

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAV+H   V   + +F   + A+  + +    Y GGE    + L + +++LG  
Sbjct: 196 MVLAAAGAVEHAEIVEAAQRHFGGLTAAEAPQ-VVAGRYGGGERRMAKKLEQANLVLGLP 254

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +++  D+Y  ++ +  LG G++SRL+ EVRE RGL Y I A H  FSD G+  I + T
Sbjct: 255 GLSFRDDDYYALHLFSQALGGGLTSRLWHEVRETRGLAYDIQAFHWPFSDCGLFGIGAGT 314

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
           +  ++  L    +   ++  E ++  E+ +  A++   L+ + E    R    ++Q++  
Sbjct: 315 SGADLPELVDVTIATTRAAAEQLDAAELARAKAQLKVSLLSALETPGGRIERNARQLLAW 374

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
           G ++  +++I  + A+  E +    + +    PTLA +GP +  +P  + +  AL+  
Sbjct: 375 GRVIPPQELIAKVDAVEVEHVREAGRTLLQGAPTLAAIGP-VKGLPPLARIAGALQDA 431


>gi|222825031|dbj|BAH22189.1| peptidase, M16 family [Wolbachia endosymbiont of Cadra cautella]
          Length = 424

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 138/424 (32%), Positives = 248/424 (58%), Gaps = 7/424 (1%)

Query: 1   MNL-RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ +++K  +G+ +ITE    +DS  + + +  GSR E   ++G++HFLEHM FKGT  
Sbjct: 1   MNIPQVTKLDNGLRIITERVHEVDSVALNIRVGVGSRAESASQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E TSY+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGAFNACTGRESTSYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIIFDKYFEAAYKDQPFGRSILGTQDTVKSFTRANLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + +     G V+HE  V  ++ + +     ++K+S + A Y GGEY++ R L + H+
Sbjct: 181 YFGENIIFAVAGNVEHEEVVQLIKDFLSKIHSKELKKS-ENASYTGGEYLEHRKLDQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L +ILG GMSSRLFQEVREK+GL YSI + + +++D G+L 
Sbjct: 240 LIGLPSVSRDDNRYHTFKVLDAILGSGMSSRLFQEVREKQGLAYSIYSFNSSYADTGMLS 299

Query: 299 IASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  +I   ++    +++++ E+++   ++ ++++ S+E    RA  + 
Sbjct: 300 IFAGTDSSNLDKLLKAITTELKKLSTDDLKEEEVNRVKERVKSQILMSRESVSSRAETLG 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILGPPMDHVPTTSELI 415
                    +   ++I+ ISA+T  DI   A+++ S     TLA +G  ++ +P+  +++
Sbjct: 360 HYYGNYNKYISKNELIEKISAVTIYDIKKAAEELLSQHERITLAAIG-EINSLPSYDKVV 418

Query: 416 HALE 419
             L 
Sbjct: 419 SMLS 422


>gi|56419806|ref|YP_147124.1| processing protease [Geobacillus kaustophilus HTA426]
 gi|56379648|dbj|BAD75556.1| processing protease [Geobacillus kaustophilus HTA426]
          Length = 426

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 141/404 (34%), Positives = 229/404 (56%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGTT RTA
Sbjct: 15  INKYTCKNGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQTNGISHFLEHMFFKGTTTRTA 74

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERN
Sbjct: 75  RDIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERN 134

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +     +  +    +G PILG  ET+ +FT + +  +++  YT 
Sbjct: 135 VVLEEIKMYEDTPDDIVHDLLGKACYAGHPLGYPILGTEETLRTFTGDTLRQYMADYYTP 194

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD E  + +VE YF   +      S     +V  +  +K+D  + H+ +G
Sbjct: 195 DRVVISVAGNVD-ERFIDEVERYFGSFAAESKPPSSGTPAFVPQKIARKKDTEQAHVCIG 253

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I +
Sbjct: 254 FNGLPIGHPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYA 313

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  +I   ++ L  + + ++E+     ++   L+   E +  R     K  
Sbjct: 314 GTGSSQLDVLFETIQHTIRQLKEDGVTEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNE 373

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
           +  G     ++II+ I ++T E +  +A+ +F+    LA++ P 
Sbjct: 374 LLLGRHRSLDEIIEEIESVTVEKVNELARTVFTDDYALALISPD 417


>gi|322382338|ref|ZP_08056245.1| specific processing protease-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153691|gb|EFX46066.1| specific processing protease-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 416

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 120/405 (29%), Positives = 226/405 (55%), Gaps = 3/405 (0%)

Query: 6   SKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
            +  +G+ V+ E +P   S    + ++ GSRNE  + +G++HF+EHMLFKGT + +AKEI
Sbjct: 4   YQLKNGLRVVIEKIPTCRSVAFGIWVKTGSRNESAQNNGISHFIEHMLFKGTVRHSAKEI 63

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            E  + +GG++NA+TS E+T Y+A VL EH+P+A++++ DM  NS F+  ++E+E+NV+ 
Sbjct: 64  AEIFDGIGGNVNAFTSKEYTCYYAKVLDEHLPIAVDVLSDMFFNSVFDKQELEKEKNVIF 123

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           EEI M ED   D +    +   + +  +GR ILG  ET+S+  P+ + +++ + Y  +  
Sbjct: 124 EEISMYEDTPDDLVHDLVARASYGEHSLGRTILGTEETLSAMNPDDLRAYMEQFYNIENT 183

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
            +   G +D +  +  +E +F   + +    S     +VG    +++   + H+ +   G
Sbjct: 184 VISIAGNID-DKVIQLIEKHFGEFTNSGSPTSYTTPEFVGDLIFEEKKAEQNHICMSLPG 242

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
            A +  + Y   +L + LG GMSSRLFQE+REKRGL YS+ ++H +  D G+  I + TA
Sbjct: 243 MALEEDNLYPMVLLNNALGGGMSSRLFQEIREKRGLAYSVYSYHSSHMDTGLFTIYTGTA 302

Query: 305 KENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            +    +    +++++++    +   E+ K   ++   LI S E +  R   + K  +  
Sbjct: 303 PKQTEEVLKVTMDILENVKEHGLTDLELKKGKEQLKGSLILSLESTNSRMNRLGKNELIF 362

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHV 408
           G     +++I+ I ++  + I  +  ++F+    L+++G   + +
Sbjct: 363 GKHYSLDEMIERIESVNIDHIRSLVGRLFARPFALSMVGSSNEAL 407


>gi|42520580|ref|NP_966495.1| M16 family peptidase putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410319|gb|AAS14429.1| peptidase, M16 family, putative [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 423

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 136/425 (32%), Positives = 246/425 (57%), Gaps = 7/425 (1%)

Query: 1   MNL-RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ R++K  +G+ +ITE    IDS  + + +  GSR E  +++G++HFLEHM FKGT  
Sbjct: 1   MNIPRVTKLDNGLRIITEQVRDIDSVALSIRVGVGSRAESAKQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E T+Y+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGVFNASTGRESTTYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG   T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIIFDKYFEAAYKDQPFGRSILGTQNTVKSFTRGDLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + M     G V+HE  V+  + + +     K+K+S   +   GGEY++ R L + H+
Sbjct: 181 YFGENMLFAVAGNVEHEEVVALTKDFLSKIHSKKLKKSQNASC-TGGEYLEHRKLDQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + ++++ G+  
Sbjct: 240 LIGLPSVSRHDDKYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTNTGMFS 299

Query: 299 IASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  SI   ++    +++++ E+++   ++ ++++ S+E    RA  + 
Sbjct: 300 IFAGTDSSNLDKLLKSITTELKKLSTDDLKEEEVNRVKERVKSQILMSRESVSSRAETLG 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILGPPMDHVPTTSELI 415
                    +   ++I+ ISA+T  ++   A+++ S     TLA +G  ++ +P+  +++
Sbjct: 360 HYYGNYNRYISKNELIEKISAVTTANVKKAAEELLSQHEKTTLAAIG-EIESLPSYDKVV 418

Query: 416 HALEG 420
             L+ 
Sbjct: 419 SMLKA 423


>gi|297530554|ref|YP_003671829.1| peptidase M16 domain protein [Geobacillus sp. C56-T3]
 gi|319766288|ref|YP_004131789.1| peptidase M16 domain protein [Geobacillus sp. Y412MC52]
 gi|297253806|gb|ADI27252.1| peptidase M16 domain protein [Geobacillus sp. C56-T3]
 gi|317111154|gb|ADU93646.1| peptidase M16 domain protein [Geobacillus sp. Y412MC52]
          Length = 415

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 141/404 (34%), Positives = 230/404 (56%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGTT RTA
Sbjct: 4   INKYTCKNGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQTNGISHFLEHMFFKGTTTRTA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERN
Sbjct: 64  RDIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERN 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +     +  +    +G PILG  ET+ +FT + +  +++  YT 
Sbjct: 124 VVLEEIKMYEDTPDDIVHDLLGKACYAGHPLGYPILGTEETLRTFTGDTLRQYMADYYTP 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD E  + +VE YF   +      S     +V  +  +K+D  + H+ +G
Sbjct: 184 DRVVISVAGNVD-ERFIDEVERYFGSFAAESKPPSSGTPAFVPQKIARKKDTEQAHVCIG 242

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I +
Sbjct: 243 FNGLPIGHPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYA 302

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  +I + ++ L  + + ++E+     ++   L+   E +  R     K  
Sbjct: 303 GTGSSQLDVLFETIQQTIRQLKEDGVTEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNE 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
           +  G     ++II+ I ++T E +  +A+ +F+    LA++ P 
Sbjct: 363 LLLGRHRSLDEIIEEIESVTVEKVNELARTVFTDDYALALISPD 406


>gi|261419472|ref|YP_003253154.1| peptidase M16 domain protein [Geobacillus sp. Y412MC61]
 gi|261375929|gb|ACX78672.1| peptidase M16 domain protein [Geobacillus sp. Y412MC61]
          Length = 413

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 141/404 (34%), Positives = 230/404 (56%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGTT RTA
Sbjct: 2   INKYTCKNGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQTNGISHFLEHMFFKGTTTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERN
Sbjct: 62  RDIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +     +  +    +G PILG  ET+ +FT + +  +++  YT 
Sbjct: 122 VVLEEIKMYEDTPDDIVHDLLGKACYAGHPLGYPILGTEETLRTFTGDTLRQYMADYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD E  + +VE YF   +      S     +V  +  +K+D  + H+ +G
Sbjct: 182 DRVVISVAGNVD-ERFIDEVERYFGSFAAESKPPSSGTPAFVPQKIARKKDTEQAHVCIG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I +
Sbjct: 241 FNGLPIGHPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYA 300

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  +I + ++ L  + + ++E+     ++   L+   E +  R     K  
Sbjct: 301 GTGSSQLDVLFETIQQTIRQLKEDGVTEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
           +  G     ++II+ I ++T E +  +A+ +F+    LA++ P 
Sbjct: 361 LLLGRHRSLDEIIEEIESVTVEKVNELARTVFTDDYALALISPD 404


>gi|190571000|ref|YP_001975358.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019520|ref|ZP_03335326.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357272|emb|CAQ54699.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994942|gb|EEB55584.1| peptidase, M16 family [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 424

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 140/424 (33%), Positives = 247/424 (58%), Gaps = 7/424 (1%)

Query: 1   MNL-RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           MN+ +++K  +G+ +ITE    +DS  + + +  GSR E   ++G++HFLEHM FKGT  
Sbjct: 1   MNIPQVTKLDNGLRIITERVHEVDSVALNIRVGVGSRAESASQNGISHFLEHMAFKGTKT 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           RTA EI +  + +GG  NA T  E TSY+A VLK+ +   ++I+ D+L NS+F   ++ER
Sbjct: 61  RTAFEIAKAFDDIGGAFNACTGRESTSYYAKVLKKDIKTGIDILIDILMNSTFPEDELER 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E+ VV++EI  + D   D +  ++ E  +KDQ  GR ILG  +T+ SFT   + ++++ +
Sbjct: 121 EKGVVIQEIFQTNDSPSDIIFDKYFEAAYKDQPFGRSILGTQDTVKSFTRANLDNYINEH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           Y  + +     G V+HE  V  ++ + +     ++K+S + A Y GGEY++ R L + H+
Sbjct: 181 YFGENIIFAVAGNVEHEEVVQLIKDFLSKIHSKELKKS-ENASYTGGEYLEHRKLDQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           ++G    +     ++   +L SILG GMSSRLFQEVREK+GL YSI + + +++D G+L 
Sbjct: 240 LIGLPSVSRDDNKYHTFKVLDSILGSGMSSRLFQEVREKQGLAYSIYSFNSSYADTGMLS 299

Query: 299 IASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T   N+  L  SI   ++    +++++ E+++   ++ ++++ S+E    RA  + 
Sbjct: 300 IFAGTDSSNLDKLLKSITTELKKLSTDDLKEEEVNRVKERVKSQILMSRESVSSRAETLG 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILGPPMDHVPTTSELI 415
                    +   ++I+ ISA+T  DI   A+++ S     TLA +G  +  +P+  +++
Sbjct: 360 HYYGNYNKYISKNELIEKISAVTIYDIKKAAEELLSQHERITLAAIG-EIKSLPSYDKVV 418

Query: 416 HALE 419
             L 
Sbjct: 419 SMLS 422


>gi|52080278|ref|YP_079069.1| peptidase [Bacillus licheniformis ATCC 14580]
 gi|52785655|ref|YP_091484.1| MlpA [Bacillus licheniformis ATCC 14580]
 gi|52003489|gb|AAU23431.1| peptidase [Bacillus licheniformis ATCC 14580]
 gi|52348157|gb|AAU40791.1| MlpA [Bacillus licheniformis ATCC 14580]
          Length = 409

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 130/409 (31%), Positives = 230/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT  RTA
Sbjct: 2   IKRYTCQNGVRIVFENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTKTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  +++GG +NA+TS E+T Y+A VL EH   ALE++ DM  +SSF+  ++++E+N
Sbjct: 62  RDIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHASYALEVLSDMFFHSSFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  +    +G PILG  ET++ F  + +  +++  YT 
Sbjct: 122 VVYEEIKMYEDTPDDIVHDLLSKASYGSHSLGYPILGTEETLAEFDGDSLRKYMNEYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G    E  + + E +F        +  M    +   +  +K++  + H+ LG
Sbjct: 182 DRVVISIAGN-VPETFIKEAEKHFGSYEAKGKRTGMTKPDFHHEKMTRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      + Y   +L +ILG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G++ I +
Sbjct: 241 FNGLEAGHPEIYDLIVLNNILGGSMSSRLFQDVREDKGLAYSVFSYHTSYEDSGMMTIYA 300

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L+ +I E +++L  + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGANQLQLLSETIHETLRALKSDGITPKELENSKEQMKGSLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +  G     ++II+ ++A++ E +  +A +IF+   + A++ P  + +P
Sbjct: 361 LLLGKHRTLDEIIEKLNAVSLERVNNLANRIFTDDYSSALISPSGE-LP 408


>gi|196247585|ref|ZP_03146287.1| peptidase M16 domain protein [Geobacillus sp. G11MC16]
 gi|196212369|gb|EDY07126.1| peptidase M16 domain protein [Geobacillus sp. G11MC16]
          Length = 413

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 145/410 (35%), Positives = 232/410 (56%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ ++ E +P + S  + V I  GSRNE ++ +G++HFLEHM FKGTT RTA
Sbjct: 2   INKYTCKNGVRIVLEQIPTVRSVAIGVWIGTGSRNETEQNNGISHFLEHMFFKGTTTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERN
Sbjct: 62  RDIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +     +  + +  +G PILG  ET+ +FT + +  +++  YT 
Sbjct: 122 VVLEEIKMYEDTPDDIVHDLLGKACYANHPLGYPILGTEETLRTFTGDTLRQYMADYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ V   G VD E  + ++E YF   + A    S     +V  +  +K+D  + H+ +G
Sbjct: 182 DRVVVSVAGNVD-ERFIGEIERYFGSFTAANKPASPGKPSFVPQKLARKKDTEQAHVCIG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I +
Sbjct: 241 FNGLPIGHPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYA 300

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  +I   +  L  + I ++E+     ++   L+   E +  R     K  
Sbjct: 301 GTGSGQLDILFETIQRTLCHLKEDGITEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +  G     ++II+ I ++T E +  +A+ +F+    LA++ P    +P 
Sbjct: 361 LLLGRHRSLDEIIEEIESVTVEKVNELARTVFAEDYALALISPD-GVLPQ 409


>gi|138894791|ref|YP_001125244.1| processing peptidase-like protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|134266304|gb|ABO66499.1| processing peptidase-like protein [Geobacillus thermodenitrificans
           NG80-2]
          Length = 415

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 145/410 (35%), Positives = 232/410 (56%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ ++ E +P + S  + V I  GSRNE ++ +G++HFLEHM FKGTT RTA
Sbjct: 4   INKYTCKNGVRIVLEQIPTVRSVAIGVWIGTGSRNETEQNNGISHFLEHMFFKGTTTRTA 63

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  + +GG +NA+TS E+T Y+A VL EH PLALE++ DM  +S+F   ++++ERN
Sbjct: 64  RDIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHAPLALEMLADMFFHSTFVEDELQKERN 123

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +     +  + +  +G PILG  ET+ +FT + +  +++  YT 
Sbjct: 124 VVLEEIKMYEDTPDDIVHDLLGKACYANHPLGYPILGTEETLRTFTGDTLRQYMADYYTP 183

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ V   G VD E  + ++E YF   + A    S     +V  +  +K+D  + H+ +G
Sbjct: 184 DRVVVSVAGNVD-ERFIGEIERYFGSFTAANKPASPGKPSFVPQKLARKKDTEQAHVCIG 242

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I +
Sbjct: 243 FNGLPIGHPDAYPLLILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSAYQDSGLLAIYA 302

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  +I   +  L  + I ++E+     ++   L+   E +  R     K  
Sbjct: 303 GTGSGQLDILFETIQRTLCHLKEDGITEKELHNSKEQMKGSLMLGLESTNSRMSRNGKNE 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +  G     ++II+ I ++T E +  +A+ +F+    LA++ P    +P 
Sbjct: 363 LLLGRHRSLDEIIEEIESVTVEKVNELARTVFAEDYALALISPD-GVLPQ 411


>gi|240850094|ref|YP_002971487.1| processing protease [Bartonella grahamii as4aup]
 gi|240267217|gb|ACS50805.1| processing protease [Bartonella grahamii as4aup]
          Length = 424

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 174/421 (41%), Positives = 259/421 (61%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ I + S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MDVDICRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETSTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E T+Y A VLK  +PLA++I+ D+L +S F+ +++ERE
Sbjct: 61  TAFQIATDIEDVGGEINATTSIETTAYFARVLKSDIPLAIDILADILMHSKFDDNELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG + D   D +   F+E  ++ Q +GR ILG  +TI SFT   +  F+++ Y
Sbjct: 121 KQVIFQEIGAAHDTPDDIVFDHFTETAFRHQSLGRSILGTAKTIQSFTSTDLHDFINKQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VES                A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVKHESFLREVESRLGTFRSHSTAPLTNLANYVGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G AY +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRAYHARDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDTGLFGV 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +   +  A L  SQE    +A  I++Q
Sbjct: 301 HAATGQEGLKELIPVILDELSKVSKNIHANELQRAQTQYRANLTMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   + I+ ++ IT + +  +A ++F +STPTL  +GP +  +    +L   L
Sbjct: 361 ILLYGRPIPISETIERLNLITPKRLTDLAHRLFTNSTPTLTAVGP-VGPLINFDDLTSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|148252423|ref|YP_001237008.1| putative zinc protease [Bradyrhizobium sp. BTAi1]
 gi|146404596|gb|ABQ33102.1| putative zinc protease [Bradyrhizobium sp. BTAi1]
          Length = 429

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 150/424 (35%), Positives = 246/424 (58%), Gaps = 3/424 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++K  +G+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MGVEVTKLPTGLTVVTDTMPHLETAALGVWAGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EIVE IE VGGD+NA TS E T+Y+A VLK  VPLAL+++ D+L+N SF P ++ERE
Sbjct: 61  SAREIVEAIEAVGGDLNAGTSTETTAYYARVLKADVPLALDVLSDILANPSFVPEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG ++D   D +    +E+ + DQ +GR +LG  +T+  F  +K+  +++ +Y
Sbjct: 121 KNVIVQEIGAAQDTPDDVVFEHLNELCFPDQPMGRSLLGTAKTLQGFDRDKLHGYLATHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V  V   F   + A   + +  A   GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAVDHQQVVEDVTRRFASFNGAPAPKPLPAAFGKGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVRE RGLCYS+   H  +SD G   +
Sbjct: 241 LALEGVPQADPSLFSLQVFTNILGGGMSSRLFQEVRENRGLCYSVYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   +V+++ + +E + + E+ +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPADAPEMMEVVVDIIGNAVETLSEAEVARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHAL 418
           ++  G     ++++D I A++ E     A+ + + S P +  LG     + T      AL
Sbjct: 361 ILAYGRPQTLQEMVDKIEAVSVESTRDAARALLARSKPAVVALG-SGRGLDTAVTFAEAL 419

Query: 419 EGFR 422
            G +
Sbjct: 420 TGSK 423


>gi|242006974|ref|XP_002424317.1| ubiquinol-cytochrome C reductase, core protein 1 [Pediculus humanus
           corporis]
 gi|212507717|gb|EEB11579.1| ubiquinol-cytochrome C reductase, core protein 1 [Pediculus humanus
           corporis]
          Length = 478

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 108/430 (25%), Positives = 197/430 (45%), Gaps = 13/430 (3%)

Query: 5   ISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           ++   +G+ + +E     +A V + I AGSR E +E +G+AHFLEHM FKGT KR+  ++
Sbjct: 49  VTTLENGLRIASEDTGSPTATVGLWIDAGSRYENEENNGVAHFLEHMAFKGTEKRSQTDL 108

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
             EIE +G  +NAYTS E T ++A  LK+ V  ALEI+ D++ NS    ++IERER V+L
Sbjct: 109 ELEIENLGAHLNAYTSREQTVFYAKCLKQDVSKALEILSDIIQNSKLGEAEIERERAVIL 168

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
            E+   E +  + +      + ++   +GR ILG  E I + +   +  +++  Y   R+
Sbjct: 169 REMQEVETNLQEVVFDYLHSVAYQGTSLGRTILGPTENIKTISRADLKEYINNTYKPPRI 228

Query: 185 YVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            +   G V H+  V+   S FN    C   +I  +           ++   +   H+ + 
Sbjct: 229 VLAGAGGVVHDELVNLACSLFNKLDVCYTGEIPCNTPCRFTGSEVRVRDDTMPLAHIAIA 288

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSD 293
             GC +   D     I  ++LG    S+        +         L +S  + +  + D
Sbjct: 289 VEGCGWCDSDNISLMIANTLLGAWDRSQGGGTNNASKLAQVVAEGNLAHSFQSFNTCYKD 348

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
            G+  I   T       +  S+++  + L  +I   E+++    +   ++   + +    
Sbjct: 349 TGLWGIYFVTEPSKTDDMLCSVLDEWKRLCTSITGPEVERAKNLLKTNMLLQLDGTTPVC 408

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTS 412
            +I +Q++  G  +   ++   IS IT E +     K      P +A +GP ++ +P  +
Sbjct: 409 EDIGRQMLCYGRRIPLNELEARISMITAEQVRNTMLKYIYDRCPAVAAIGP-IETLPDYN 467

Query: 413 ELIHALEGFR 422
                +  FR
Sbjct: 468 ITRGKMYWFR 477


>gi|195037611|ref|XP_001990254.1| GH18338 [Drosophila grimshawi]
 gi|193894450|gb|EDV93316.1| GH18338 [Drosophila grimshawi]
          Length = 470

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 198/429 (46%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++++  +G+ V +E     +A V + I AGSR+E    +G+AHFLEHM FKGT KR+  +
Sbjct: 42  QVTQLDNGLRVASEDSGASTATVGLWIDAGSRSENDRNNGVAHFLEHMAFKGTDKRSQTD 101

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    S+I RER+V+
Sbjct: 102 LELEVENMGAHLNAYTSREQTVFYAKCLSKDVPKAVEILADIIQNSKLGESEIARERSVI 161

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     +  ++  +Y A R
Sbjct: 162 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIQSIGKSDLTDYIQTHYKASR 221

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H   V   E        + +   + P  + G E   + D L   H+ +  
Sbjct: 222 IVLAGAGGVKHNELVKLAEQSLGRLEASLLPAEVTPCRFTGSEVRVRDDSLPLAHVAIAV 281

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +  +D     +  +++G    S+                  LC+S  + +  + D 
Sbjct: 282 EGCGWTDQDNIPLMVANTLVGAWDRSQGGGANNASNLARASAEDNLCHSFQSFNTCYKDT 341

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  I           +  ++      L   + + E+++    +   ++   + +     
Sbjct: 342 GLWGIYFVCDPLQCEDMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPICE 401

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I A++ +++  V  K I+   P ++ +GP ++++P  + 
Sbjct: 402 DIGRQILCYNRRIPLHELEQRIDAVSVQNVRDVGMKYIYDRCPAVSAVGP-VENLPDYNR 460

Query: 414 LIHALEGFR 422
           +  ++   R
Sbjct: 461 IRSSMYWLR 469


>gi|77736173|ref|NP_001029785.1| mitochondrial-processing peptidase subunit beta precursor [Bos
           taurus]
 gi|85701142|sp|Q3SZ71|MPPB_BOVIN RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP; Flags: Precursor
 gi|74268147|gb|AAI03086.1| Peptidase (mitochondrial processing) beta [Bos taurus]
          Length = 490

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 95/429 (22%), Positives = 193/429 (44%), Gaps = 13/429 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 60  RVTCLENGLRVASEDSGLATCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 119

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 120 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 179

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 180 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 239

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 240 IVLAAAGGVSHDELLELAKFHFGESLSTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAV 299

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 300 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 359

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 360 DTGLWGIYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 419

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K     +P +A +GP ++ +P  
Sbjct: 420 CEDIGRQMLCYNRRIPIPELEARIDAVNAEIIREVCTKYIYDKSPAVAAVGP-IEQLPDF 478

Query: 412 SELIHALEG 420
           +++   +  
Sbjct: 479 NQICSNMRW 487


>gi|194666119|ref|XP_001789518.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Bos taurus]
 gi|296488545|gb|DAA30658.1| mitochondrial-processing peptidase subunit beta precursor [Bos
           taurus]
          Length = 490

 Score =  209 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 95/429 (22%), Positives = 193/429 (44%), Gaps = 13/429 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 60  RVTCLENGLRVASEDSGLATCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 119

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 120 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 179

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 180 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 239

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 240 IVLAAAGGVSHDELLDLAKFHFGESLSTHKGEIPALPLCKFTGSEIRVRDDKMPLAHLAV 299

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 300 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 359

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 360 DTGLWGIYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 419

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K     +P +A +GP ++ +P  
Sbjct: 420 CEDIGRQMLCYNRRIPIPELEARIDAVNAEVIREVCTKYIYDKSPAVAAVGP-IEQLPDF 478

Query: 412 SELIHALEG 420
           +++   +  
Sbjct: 479 NQICSNMRW 487


>gi|78043889|ref|YP_359993.1| M16 family peptidase [Carboxydothermus hydrogenoformans Z-2901]
 gi|77996004|gb|ABB14903.1| peptidase, M16 family [Carboxydothermus hydrogenoformans Z-2901]
          Length = 409

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 139/404 (34%), Positives = 235/404 (58%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + ++   + ITV+ E +P I SA + +  + GSR+ER++E G++HF+EHM+FKGT  RTA
Sbjct: 2   IHVTTLPNKITVLVEEIPYIRSAAIGLWFKVGSRHERRDESGISHFIEHMMFKGTVNRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI E +++VGG +NA+T+ E+T Y+A VL EH  LALEI+ DM+ NS F   DIE+E+N
Sbjct: 62  KEIAESLDQVGGQLNAFTTKEYTCYYARVLDEHTLLALEILHDMVFNSKFAEEDIEKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEI M ED   + +    +E++W +  +GRPILG+ + I S T EK++++  R YT 
Sbjct: 122 VVIEEIRMYEDAPDELIHDLLTEVMWNNHPLGRPILGEIQDIESLTREKVVNYYKRYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G V+++  + ++   F      +  + +    +    + +++D  + H+ LG
Sbjct: 182 DNLIIAVAGRVNYQQLLDKIMELFGSIQGEQKGDKITIPEFNLHSFSRRKDSEQVHLCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G A      Y  NIL++ILG G+SSRLFQE+RE+ GL YS+ ++   + D G+  I +
Sbjct: 242 TKGYAINDDRIYGLNILSTILGGGISSRLFQELRERHGLVYSVYSYTTAYQDAGLFGIYA 301

Query: 302 ATAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
                 +      I + ++ L        E+++   +I   L+ S E    R   ++K  
Sbjct: 302 GLGPNKVNEALELIQKQLKELKTGDISAEEVERARQQIKGNLLLSLESVTTRMSRLAKSF 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
           ++ G I+  E+I++ +  ++ EDI  +A++I   +  T   +GP
Sbjct: 362 LYHGKIISPEEIVEKVFNVSLEDIKAMAEEISDLNNFTKVSIGP 405


>gi|84501696|ref|ZP_00999868.1| peptidase, M16 family protein [Oceanicola batsensis HTCC2597]
 gi|84390317|gb|EAQ02876.1| peptidase, M16 family protein [Oceanicola batsensis HTCC2597]
          Length = 420

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 145/415 (34%), Positives = 228/415 (54%), Gaps = 2/415 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   +    +G  ++TE MP   SA + + + AG R+ER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTPELHTLPNGFRIVTERMPGLKSASIGIWVAAGGRDERPEQNGLAHFLEHMAFKGTATR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +  +I E IE VGG +NAYTS E T+Y+A VL   VPLALE++ D+L NS+ +  +IE E
Sbjct: 61  SPVQIAEAIEDVGGYMNAYTSREVTAYYARVLGADVPLALEVLADILRNSTLDEDEIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L EIG + D   D +     E  + +Q +GR ILG  E I +F  + +  FV  NY
Sbjct: 121 RGVILSEIGQALDTPDDIIFDWLQEKAYPEQPLGRTILGPEERIRAFQRDDLARFVRENY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              +M +   G VDH   V+  E  F   +      +   A +VGGE    + L + H+ 
Sbjct: 181 GPGQMILSAAGDVDHAAVVAAAERLFGDMTPVDQTLA-NGATFVGGESRVVKTLEQAHIA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF    Y+  D Y+  + A+ +G GM+SRLFQE+RE+RGLCY+I A    ++D G+  +
Sbjct: 240 LGFESPDYRHPDAYVAQVYAAAMGGGMASRLFQEIRERRGLCYTIFAQAGAYTDTGMTTV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ +    L    ++ ++   ++  + E  +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSDDKAGDLARITIDEMKRAADDFSEEETARARAQMKAGLLMGLEGPSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           V   G +   E +++ I A+T +D+   A ++ +  P    +  P+D VP  + L
Sbjct: 360 VQIWGHVPPLETVVERIEAVTRDDLRAYAGRMATEAPMALAVYGPVDRVPDHAGL 414


>gi|307176240|gb|EFN65875.1| Mitochondrial-processing peptidase subunit beta [Camponotus
           floridanus]
          Length = 477

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 109/432 (25%), Positives = 200/432 (46%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E     +A V + I +GSR E  + +G+AHF+EHM FKGT KR+  +
Sbjct: 46  RVTTLDSGMRVASEDSGAATATVGLWIDSGSRYETDDNNGVAHFMEHMAFKGTAKRSQTD 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVFYAKCLSQDVPKAIEILSDIIKNSKLGENEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  + I S + + +  +V  +Y   R
Sbjct: 166 LREMQEVETNLQEVVFDHLHAAAYQGTSLGRTILGPTKNIKSISRDDLQHYVKTHYGPSR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAK---IKESMKPAVYVGGEYIQKRD-LAEEHMM 239
             +   G VDH   +     +F   +      I E +K   Y G E   + D +   H+ 
Sbjct: 226 FVLAGAGGVDHNQLIELANKHFGQMAGPDYDAIPEYVKACRYTGSEIRVRDDTIPLAHVA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENF 291
               G  +   D     +  +++G    S+           +   + GLC+S  + +  +
Sbjct: 286 FAVEGAGWAEADNIPLMVANTLIGAWDRSQGGGVNNASNLAKTCAEDGLCHSYQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  I           + S+I      L  ++ ++E+ +    +   +    + +  
Sbjct: 346 KDTGLWGIYFVCDPMQCDDMISNIQHEWMKLCTSVTEKEVARAKNILKTNMFLQLDGTTA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I ++T + I  V  K IF   P +A +GP ++++P 
Sbjct: 406 ICEDIGRQILCYNRRIPLHELEMRIDSVTAQTIQNVGMKYIFDQCPVIAAVGP-VENLPD 464

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 465 YNYIRGAMYWLR 476


>gi|239826665|ref|YP_002949289.1| processing peptidase [Geobacillus sp. WCH70]
 gi|239806958|gb|ACS24023.1| processing peptidase [Geobacillus sp. WCH70]
          Length = 413

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 141/403 (34%), Positives = 233/403 (57%), Gaps = 3/403 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +      +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGT  R
Sbjct: 1   MLINKYTCKNGVRIVLEQIPTVRSVAIGIWIGTGSRNETEQNNGISHFLEHMFFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA+EI E  + +GG +NA+TS E+T Y+A VL EH   ALE++ DM  +S+F   ++++E
Sbjct: 61  TAREIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHASFALEMLADMFFHSTFVDEELQKE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           RNVVLEEI M ED   D +    S+  + +  +G PILG  ET+ +FT + +  +++  Y
Sbjct: 121 RNVVLEEIRMYEDTPDDIVHDLLSKACYANHPLGYPILGTEETLRTFTGDSLRGYMADYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           T DR+ +   G VD    + QVESYF   +  +     +  ++   + ++++D  + H+ 
Sbjct: 181 TPDRVVISIAGNVDES-FIQQVESYFGSFTAKQKASESQAPLFQPQKLVRQKDTEQAHLC 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GFNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G+L I
Sbjct: 240 IGFNGLPVGHPDIYTLIILNNILGGSMSSRLFQEVREQRGLAYSVFSYHSSYQDSGLLAI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T    +  L  +I E + +L  + I ++E+     ++   L+   E +  R     K
Sbjct: 300 YAGTGNNQLDLLFETIQETIDALKEDGITEKELKNSKEQMKGSLMLGLESTNSRMSRNGK 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
             +  G     ++II+ I+++T E +  +A+ IF+    LA++
Sbjct: 360 NELLLGRHRSLDEIIEEINSVTVEKVNELARSIFNEDYALALI 402


>gi|118472683|ref|YP_886994.1| peptidase, M16 family protein [Mycobacterium smegmatis str. MC2
           155]
 gi|118173970|gb|ABK74866.1| peptidase, M16 family protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 434

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 137/429 (31%), Positives = 218/429 (50%), Gaps = 11/429 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RT
Sbjct: 10  QVRRTTLPGGLRVVTEYLPYVRSASVGVWVGVGSRDEGRSVAGAAHFLEHLLFKSTPTRT 69

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++        D+E ER
Sbjct: 70  AVDIAQTVDAVGGELNAFTAREHTCYYAHVLDSDLELAVDLVADVVLRGRCAAEDVEVER 129

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+IS  T  ++ SF  R YT
Sbjct: 130 DVVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVIGSIESISEMTRAQLHSFHVRRYT 189

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAE 235
            DRM +   G VDH+  V+    +F             ++            + +RD  +
Sbjct: 190 PDRMVLAVAGNVDHDEVVALAREHFGRRLVQGRDAVPPRKGSGRVPGRPSLRVVERDGEQ 249

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ LG           +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + FSD+G
Sbjct: 250 THVSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQEIRETRGLAYSVYSTVDTFSDSG 309

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRAL 354
            L I +    E    +     +V++++    I + E       +   L+   E S  R  
Sbjct: 310 ALSIYAGCLPERFEEVVRVTTDVLETVARDGISENECRIAKGSLRGGLVLGLEDSASRMH 369

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
            I +  +  G     E+ +  I A+T +++  VA+++ +     A+LGP    V     L
Sbjct: 370 RIGRAELNYGEHRSIEQTLAQIDAVTLDEVNAVARQLLTRDYGAAVLGPDTAKV----AL 425

Query: 415 IHALEGFRS 423
              L+   S
Sbjct: 426 PQRLQDIAS 434


>gi|326202155|ref|ZP_08192025.1| processing peptidase [Clostridium papyrosolvens DSM 2782]
 gi|325987950|gb|EGD48776.1| processing peptidase [Clostridium papyrosolvens DSM 2782]
          Length = 411

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 130/404 (32%), Positives = 212/404 (52%), Gaps = 4/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +  + S+G+ ++ E +P + S  V + +  GSRNE  E +G++HF+EHMLFKGTTKR+A
Sbjct: 2   FKKVQLSNGLRLVYEKIPYVRSVSVGIWVGTGSRNETSENNGISHFIEHMLFKGTTKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E I+ +GG INA+T  E T Y+   L  H+ +A++++ DM  NSSF   DI  E+ 
Sbjct: 62  KDIAECIDAIGGQINAFTGKECTCYYTKTLDTHLDIAVDVLADMFFNSSFAGDDINVEKR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEIGM ED   + +   FSEMVW    +G PILG    I+ F  + I+ +++  YT 
Sbjct: 122 VVIEEIGMYEDTPEELVHDIFSEMVWDGNPLGYPILGTEMCINKFDKDMILKYMNEFYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHMML 240
               +   G  D    +  V  YF      K       PA Y   + ++++D  + H+ +
Sbjct: 182 YNTVISVAGNFDEAKLIELVNQYFQDWKFGKTFSNKFSPAQYKVNKIVREKDTEQVHLCM 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G  + +   Y    L +ILG GMSSRLFQ +REKRGL YSI ++   +  +G+  I 
Sbjct: 242 GFEGVEHGNEKLYSLLSLNNILGGGMSSRLFQTIREKRGLVYSIYSYPSTYQGSGLFVIY 301

Query: 301 SATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +    E +  +       + + + + I + E+ K   ++    I   E +  R   I K 
Sbjct: 302 AGMNPEYLQTVIDLTKSELNNIIKDGITKDELSKTKEQLKGNYILGLESTSSRMNSIGKS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
            +  G I   E+++  I  +  + +  + K++      +++ +G
Sbjct: 362 ELMLGKINTPEEVLQKIDRVNMDSVDEMIKRVLDFEKMSISAVG 405


>gi|260809835|ref|XP_002599710.1| hypothetical protein BRAFLDRAFT_287788 [Branchiostoma floridae]
 gi|229284991|gb|EEN55722.1| hypothetical protein BRAFLDRAFT_287788 [Branchiostoma floridae]
          Length = 481

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 96/432 (22%), Positives = 186/432 (43%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G  V +E   + +  V + I AGSR E Q  +G AHFLEHM FKGT  R+  +
Sbjct: 50  KVTTLDNGFRVASEDSGLPTCTVGLWIDAGSRYENQRNNGTAHFLEHMAFKGTKNRSQMD 109

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T Y+A      +  A++++ D++ NS+   ++IERER V+
Sbjct: 110 LELEVENMGAHLNAYTSREQTVYYAKSFSSDLGKAVDVLSDIIQNSTLGEAEIERERGVI 169

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S   + ++ ++S +Y   R
Sbjct: 170 LREMQEVETNLQEVVFDHLHATAYQGTALGRTILGPTENIKSINRQDLVDYISTHYKGPR 229

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + +   G V+H+  V   + YF                          ++   +   H+ 
Sbjct: 230 IVLAAAGGVNHDELVKLADKYFGQLSMSYEGQAPPVLPPCRYTGSEIRVRDDKMPFAHIA 289

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   G  +   D     +  +++G    S         +         +C+S  + +  +
Sbjct: 290 IAVEGVGWSHPDTIPLMVANTLIGSWDRSYGGGNNLSSKLAQAASEGNVCHSFQSFNTCY 349

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           +D G+  I        I  +T  +      L  ++ + E+ +    +   ++   + S  
Sbjct: 350 TDTGLWGIYFVCDGMTIEDMTFHVQNEWMRLCTSVTEGEVQRAKNLLKTNMLLQLDGSTP 409

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              ++ +Q++  G  +   ++   I +IT   I  V  K      P +A +GP ++ +P 
Sbjct: 410 ICEDVGRQMLCYGRRIPLHELDARIDSITASTIRDVCTKYIYDKCPAVAAVGP-VEQLPD 468

Query: 411 TSELIHALEGFR 422
            + L   +   R
Sbjct: 469 YNRLRGGMYWLR 480


>gi|302865981|ref|YP_003834618.1| peptidase M16 domain-containing protein [Micromonospora aurantiaca
           ATCC 27029]
 gi|302568840|gb|ADL45042.1| peptidase M16 domain protein [Micromonospora aurantiaca ATCC 27029]
          Length = 455

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 124/412 (30%), Positives = 215/412 (52%), Gaps = 10/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P   S    + +  GSR+E   + G AHFLEH+LFKGT KR+
Sbjct: 34  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVAVGSRDETGSQAGAAHFLEHLLFKGTNKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI  +IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S    +D+E ER
Sbjct: 94  ALEISSQIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTAADVETER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  ET++  T  +I  F  R YT
Sbjct: 154 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTEETVTPMTRRQIQGFYRRRYT 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVES--------YFNVCSVAKIKESMKPAVYVGGEYIQKRD 232
           A ++ +   G +DH   V  V                      +           ++ ++
Sbjct: 214 APQIVIAAAGNLDHAAVVKLVRQALRGTPLDTDPASPAPHRAATPTVRTKPATTLVEPKE 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++   ++
Sbjct: 274 TEQAHVILGCPGIDRTDDRRFALGVLNNVLGGGMSSRLFQEIREQRGLAYSVYSYASQYA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D+GV  + +  A   +  +       + +   E I + E+ +         +   E +  
Sbjct: 334 DSGVFAVYAGCAPGKVDEVLDLTRAELARVAAEGITEAELARGKGMSKGSFVLGLEDTGS 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   ++K  +  G+++  + ++  + A+T +D+  +A  +     +LA++GP
Sbjct: 394 RMSRLAKGELLYGNLMPVDDLLARVDAVTLDDVNTLAADLLGRPMSLAVVGP 445


>gi|315502541|ref|YP_004081428.1| peptidase m16 domain protein [Micromonospora sp. L5]
 gi|315409160|gb|ADU07277.1| peptidase M16 domain protein [Micromonospora sp. L5]
          Length = 444

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 124/412 (30%), Positives = 215/412 (52%), Gaps = 10/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P   S    + +  GSR+E   + G AHFLEH+LFKGT KR+
Sbjct: 23  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVAVGSRDETGSQAGAAHFLEHLLFKGTNKRS 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI  +IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S    +D+E ER
Sbjct: 83  ALEISSQIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTAADVETER 142

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  ET++  T  +I  F  R YT
Sbjct: 143 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTEETVTPMTRRQIQGFYRRRYT 202

Query: 181 ADRMYVVCVGAVDHEFCVSQVES--------YFNVCSVAKIKESMKPAVYVGGEYIQKRD 232
           A ++ +   G +DH   V  V                      +           ++ ++
Sbjct: 203 APQIVIAAAGNLDHAAVVKLVRQALRGTPLDTDPASPAPHRAATPTVRTKPATTLVEPKE 262

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++   ++
Sbjct: 263 TEQAHVILGCPGIDRTDDRRFALGVLNNVLGGGMSSRLFQEIREQRGLAYSVYSYASQYA 322

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D+GV  + +  A   +  +       + +   E I + E+ +         +   E +  
Sbjct: 323 DSGVFAVYAGCAPGKVDEVLDLTRAELARVAAEGITEAELARGKGMSKGSFVLGLEDTGS 382

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   ++K  +  G+++  + ++  + A+T +D+  +A  +     +LA++GP
Sbjct: 383 RMSRLAKGELLYGNLMPVDDLLARVDAVTLDDVNTLAADLLGRPMSLAVVGP 434


>gi|254382117|ref|ZP_04997479.1| protease [Streptomyces sp. Mg1]
 gi|194341024|gb|EDX21990.1| protease [Streptomyces sp. Mg1]
          Length = 459

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 128/416 (30%), Positives = 219/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPTLNGATHYLEHLLFKGTEKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIREEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F++ ++ +  +GRP+LG  +TI++ T ++I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAQTMFGETPLGRPVLGTVDTINALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF--------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV + F                +   K     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHNKVVRQVRAAFEKAGALTRTDAEPIGPRGGTKRIRTSGRVELINRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +   + +   EI +   ++    +   E +  
Sbjct: 334 DTGLFGVYAGCRPSQVHDVLRICRDELDKVASDGLTDEEIRRAVGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+A+T +D+  VA+ + +  P+LA++GP  + 
Sbjct: 394 IMNRIGKSELCWGDQMSVDDMLARIAAVTPDDVRAVAQDVLAQRPSLAVIGPLKEK 449



 Score = 39.1 bits (89), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 41/99 (41%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++  Q MF  +         +DTI+A+T + I 
Sbjct: 146 EEDVDAERGVILEEIAMTEDDPGDCVHDLFAQTMFGETPLGRPVLGTVDTINALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              KK +  T  +      +DH     ++  A E   ++
Sbjct: 206 RFYKKHYDPTHLVVAAAGNVDHNKVVRQVRAAFEKAGAL 244


>gi|113931314|ref|NP_001039103.1| peptidase (mitochondrial processing) beta [Xenopus (Silurana)
           tropicalis]
 gi|111306188|gb|AAI21601.1| peptidase (mitochondrial processing) beta [Xenopus (Silurana)
           tropicalis]
          Length = 479

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 98/429 (22%), Positives = 193/429 (44%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E Q  +G AHFLEHM FKGT  R+  +
Sbjct: 51  KVTTLENGLRVSSEDSGLLTCTVGLWIDAGSRYENQMNNGTAHFLEHMAFKGTKNRSQLD 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 111 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        + +  +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 171 LREMQEVETNLQEVVFDYLHATAYHNTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  +   + +F         E++ P  + G E   + D +   H+ +  
Sbjct: 231 IVLAAAGGVSHDELLHLAKFHFGNLPSTYEGETLPPCSFTGSEIRVRDDKMPLAHIAVAV 290

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFSDN 294
               +   D     +  +++G+   S            ++     LC+S  + +  ++D 
Sbjct: 291 EAVGWSHPDTIPLMVANTLIGNWDRSFGGGVNLSSKLAQLTCHGNLCHSFQSFNTCYTDT 350

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +   +      L  ++ + E+ +    +   ++   + S     
Sbjct: 351 GLWGLYMVCEPNTVEDMMHFVQREWIRLCTSVTENEVARAKNLLKTNMLLQLDGSTPICE 410

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I  I+ E I  V  K   + +P +A +GP +  +P    
Sbjct: 411 DIGRQMLCYNRRIPLPELEARIDLISAETIREVCTKYIYNKSPAVAAVGP-IGQLPDYDR 469

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 470 IRSGMYWLR 478


>gi|317129154|ref|YP_004095436.1| peptidase M16 domain protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474102|gb|ADU30705.1| peptidase M16 domain protein [Bacillus cellulosilyticus DSM 2522]
          Length = 412

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 127/411 (30%), Positives = 219/411 (53%), Gaps = 4/411 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++   + +G+ ++ E    + S  + + I  GSR E ++++G++HFLEHM FKGT  RTA
Sbjct: 2   IKRFTSDNGLRIVFEPNNTVRSVAIGIWIGTGSRFETKQQNGVSHFLEHMFFKGTKSRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  + +GG +NA+TS E+T Y++ VL  H   A++++ DM  NS F+ +++ +E+ 
Sbjct: 62  QQIAESFDSIGGHVNAFTSKEYTCYYSKVLDTHAKHAVDVLADMYFNSIFDTNELNKEKG 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +    S+  + +  +G PILG  ET+S F+ E +I ++ + Y A
Sbjct: 122 VVLEEIKMYEDTPDDIVHDLLSKASFGEHPLGYPILGTEETLSQFSAESLIEYMDQYYNA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G    E  V  V+  F+     K  +++    +      +K+D  + H+ +G
Sbjct: 182 DNVVISICGN-VEEDFVQYVQEVFSKMKKGKSNKTLNKPTFNSDRIARKKDTEQAHICIG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G    +   Y   +L + LG  MSSRLFQEVREKRGL YS+ ++H  F D G++ + +
Sbjct: 241 FEGFPLNNEQIYSLILLNNTLGGSMSSRLFQEVREKRGLAYSVFSYHSAFHDTGMVTVYA 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T +  +  L   ++  V     E + ++E+     ++   L+   E +  R     K  
Sbjct: 301 GTGQNQLDELFEVLMNTVNIVKTEGMTEKELQNGKEQLKGSLMLGLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
           +  G     + II +I  +T + I   + +IFS   +L ++ P  D +P  
Sbjct: 361 LLLGRHRSLDDIIHSIDQVTLDMIKETSDQIFSKDYSLTVISPKGD-LPKA 410


>gi|291009327|ref|ZP_06567300.1| putative zinc protease [Saccharopolyspora erythraea NRRL 2338]
          Length = 419

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 128/416 (30%), Positives = 221/416 (53%), Gaps = 9/416 (2%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P   SA + + +  GSR+E +++ G AH+LEH+LFKGT KRTA 
Sbjct: 2   RRTVLPGGLRVVTEQVPGARSASMGIWVGVGSRDESRQQAGAAHYLEHLLFKGTAKRTAV 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I +EI+ VGG++NA+TS EHT Y+A VL E +PLA++++ D++ ++    +D++ ER+V
Sbjct: 62  QIAQEIDAVGGELNAFTSKEHTCYYAHVLDEDLPLAVDMLCDVVFDAVNAKADVDVERSV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F+E V  D  +GR +LG  E+I S +  ++  F   +Y   
Sbjct: 122 VLEEIAMRDDDPEDLLHETFTEAVLGDHPLGRSVLGTEESIESMSRARVHGFYRSSYQLP 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM V   G ++H   +  +            + A  +             + + D  + H
Sbjct: 182 RMVVAVAGNIEHARVLRLLRKAIGDRLDGDSAPAPPRSGRARLPRQRPLVLHEDDTEQAH 241

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LG  G        +   +L + LG GMSSRLFQE+REKRGL YS+ +    ++D G  
Sbjct: 242 LLLGCRGIDRHDERRFALGVLNAALGGGMSSRLFQEIREKRGLAYSVYSSTTAYADTGTF 301

Query: 298 YIASATAKENIMALTSSIVEVVQ-SLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + +    + +  + + +  V+     + + + E+ +   ++   L+   E +  R   I
Sbjct: 302 SVYAGCTPDRLGEVAAVVRGVLAGVAADGLTEDEVARGRGQLRGGLVLGLEDTASRMTRI 361

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP--PMDHVPT 410
            K  +  G  L   + ++ I A+T +D+  +A ++     T A++GP   ++ +P 
Sbjct: 362 GKSELNYGRHLSVAQTLERIDAVTAQDVAELAAELLQRPLTTAVVGPYGAVEDLPD 417


>gi|134102360|ref|YP_001108021.1| putative zinc protease [Saccharopolyspora erythraea NRRL 2338]
 gi|133914983|emb|CAM05096.1| putative zinc protease [Saccharopolyspora erythraea NRRL 2338]
          Length = 449

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 128/416 (30%), Positives = 221/416 (53%), Gaps = 9/416 (2%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P   SA + + +  GSR+E +++ G AH+LEH+LFKGT KRTA 
Sbjct: 32  RRTVLPGGLRVVTEQVPGARSASMGIWVGVGSRDESRQQAGAAHYLEHLLFKGTAKRTAV 91

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I +EI+ VGG++NA+TS EHT Y+A VL E +PLA++++ D++ ++    +D++ ER+V
Sbjct: 92  QIAQEIDAVGGELNAFTSKEHTCYYAHVLDEDLPLAVDMLCDVVFDAVNAKADVDVERSV 151

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F+E V  D  +GR +LG  E+I S +  ++  F   +Y   
Sbjct: 152 VLEEIAMRDDDPEDLLHETFTEAVLGDHPLGRSVLGTEESIESMSRARVHGFYRSSYQLP 211

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM V   G ++H   +  +            + A  +             + + D  + H
Sbjct: 212 RMVVAVAGNIEHARVLRLLRKAIGDRLDGDSAPAPPRSGRARLPRQRPLVLHEDDTEQAH 271

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LG  G        +   +L + LG GMSSRLFQE+REKRGL YS+ +    ++D G  
Sbjct: 272 LLLGCRGIDRHDERRFALGVLNAALGGGMSSRLFQEIREKRGLAYSVYSSTTAYADTGTF 331

Query: 298 YIASATAKENIMALTSSIVEVVQ-SLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + +    + +  + + +  V+     + + + E+ +   ++   L+   E +  R   I
Sbjct: 332 SVYAGCTPDRLGEVAAVVRGVLAGVAADGLTEDEVARGRGQLRGGLVLGLEDTASRMTRI 391

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP--PMDHVPT 410
            K  +  G  L   + ++ I A+T +D+  +A ++     T A++GP   ++ +P 
Sbjct: 392 GKSELNYGRHLSVAQTLERIDAVTAQDVAELAAELLQRPLTTAVVGPYGAVEDLPD 447


>gi|297202780|ref|ZP_06920177.1| protease [Streptomyces sviceus ATCC 29083]
 gi|197716768|gb|EDY60802.1| protease [Streptomyces sviceus ATCC 29083]
          Length = 459

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 128/416 (30%), Positives = 220/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT+KR+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPSLNGATHYLEHLLFKGTSKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D+  ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDADLPLAIDVVCDMLTGSLILEEDVNVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK--------RD 232
              + V   G VDH+  V QV + F      K  ++   A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHDKVVRQVRAAFEKAGALKSPDATPIAPRDGRRALRTAGRVELIGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDQVAEHGLTDDEIGRAIGQLRGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+++T +D+  VA++I    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLTRIASVTPDDVRAVAREILGRRPSLSVIGPLKDK 449



 Score = 37.6 bits (85), Expect = 3.5,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 40/99 (40%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + +++ E   I  ++  +++       ++    MF  +         +DT++A+T + I 
Sbjct: 146 EEDVNVERGAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVDTVNALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              KK +  T  +      +DH     ++  A E   ++
Sbjct: 206 RFYKKHYDPTHLVVAAAGNVDHDKVVRQVRAAFEKAGAL 244


>gi|158301640|ref|XP_321316.4| AGAP001767-PA [Anopheles gambiae str. PEST]
 gi|157012570|gb|EAA01226.4| AGAP001767-PA [Anopheles gambiae str. PEST]
          Length = 474

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 98/431 (22%), Positives = 191/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++++  +G+ V +E    ++A V V I AGSR E    +G+AHFLEHM FKGT KR+   
Sbjct: 44  QVTQLDNGLRVASEDSGAETATVGVWINAGSRCENSSNNGVAHFLEHMAFKGTAKRSQAN 103

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + V  A+EI+ D++ N +    +I RER+V+
Sbjct: 104 LELEVENLGAHLNAYTSREQTVFYAKCLSKDVAKAVEILSDIVQNPTLGEEEIVRERDVI 163

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S    ++  ++   Y A R
Sbjct: 164 LREMQEIESNLKEVVFDHLHATAFQGTALGKSILGPSKNIQSIGKTELKHYIDTQYKAPR 223

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G VDH+  V   +  F   +    AK               ++   L   H+++
Sbjct: 224 IVLAAAGGVDHKELVQLAKQNFGEMNSIVDAKKDALDACRFTGSEVRVRDDSLPLAHVVI 283

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
               C +   D     +  S +G    ++        +        G+C+S  + +  + 
Sbjct: 284 AVESCGWTDEDHVPLMVATSFIGAWDRAQSGSVNHASKLAVASAVDGMCHSFQSFNVCYR 343

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I           +  ++      L   + + EI++    +   ++   + +   
Sbjct: 344 DTGLWGIYFVCDPLTCEDMLFNVQNEWMRLCTIVTEGEIERAKNLLKTNMLLHLDGTTPI 403

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I ++T   +  VA K  F   P +A +GP ++++P  
Sbjct: 404 CEDIGRQLLCYNRRIPVHEMEQRIDSVTAAKVREVAMKYIFDRCPAVAAVGP-VENLPDY 462

Query: 412 SELIHALEGFR 422
             +  ++   R
Sbjct: 463 MRIRSSMHWTR 473


>gi|297617198|ref|YP_003702357.1| peptidase M16 domain protein [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145035|gb|ADI01792.1| peptidase M16 domain protein [Syntrophothermus lipocalidus DSM
           12680]
          Length = 446

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 127/402 (31%), Positives = 215/402 (53%), Gaps = 5/402 (1%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
               +G  +++E +P + S  + + +  GSR+E  E +G  HF+EH+LFKGT  RTAK+I
Sbjct: 5   WVLDNGARLVSEEIPHLRSVAMGIYVGVGSRDEADEMNGTTHFIEHLLFKGTATRTAKDI 64

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            E  E +GG +NAYTS E+T ++A  L E+   AL+I+ DM+ NS F   D+  E+ V++
Sbjct: 65  AEAFESIGGQLNAYTSKEYTCFYARTLDENFEEALDILFDMVFNSVFMDKDLLTEKGVIV 124

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           EEIGM ED   + +   FS+++W++  +GRPILG  ET+ +   E +I +  + Y    M
Sbjct: 125 EEIGMYEDSPDELIHDVFSQLLWRNHALGRPILGTKETVMALKRESVIEYYRQYYVPSNM 184

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKES--MKPAVYVGGEYIQKRDLAEEHMMLGF 242
            +   G +++     +V  + +      +  +             +  +D  +  + +G 
Sbjct: 185 VIAIAGNINNSMVRDKVSEWLHRVQNHPVSRAKLPPDIPPKNELRLITKDTEQVQLCIGT 244

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              +Y   + ++ NI+ SILG G+ SRLFQ +RE++GL YS+  +  ++SD+G   I +A
Sbjct: 245 PSISYSHDERHVQNIMNSILGGGIGSRLFQTIREEKGLAYSVYTYPTSYSDSGSFCIYAA 304

Query: 303 TAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           T+ E I  L + + E + +     +   EI++   +I A +    E    R   + K VM
Sbjct: 305 TSPEKINDLMAGLGEELDKFRTNGVTADEINRAQRQIKANMYLGMESVMNRMSRLGKSVM 364

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           F   I+  E++ID I A+T +DI   A ++       LA +G
Sbjct: 365 FYDRIIPLEEVIDNIMAVTADDIQRFANQVLVPDKLCLAAIG 406


>gi|148232643|ref|NP_001088918.1| hypothetical protein LOC496289 [Xenopus laevis]
 gi|56970691|gb|AAH88718.1| LOC496289 protein [Xenopus laevis]
          Length = 479

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 97/429 (22%), Positives = 190/429 (44%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E Q  +G AHFLEHM FKGT  R+  +
Sbjct: 51  KVTTLENGLRVASEDSGLLTCTVGLWIDAGSRYENQMNNGTAHFLEHMAFKGTKNRSQLD 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 111 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +    +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 171 LREMQEVETNLQEVVFDYLHATAYHSTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+      + +F         E++    + G E   + D +   H+ +  
Sbjct: 231 IVLAAAGGVSHDELQDLAKFHFGNLPSIYDGETLPSCSFTGSEIRVRDDKMPLAHIAVAV 290

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLF--------QEVREKRGLCYSISAHHENFSDN 294
               +   D     +  +++G+   S            ++     LC+S  + +  ++D 
Sbjct: 291 EAVGWSHPDTIPLMVANTLIGNWDRSFGSGVNLSSKLAQLTCHGNLCHSFQSFNTCYTDT 350

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +   +      L  ++ + E+ +    +   ++   + S     
Sbjct: 351 GLWGLYMVCEPNTVEDMMHFVQREWIRLCTSVTENEVARAKNLLKTNMLLQLDGSTPICE 410

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I  I+ E I  V  K   + +P +A +GP +  +P    
Sbjct: 411 DIGRQMLCYNRRIPLPELEARIDLISAETIREVCTKYIYNKSPAVAAVGP-IGELPNYDR 469

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 470 IRSGMYWLR 478


>gi|326403980|ref|YP_004284062.1| putative peptidase M16 [Acidiphilium multivorum AIU301]
 gi|325050842|dbj|BAJ81180.1| putative peptidase M16 [Acidiphilium multivorum AIU301]
          Length = 417

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 153/416 (36%), Positives = 242/416 (58%), Gaps = 3/416 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +++K  SG+T++TE M  +++         G+R+E   E+G++HFLEHM FKGT +R+A 
Sbjct: 2   QVTKLDSGLTILTERMDRVETVSFGAYAGVGTRHETAAENGVSHFLEHMAFKGTERRSAA 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I E IE VGG INAYTS E T+Y+  +LKE + L ++IIGD+L +S+F+P++ ERER V
Sbjct: 62  AIAEAIEDVGGHINAYTSREQTAYYVKLLKEDLSLGIDIIGDILCHSTFDPAEFERERGV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L+EIG + D   D +   F    + DQ +G P LG  E I +  P+ +  ++  +YT +
Sbjct: 122 ILQEIGQANDTPDDIVFDHFQLAAYPDQPMGWPTLGTEEIIRAIGPDALRRYMKAHYTPE 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            + +   G ++H   V  V  +F     A   E +    Y GGEY + RDL + H++LGF
Sbjct: 182 NLVIAASGNLEHARVVDLVAKHFADLPAATRAEPLPAD-YAGGEYRELRDLDQAHLVLGF 240

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
               Y   DF+   +L+++LG GMSSRLFQE+REKRGL YSI +      D G+  I + 
Sbjct: 241 PAVGYADPDFHAAMLLSTLLGGGMSSRLFQEIREKRGLVYSIYSFALPARDAGLFGIYAG 300

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T +     L    +  +  + +++ + E+ +  A++ A L+ S E +  R  +I++Q   
Sbjct: 301 TGEAEAAELVPVTLGELAKVRQSVSEAELRRARAQVKAGLLMSLESTGSRCEQIARQWQI 360

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
            G I+ + + +  I A+T +DI  VA +IF + PTLA +GP +  VP   ++I  L
Sbjct: 361 FGRIVPTAETVAKIDAVTVDDITSVATRIFRAKPTLAAIGP-VGRVPQMPKIIERL 415


>gi|296269052|ref|YP_003651684.1| peptidase M16 domain-containing protein [Thermobispora bispora DSM
           43833]
 gi|296091839|gb|ADG87791.1| peptidase M16 domain protein [Thermobispora bispora DSM 43833]
          Length = 435

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 138/413 (33%), Positives = 216/413 (52%), Gaps = 9/413 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE MP + S  V + +  GSR+E  E  G  HFLEH+LFKGT  R A
Sbjct: 15  VRRTVLPGGLRVVTETMPTVRSVAVGIWVGIGSRDEAPEHMGATHFLEHLLFKGTPTRNA 74

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   IE +GG+INA+T+ E+T Y+A VL E + +A++++ D++++S   P D+E ER 
Sbjct: 75  MEISASIEGIGGEINAFTAKEYTCYYARVLDEDLAIAIDVLADVVTSSLLAPEDVESERG 134

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   FS  ++ D  IGRPILG  E+I++ T ++I  +  R Y  
Sbjct: 135 VILEEIAMHDDDPADLVHEEFSAELFGDTPIGRPILGNEESINALTRDRIGEYYRRFYVP 194

Query: 182 DRMYVVCVGAVDHEFC-------VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLA 234
            R  V  VG VDHE           +  +       A  +          G  +  R   
Sbjct: 195 SRTVVSVVGNVDHERVVDLVAAAYERAGALHGPAEPAPPRIGGPGVPQRSGVRVIARPTE 254

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + +++LG           +   +L + LG GMSSRLFQE+REKRGL YS  +   +++D 
Sbjct: 255 QANLVLGTTAYPRTDERRFALGVLNAALGGGMSSRLFQEIREKRGLAYSTYSFTAHYADT 314

Query: 295 GVLYIASATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G   I        I  +      E+ + L E +   EI +   ++   L+   E +  R 
Sbjct: 315 GQFGIYVGCLPSKIDEVLKICRDEMARVLTEGLTPEEIARGKGQMRGGLVLGLEDTGSRM 374

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
             I+K  +    ++  ++++  I+A+T ED+  VA+ +F+   TLA++GP  D
Sbjct: 375 SRIAKSELVYERLMPVDEVLARIAAVTPEDVAAVAQDVFNRPLTLAVIGPYED 427


>gi|238063393|ref|ZP_04608102.1| peptidase M16 [Micromonospora sp. ATCC 39149]
 gi|237885204|gb|EEP74032.1| peptidase M16 [Micromonospora sp. ATCC 39149]
          Length = 456

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 126/412 (30%), Positives = 221/412 (53%), Gaps = 10/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P   S    + +  GSR+E   + G AHFLEH+LFKGT KRT
Sbjct: 37  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVSVGSRDETGPQAGAAHFLEHLLFKGTHKRT 96

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I  EIE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D +++S   P+D+E ER
Sbjct: 97  ALDISAEIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDAVADSLLEPADVETER 156

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  ET++  T  +I SF  R+YT
Sbjct: 157 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTEETVTPMTRRQIQSFYRRHYT 216

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCS--------VAKIKESMKPAVYVGGEYIQKRD 232
           A ++ V   G +DH   V  V                      + +  V      ++ ++
Sbjct: 217 APQIVVAAAGNLDHAVVVRLVRQALAGTPLDTDPAAPAPHRAATPRVRVRPATTLVEPKE 276

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++   ++
Sbjct: 277 TEQAHVVLGCPGIDRVDERRFALGVLNNVLGGGMSSRLFQEIRERRGLAYSVYSYASQYA 336

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
           D+G+  + +  A   +  +       ++ +  + + + E+ +         +   E +  
Sbjct: 337 DSGMFAVYAGCAPGKVDEVLELTRAELRRVAADGLTEAEVARGKGMSKGSFVLGLEDTGS 396

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   ++K  +  G ++  ++++  + A+T  D+  +A ++ +   +LA++GP
Sbjct: 397 RMSRLAKGELLYGDLMPVDELLARVDAVTVADVNTLAAELLAQPMSLAVVGP 448


>gi|75674429|ref|YP_316850.1| peptidase M16 [Nitrobacter winogradskyi Nb-255]
 gi|74419299|gb|ABA03498.1| peptidase M16 [Nitrobacter winogradskyi Nb-255]
          Length = 429

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 144/404 (35%), Positives = 234/404 (57%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K SSG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGTT R
Sbjct: 1   MSVNVTKLSSGLTVVTDDMPHLETAALGVWTGVGGRDEKPDEHGISHLLEHMAFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++ I EEIE VGGD+NA T +E T+Y+A V+K  VPLAL+++ D+LSN  F+  ++E E
Sbjct: 61  SSRAIAEEIEAVGGDLNAATGVETTAYYARVMKADVPLALDVLSDILSNPIFDAKELECE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+ +EIG ++D   D +  + +E+ + DQ IGR +LG PET+  F  + +  ++  +Y
Sbjct: 121 KGVIEQEIGAAQDTPDDVVFEQLNELCYPDQPIGRSLLGTPETLERFNSDMLHGYLKTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GA++H   V++VE  F     A   +        GG  +  RDL + H+ 
Sbjct: 181 RGPDMVVAAAGAIEHGMVVAEVERRFAGFDAAPPPQPAAATFGHGGSRVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  S+LG GMSSRLFQEVREKRGLCYSI   H  ++D G+  +
Sbjct: 241 LALEGVPQTDGSLFSLQVFTSVLGGGMSSRLFQEVREKRGLCYSIYTFHAPYADTGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+V+   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVIVDVISEAVETLTEAEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           ++  G      ++   I A++ E     A+ + + S P +  LG
Sbjct: 361 MLVYGRPQSVGELTARIDAVSVESTRDAARGLLARSRPAVVALG 404


>gi|114770417|ref|ZP_01447955.1| peptidase, M16 family protein [alpha proteobacterium HTCC2255]
 gi|114549254|gb|EAU52137.1| peptidase, M16 family protein [alpha proteobacterium HTCC2255]
          Length = 421

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 152/418 (36%), Positives = 242/418 (57%), Gaps = 3/418 (0%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+RI+   +G  +++E M    SA + V + AG RNE  +++G+AHFLEHM FKGT KR 
Sbjct: 4   NVRITTLDNGFRIVSERMSGLKSASLGVWVNAGCRNESFKQNGIAHFLEHMAFKGTKKRN 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI E IE VGG INAYTS E T+Y+  VL+  VPLAL++I D++ NS F+P ++E ER
Sbjct: 64  ALEIAEAIEDVGGYINAYTSREMTAYYVRVLENDVPLALDVISDIVLNSVFDPKELEIER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG S D   D +     +  + +Q +GR ILG  E + SF  + + +FV+ +Y 
Sbjct: 124 GVILQEIGQSLDTPDDIIFDWLQDTAYPNQAMGRAILGSTENVRSFNRKDLQNFVNEHYG 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            ++M +   GAVDH+  V + +  F        K   +P+ ++GGE    ++L + H  L
Sbjct: 184 PEQMVLSAAGAVDHDALVKEAKILFGGLKRTS-KFLNEPSNFIGGEVRVIKNLEQAHFAL 242

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            F   +Y   + Y   I AS LG GMSSRLFQE+REKRGLCYSI A    F+D+G++ I 
Sbjct: 243 SFESASYLDDNIYTAQIYASALGGGMSSRLFQEIREKRGLCYSIYASAGAFADSGMMTIY 302

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           S T+ ++I  L +  ++ ++    +I   E+ +  A++ A ++   E +  R   +++ +
Sbjct: 303 SGTSSDDISGLANITIDEIKRSAADITDEEVARSRAQMKAGMLMGLEGASSRCERLARTI 362

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           +    +   ++II  I A++   +   A+ +  S+   A+ GP ++  P  ++L   L
Sbjct: 363 LIFNRVPDLDEIISKIDAVSASHVKNFAQSLCESSIAYALYGP-VEGAPDVNDLEKRL 419


>gi|322803096|gb|EFZ23184.1| hypothetical protein SINV_10420 [Solenopsis invicta]
          Length = 477

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 110/432 (25%), Positives = 202/432 (46%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E     +A V + I +GSR E  + +G+AHF+EHM FKGT KR+  +
Sbjct: 46  RVTTLDSGMRVASEDSGAATATVGLWIDSGSRYETDDNNGVAHFMEHMAFKGTAKRSQTD 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVFYAKCLSQDVPKAIEILSDIIQNSKLGENEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  + I S + + +I +V  +Y   R
Sbjct: 166 LREMQEVETNLQEVVFDHLHAAAYQGTSLGRTILGPTKNIKSISRDDLIKYVKNHYGPPR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRD-LAEEHMM 239
             +   G VDH   +     +F   +     +I + +K   Y G E   + D +   H+ 
Sbjct: 226 FVLAGAGGVDHSQLIELANKHFGKMTGPEYDEIPDYIKSCRYTGSEIRVRDDTIPLAHVA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENF 291
           +   G  +   D     +  +++G    S+               ++GLC+S  + +  +
Sbjct: 286 IAVEGAGWAEADNIPLMVANTLIGGWDRSQGGGVNNASSLAKACAEQGLCHSYQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  I           +TS I      L   + ++++ +    +   +    + +  
Sbjct: 346 KDTGLWGIYFVCDPMQCEDMTSHIQHEWMKLCTLVTEKDVARAKNILKTNMFLQLDGTTA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I ++T E I  V  K IF   P +A +GP ++++P 
Sbjct: 406 VCEDIGRQMLCYNRRIPLHELEMRIDSVTAETIQNVGMKYIFDHCPVIAAVGP-VENLPD 464

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 465 YNNIRGAMYWLR 476


>gi|163794855|ref|ZP_02188824.1| processing peptidase [alpha proteobacterium BAL199]
 gi|159179674|gb|EDP64201.1| processing peptidase [alpha proteobacterium BAL199]
          Length = 418

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 141/419 (33%), Positives = 248/419 (59%), Gaps = 3/419 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R++K  SG+TV+T+ MP ++SA V + +  G+R+E   E+G+AH +EHM+FKGT +R
Sbjct: 1   MGIRVTKLDSGLTVVTDAMPSVESASVGLWVGVGTRHENPAENGLAHMIEHMVFKGTRRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A  I  EIE VGG +NAYTS E T+Y+A VL + +P+A+++I D++ +S F+P ++ RE
Sbjct: 61  DAAAIAREIEDVGGHMNAYTSREQTAYYAKVLADDMPVAVDLIADIMQDSLFDPDELARE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+++EIG   D   D +   F E  + +Q +GRP+LG+ E + S   + ++ ++  NY
Sbjct: 121 RSVIIQEIGQVADTPDDIIYDHFQEAAYPNQGLGRPVLGRTEIVQSLGRDALVGYLDTNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
                 +   G VDH+  V+     F+      +  + K   YVGGE   +R+L + H++
Sbjct: 181 GPGISILSAAGKVDHDAFVALAAERFDHLPGRAVATTDKAN-YVGGEVRVERELEQLHVI 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G A+   DF+   + +++ G GMSSRLFQEVREKRGL YS+ +   ++ D+G++ +
Sbjct: 240 LGFRGVAFDDPDFHAMQVFSTLYGGGMSSRLFQEVREKRGLAYSVYSFTSSYLDDGMVGV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T  + I  +   +VE + ++ + +E+ E+ +   ++ A L+ S+E +  R  +++  
Sbjct: 300 YAGTGPDEIDEVMPLVVEQLHAVADKLEEGELARARTQLKASLLMSRESTGTRCEQLANY 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G      + +  + A+    I  V  ++ +S PTLA +GP    + +  ++   L
Sbjct: 360 MLVYGRPPVVAETVAKVDAVDEAAIRRVVARLLASPPTLAAIGP-TGALESYDKVKARL 417


>gi|148263964|ref|YP_001230670.1| peptidase M16 domain-containing protein [Geobacter uraniireducens
           Rf4]
 gi|146397464|gb|ABQ26097.1| peptidase M16 domain protein [Geobacter uraniireducens Rf4]
          Length = 419

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 139/415 (33%), Positives = 229/415 (55%), Gaps = 3/415 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +  +   +GI VI+E +P  +S  + + +  GSR+ER+E +G+AHF+EH+LFKGT++RTA
Sbjct: 2   INKTILDNGIRVISEALPHANSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTSRRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++I+ D+  NS F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGILNAFTSREYVCYYAKVLDKFLPKAVDILVDIFHNSLFDPEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED+  D +   F +  WK   +G  ILG  E++SS + +KI+ + +  Y A
Sbjct: 122 VVLQEISMMEDNPDDSIHDLFHQHFWKGHPLGMSILGDQESVSSLSRDKIVGYKNHMYRA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G VDH+  +  +            K + +  VY     +  ++L + HM LG
Sbjct: 182 DDIIITAAGKVDHQDLLDLIGKLLPDVPQGSGKVACQNPVYEKRIELIGKELEQVHMCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK+GL YS+ ++  +  D G L + +
Sbjct: 242 VKGLPQHHSQRYEAFIMNTILGGSMSSRLFQEVREKQGLAYSVYSYMASHVDAGSLVVYA 301

Query: 302 ATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            + +E+   +      E+++   E I   E+D    ++   LI S E S  R  +++K  
Sbjct: 302 GSGQEHFTEVLEITVRELMRLKKEPISLLELDSAREQLKGNLILSLESSDNRMSKLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSEL 414
           ++ G     E+I      +T E I+ ++ ++      TL +LG   +     S++
Sbjct: 362 IYFGGYQPLEEITAGFDRVTSESIMQLSSELLDDNYLTLVLLGKLGNTRFALSDI 416


>gi|159036979|ref|YP_001536232.1| peptidase M16 domain-containing protein [Salinispora arenicola
           CNS-205]
 gi|157915814|gb|ABV97241.1| peptidase M16 domain protein [Salinispora arenicola CNS-205]
          Length = 462

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 126/411 (30%), Positives = 218/411 (53%), Gaps = 10/411 (2%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +   SG+ V+TE +P   S    + +  GSR+E   + G AHFLEH+LFKGT +R A
Sbjct: 44  VRRTVLPSGLRVLTETIPAMRSVSFGIWVSVGSRDETGPQSGAAHFLEHLLFKGTHRRAA 103

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S   P D+E ER 
Sbjct: 104 LEISSAIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTPDDVEIERG 163

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +D+  D +   F+  V+ +  +GR I G  +T++  T  +I SF  R+YT 
Sbjct: 164 VILEEIAMHDDEPGDEVHDLFARAVYGEHPLGRLISGTEQTVTPMTRRQIQSFYRRHYTP 223

Query: 182 DRMYVVCVGAVDHEFCVSQVES--------YFNVCSVAKIKESMKPAVYVGGEYIQKRDL 233
            R+ +   G +DH   V+ V                      +           +  ++ 
Sbjct: 224 PRIVIAAAGNLDHASVVTMVRQALRGTPLDTDPATPAPHRAATPAVRTRPATTLVTPKET 283

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + H++LG  G  +     +   +L +ILG GMSSRLFQE+RE+RGL YS+ ++    +D
Sbjct: 284 EQAHVVLGCTGIDWHDDRRFALGVLNNILGGGMSSRLFQEIREQRGLAYSVYSYASQHAD 343

Query: 294 NGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           +G+  I +  A   +  +   I   + +  ++ + + E+ +         +   E S  R
Sbjct: 344 SGLFGIYAGCAPGRVNEVLDLIRAELTRVAVDGLTEAEVARGKGMSKGSFVLGLEDSGSR 403

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              ++K  +  G +L  + ++  + A+T +D+  +A ++ S + +LA++GP
Sbjct: 404 MSRLAKGELLYGDLLPVDALLARVDAVTVDDVNTLATELLSRSLSLAVVGP 454


>gi|257055505|ref|YP_003133337.1| putative Zn-dependent peptidase [Saccharomonospora viridis DSM
           43017]
 gi|256585377|gb|ACU96510.1| predicted Zn-dependent peptidase [Saccharomonospora viridis DSM
           43017]
          Length = 453

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 132/433 (30%), Positives = 219/433 (50%), Gaps = 17/433 (3%)

Query: 1   MN---LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGT 56
           M+   ++ +    G+ VITE +    SA V + +  GSR+ER    G AH+LEH+LFKGT
Sbjct: 22  MDSGVVKRTVLPGGLRVITESISGVRSATVGLWVGVGSRDERPHLAGAAHYLEHLLFKGT 81

Query: 57  TKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDI 116
            +R+A +I EEI+ VGG++NA+T+ EHT ++A VL + +PLA+++I D++  +  + +D+
Sbjct: 82  ARRSAAQIAEEIDAVGGEMNAFTAKEHTCFYAQVLDDDLPLAVDLITDVVFEALCSDADV 141

Query: 117 ERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVS 176
           + ER VVLEEI M +DD  D L   F E V  +  +GR ILG  ++I+  TP  + SF  
Sbjct: 142 DIERGVVLEEIAMRDDDPEDLLHEMFVETVMPNHPLGRSILGTEQSITMMTPSALRSFYR 201

Query: 177 RNYTADRMYVVCVGAVDHEFCVSQVE-----SYFNVCSVAKIKESMKPAVYVGGEYIQKR 231
           R Y   RM +   G V+H   V  VE           +    +             + K 
Sbjct: 202 RRYRLQRMVLAVAGNVEHRAVVRMVESALRGRLSGSDTPRPPRGGQARFGRSVRPVLYKH 261

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
           D  + H+MLG           Y   +L ++LG GMSSRLFQEVRE+RGL Y + +   ++
Sbjct: 262 DTEQTHLMLGVRTPGRHDERRYSLAVLNTVLGGGMSSRLFQEVRERRGLAYQVYSSVTSY 321

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSY 350
           +D G   I      + +  +   +  ++   +   + + E+ +   ++   L+   E + 
Sbjct: 322 ADAGHFDIYVGCQPDRLGEVAGVVGGMLADLVEHGVTEAEVTRAKGQLRGGLVLGLEDTA 381

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST---PTLAILGPPM-- 405
            R   + +  +  G      + ++ I A+T ED+  +A+ +         +A++GP    
Sbjct: 382 SRMFRLGENELHYGHYRSVSETVERIDAVTTEDVTALARALLRRPGGRSAVAVVGPYAHT 441

Query: 406 DHVPTTSELIHAL 418
           D +P   EL   +
Sbjct: 442 DDLP--EELHEVM 452


>gi|57239467|ref|YP_180603.1| putative protease [Ehrlichia ruminantium str. Welgevonden]
 gi|58579445|ref|YP_197657.1| putative protease [Ehrlichia ruminantium str. Welgevonden]
 gi|57161546|emb|CAH58473.1| putative zinc protease [Ehrlichia ruminantium str. Welgevonden]
 gi|58418071|emb|CAI27275.1| Hypothetical zinc protease [Ehrlichia ruminantium str. Welgevonden]
          Length = 421

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 142/418 (33%), Positives = 247/418 (59%), Gaps = 5/418 (1%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            I++ S+  T+IT+ MP ++S  + + +  GSR+E     G++HFLEHM FKGT  RTA 
Sbjct: 4   NITQLSNSFTIITDTMPYVESVSINIWVNVGSRHENTNIAGISHFLEHMAFKGTKTRTAL 63

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I +  + +GG+ NA+T  EHT YH  +LK  + +A+E++ D++ NS F   +I+RE+ V
Sbjct: 64  DIAQIFDNIGGNFNAHTDREHTVYHVKILKRDIKIAIEVLADIILNSQFPQEEIDREKGV 123

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VL+EI  + D     +  ++ E  + +Q+ G+ ILG PE++S+ + E + +++  +Y A 
Sbjct: 124 VLQEIYQTNDSPTSIIFDKYIEAAYPNQVFGKSILGTPESVSNLSKENLHTYMQEHYHAG 183

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            M +   G + H   +     YF+    +   +    +VY+ GEY ++RDL + H+++GF
Sbjct: 184 NMLLSVAGNITHNEVIDLATQYFSQIKKS-TPQETNKSVYISGEYREERDLEQVHIVIGF 242

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              +Y+   FY+  IL SILG+GMSSRLFQ++RE+ GL YSIS+ + ++SDNG+  I +A
Sbjct: 243 PSSSYKDDQFYVIQILDSILGNGMSSRLFQKIREQLGLVYSISSFNSSYSDNGIFSIYTA 302

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T K N+  L  +I   VQ +  N+E+ E+ +   K+ ++++ S+E +  RA  +      
Sbjct: 303 TDKNNLPQLLDAIAAEVQGIYINLEENEVIRAKDKLTSEILMSRESTTARAESLGYYYSH 362

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSELIHAL 418
               +  E+++  IS IT EDI+    ++  S    TLA +G  ++ +P+ +++    
Sbjct: 363 YNRYITKEELLKKISEITMEDILNCISRLLRSNNKITLAAIG-QIETLPSYNDICQMF 419


>gi|118590738|ref|ZP_01548139.1| peptidase, family M16 [Stappia aggregata IAM 12614]
 gi|118436714|gb|EAV43354.1| peptidase, family M16 [Stappia aggregata IAM 12614]
          Length = 418

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 169/411 (41%), Positives = 253/411 (61%), Gaps = 4/411 (0%)

Query: 12  ITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEK 70
           +TV+T+ MP + +A + V +R GSR E   ++G+ H LEHM FKGT  RTA+ I EEIE 
Sbjct: 1   MTVVTDQMPHLKTAALGVWVRTGSRAETVHQNGITHLLEHMAFKGTKTRTARGIAEEIEA 60

Query: 71  VGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMS 130
           VGG++NA TS+EHT+Y+A +L E  PLA++I+ D+L NS+F+  ++ RE++V+L+EIG +
Sbjct: 61  VGGELNASTSIEHTNYYARILAEDTPLAVDILADILQNSTFDAQELTREQHVILQEIGAA 120

Query: 131 EDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVG 190
            D   D     F E  W +Q IGRPILG PET+  F  + + ++++  Y A  M +   G
Sbjct: 121 NDSPDDQAFDLFQETAWPEQAIGRPILGTPETVQGFNRDALNAYLADRYRAPDMVLAAAG 180

Query: 191 AVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSR 250
           AV+HE  V+     F   +          A Y GGE ++ ++L E  +++GF G  Y+S 
Sbjct: 181 AVEHEALVALAREKFGGFNSEPAA-PESEARYRGGETLRPKELMEAQVLIGFEGQPYKSA 239

Query: 251 DFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMA 310
           D+Y   ILAS+LG GMSSRLFQE+REK GLCY+I + H  FSD G+  + +AT++E++ A
Sbjct: 240 DYYAIQILASVLGGGMSSRLFQEIREKHGLCYAIYSFHWAFSDTGLFGLHAATSQEDLAA 299

Query: 311 LTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSE 370
           L   IVE + +  + I   E+ +  A+I A L+ + E    RA +I++Q++    +L  +
Sbjct: 300 LMPMIVEELIAATQTITDEEVARSRAQIRAGLMMALESPAARAGQIARQILVHNRVLDPD 359

Query: 371 KIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTSELIHALEG 420
           +I   I A+T  DI  VA + F  T PTL  +GP +D + T  EL   L+ 
Sbjct: 360 EISSKIEAVTAADIRRVAHQTFVGTVPTLTAIGP-VDGIMTADELAGRLQQ 409


>gi|239982655|ref|ZP_04705179.1| putative protease [Streptomyces albus J1074]
 gi|291454496|ref|ZP_06593886.1| protease [Streptomyces albus J1074]
 gi|291357445|gb|EFE84347.1| protease [Streptomyces albus J1074]
          Length = 458

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 130/416 (31%), Positives = 219/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   + +  GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 33  TVRRTTLPGGLRVVTETLPSVRSATFGIWVNVGSRDETPTLNGATHYLEHLLFKGTAKRS 92

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 93  ALDISAAVDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 152

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   ++I  F  R+Y 
Sbjct: 153 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALGRDQIARFYKRHYD 212

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
             R+ V   G VDH   V QV + F+               +   +     G   +  R 
Sbjct: 213 PTRLVVAAAGNVDHARVVRQVRAAFDRAGALERTDAEPTAPRAGSRTLRANGKIEVVNRR 272

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +  ++L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 273 TEQAHVILGMPGLARTDDRRWAMSVLNAALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 332

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + ++        E+ +   ++    +   E +  
Sbjct: 333 DCGLFGVYAGCRPSQVDDVLRICRDELDAVAGGGLSDDEVSRAIGQLAGSTVLGLEDTGA 392

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  ISA+T +++  VA+ I    P+L+++GP  D 
Sbjct: 393 LMNRIGKSELCWGEQMSVDDMLAKISAVTPDEVREVARDILGQRPSLSVIGPLKDK 448


>gi|258516320|ref|YP_003192542.1| peptidase M16 domain-containing protein [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257780025|gb|ACV63919.1| peptidase M16 domain protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 422

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 128/404 (31%), Positives = 234/404 (57%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G  ++TE +P + S  + + +  GSR+E +E +G++HF+EH++FKGT +RTA
Sbjct: 2   YQKVILDNGAKILTEEVPYVRSVAIGIFVDVGSRDELKENNGISHFIEHLMFKGTKRRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E ++ VGG +NA+T+ E+T Y+A V+ EH+ LA++++ DM+ NS+F  +DI+RERN
Sbjct: 62  KQIAETLDAVGGQLNAFTTKEYTCYYAKVIDEHLGLAIDLLTDMVFNSNFAAADIDRERN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M ED   + +   F   +W+D ++GRPI+G  + I + T ++I+ F  + Y  
Sbjct: 122 VILEEIKMYEDAPDEQVHDVFVRSLWQDHVLGRPIIGDADIIQNMTSDQIMDFYKKYYVP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             + +  VG + H+  V+ +       +  +  + +           +++D  + H+  G
Sbjct: 182 GNLVISVVGNIKHDQVVNALNGLMAGLTGERPDKVLSLPKPFQEIICREKDTEQVHLCFG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G      D Y+  +L ++LG G+SSRLFQEVRE+RGL YSI ++H ++ D+G+  I +
Sbjct: 242 TQGLKLTHDDIYIMQVLNTVLGGGISSRLFQEVREQRGLVYSIYSYHSSYHDSGIFCIYA 301

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             +K N+  +   +V+ ++      + + E+ +   ++   L+ S E   +R   + K  
Sbjct: 302 GLSKLNVEQVLELVVKELRDIQKSGLTEDELRRTKDQLKGNLLLSLESINVRMSRLGKSE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
            + G +   E+I++ ++ +T EDI  +A+ I      +LA +GP
Sbjct: 362 FYLGRLTTPEEIVEKVNLVTNEDIQRIARDILEPKNFSLATIGP 405


>gi|268316874|ref|YP_003290593.1| peptidase M16 domain-containing protein [Rhodothermus marinus DSM
           4252]
 gi|262334408|gb|ACY48205.1| peptidase M16 domain protein [Rhodothermus marinus DSM 4252]
          Length = 418

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 122/408 (29%), Positives = 212/408 (51%), Gaps = 5/408 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + +    G+ V+TE +P + S  V + +  GSR+E +EE G+ HF+EHM+FKGT +R 
Sbjct: 11  TYQKTVLPCGLRVVTETIPSVRSVAVGLWVDVGSRDEAEEEAGITHFIEHMVFKGTERRR 70

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
             +I + IE VGG +NA+T+ EHT Y+  VL E++  AL+ + D+     F   +IE+E+
Sbjct: 71  THQIAQRIEYVGGYLNAFTTKEHTCYYVRVLDEYLDRALDTLIDLAFRPRFPEREIEKEK 130

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M ED   +++   F E+V+    +GRPI+G+ ET+ SFT   ++ F++R+YT
Sbjct: 131 EVILEEMKMYEDTPDEYIFDLFEELVYAGHPLGRPIVGREETVRSFTRAMLLDFMARHYT 190

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE--YIQKRDLAEEHM 238
            DRM +   G + HE  V+  E      +        +  V        I++R + + H+
Sbjct: 191 PDRMVLAAAGRLRHERVVALTERLLRGVAPRPTNNRQRQPVPAYRPGERIERRSVQQAHL 250

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LG  G            +L ++LG GMSSRL Q +RE+ G CY+I +     +D G   
Sbjct: 251 VLGGRGYDLHHPRRAALTVLNTLLGGGMSSRLNQNIRERYGYCYNIYSFVNLHADVGDWG 310

Query: 299 IASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           +   T    +      I   + + + E + +R +     ++   L+  QE    R + + 
Sbjct: 311 VYMGTDPRRVARAEQLIRRELERLVQEPVGRRVLTHAKNQVKGTLMLGQENMSSRMMRLG 370

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTL-AILGPP 404
           +Q ++ G     ++ +     +T E++  VA+++F+  P    +L P 
Sbjct: 371 RQELYFGRYYSLDEALQEADRVTAEEVQAVARELFAEQPYSKVVLLPE 418


>gi|58617499|ref|YP_196698.1| putative protease [Ehrlichia ruminantium str. Gardel]
 gi|58417111|emb|CAI28224.1| Hypothetical zinc protease [Ehrlichia ruminantium str. Gardel]
          Length = 421

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 143/418 (34%), Positives = 247/418 (59%), Gaps = 5/418 (1%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            I++ S+  T+IT+ MP ++S  + + +  GSR+E     G++HFLEHM FKGT  RTA 
Sbjct: 4   NITQLSNSFTIITDTMPYVESVSINIWVNVGSRHENTNIAGISHFLEHMAFKGTKTRTAL 63

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I +  + +GG+ NA+T  EHT YH  +LK  + +A+E++ D++ NS F   +I+RE+ V
Sbjct: 64  DIAQIFDNIGGNFNAHTDREHTVYHVKILKRDIKIAIEVLADIILNSQFPQEEIDREKGV 123

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VL+EI  + D     +  ++ E  + +Q+ G+ ILG PE++S+ + E + +++  +Y A 
Sbjct: 124 VLQEIYQTNDSPTSIIFDKYIEAAYPNQVFGKSILGTPESVSNLSKENLHTYMQEHYHAG 183

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            M +   G + H   +     YF+    +   +    +VY+ GEY ++RDL + H+++GF
Sbjct: 184 NMLLSVAGNITHNEVIDLATQYFSQIKKS-TPQETNKSVYISGEYREERDLEQVHIVIGF 242

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              +Y+   FY+  IL SILG+GMSSRLFQ++RE+ GL YSIS+ + ++SDNG+  I +A
Sbjct: 243 PSSSYKDDQFYVIQILDSILGNGMSSRLFQKIREQLGLVYSISSFNSSYSDNGIFSIYTA 302

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T K N+  L  +I   VQS+  N+E+ E+ +   K+ ++++ S+E +  RA  +      
Sbjct: 303 TDKNNLPQLLDAIAAEVQSIYINLEENEVIRAKDKLTSEILMSRESTTARAESLGYYYSH 362

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSELIHAL 418
               +  E+++  IS IT EDI+    ++  S    TLA +G  ++ +P+  ++    
Sbjct: 363 YNRYITKEELLKKISEITMEDILNCISRLLRSNNKITLAAIG-QIETLPSYKDICQMF 419


>gi|89055639|ref|YP_511090.1| processing peptidase [Jannaschia sp. CCS1]
 gi|88865188|gb|ABD56065.1| processing peptidase [Jannaschia sp. CCS1]
          Length = 419

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 151/421 (35%), Positives = 230/421 (54%), Gaps = 7/421 (1%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +    +G+ ++TE MP  +SA + + + AG R+ER E++G+AHFLEHM FKGT +R
Sbjct: 1   MTVELHTLENGLRIVTEYMPGLESAALGIWVSAGGRHERLEQNGIAHFLEHMAFKGTQRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I EEIE VGG INAYTS E T+Y+A VLK  V LAL++IGD++ N  F+P +IE E
Sbjct: 61  SALQIAEEIEDVGGYINAYTSREVTAYYARVLKNDVALALDLIGDIVLNPIFDPREIEVE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+L+EIG + D   D +        + +Q +GR ILG  E + SF       FV+ NY
Sbjct: 121 RGVILQEIGQAADTPDDIIFDWLQAAAYPEQPLGRTILGPAERVQSFGRGDFDRFVAENY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              ++ +   GAVDH+  V   E  F     A      +P  + GGE+   + L + H  
Sbjct: 181 GPGQLILSAAGAVDHDEIVRLAEKAFGHLKPAPQAVP-QPGQFGGGEHRVVKGLEQAHFT 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L      Y+S D Y   I A+ LG GMSSRLFQE+REKRGLCY+I +   ++ D G+L I
Sbjct: 240 LALEAPGYRSDDIYTAQIFATALGGGMSSRLFQEIREKRGLCYTIYSQVGSYDDTGLLTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E++  L    V+ ++   + + + E+ +  A++ A L+   E    RA  +++ 
Sbjct: 300 YAGTSAEDLPDLVGLTVDELKRSADTMTEAELARARAQMKAGLLMGLESPSARAERLARL 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDI--VGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +     I   E+ ++ I A+T   +     A        T   L  P++  P  + +   
Sbjct: 360 IAIWNRIPPLEESVERIDAVTLRGLGDHAAA---LGQAGTAMALYGPVEKAPDLARVRER 416

Query: 418 L 418
           L
Sbjct: 417 L 417


>gi|397699|dbj|BAA03007.1| mitochondrial processing protease [Rattus norvegicus]
          Length = 487

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 94/431 (21%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   I +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 57  QVTCLENGLRVASENSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 116

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 117 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLREAEIERERGVI 176

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 177 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 236

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   +   + +F          +              ++   +   H+ +
Sbjct: 237 IVLAAAGGVCHNELLELAKFHFGDSLCAHKGDVPALPPCKFTGSEIRVRDDKMPLAHLAV 296

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 297 AIEAVGWTHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 356

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +     +  +  +  ++ +    L   + + E+ +    +   ++   + S   
Sbjct: 357 DTGLWGLYMVCEQATVADMLHAVQKEWMRLCTAVSESEVARAKNLLKTNMLLQLDGSTPI 416

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E +  V  K     +P +A LGP ++ +P  
Sbjct: 417 CEDIGRQMLCYNRRIPIPELEARIDAVDAEMVREVCTKYIYGKSPAIAALGP-IERLPDF 475

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 476 NQICSNMRWTR 486


>gi|325290351|ref|YP_004266532.1| processing peptidase [Syntrophobotulus glycolicus DSM 8271]
 gi|324965752|gb|ADY56531.1| processing peptidase [Syntrophobotulus glycolicus DSM 8271]
          Length = 440

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 123/417 (29%), Positives = 223/417 (53%), Gaps = 3/417 (0%)

Query: 3   LRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G+ V+TE    + SA + + + AGSR E+    G++HF+EHM FKGT KRTA
Sbjct: 23  YQKVVLPNGVRVLTEEIDYLRSAAIGIWVGAGSRYEKSGYEGISHFIEHMFFKGTKKRTA 82

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +++ E +E VGG +NA+T+ E T Y+A VL E + LA++++ DM  +S F+P +IE+E+N
Sbjct: 83  RQLAESLESVGGQLNAFTTKEMTCYYAKVLDEDIDLAIDVLSDMFFHSLFDPKEIEKEKN 142

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEE+ M  D   + +   FS+ +W +  +G PILG   +I S   +KI+ ++   Y  
Sbjct: 143 VVLEEVKMYLDTPDELIHDLFSQYIWNEHPLGMPILGDEGSIKSLDRDKIMDYLETQYCP 202

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D++ +   G + H+     +E + +     ++     P   V       +D  + H++LG
Sbjct: 203 DKIVISAAGKIKHDHIGKSLEQFGSFERQKEVSVYCHPVAKV-IRTSMPKDTEQMHLVLG 261

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G      D Y  +++ +ILG G+SSRLFQE+RE+RGL YS+ ++H  + D G+  + +
Sbjct: 262 VPGIGQNDEDMYALHVINNILGGGLSSRLFQEIREQRGLAYSVYSYHATYVDTGLFAVYA 321

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             +  NI  +   I+  +  +  + + + E+ +  A+I   L    E S      + K  
Sbjct: 322 GASPGNIEEVIKCILHEINGIRSKGLSEEELRRVVAQIKGNLYLGMESSSSIMSRLGKTE 381

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           +    +  +E+ ++ +  +T +DI  V ++++       +     +  P   ++I+A
Sbjct: 382 LSFDRVKTAEETVEKLEKVTLKDIDRVMERLWHKDKVSMLTIGSKEFTPDFDQIINA 438


>gi|322418696|ref|YP_004197919.1| peptidase M16 domain-containing protein [Geobacter sp. M18]
 gi|320125083|gb|ADW12643.1| peptidase M16 domain protein [Geobacter sp. M18]
          Length = 418

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 133/403 (33%), Positives = 226/403 (56%), Gaps = 3/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +  +SGI VITE +P   S  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R++
Sbjct: 2   IKKTTLNSGIRVITERIPYASSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTDRRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++++ D+  +S+F+  +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPRAVDLLTDIFLHSTFDNEEIEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D +   F +  WK   +G  ILG  E+++  + + II++  + Y A
Sbjct: 122 VVLQEINMMEDTPDDLIHDLFHQHFWKGHPLGMSILGDAESVTGLSRDAIIAYKDQMYRA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + V   G V H+   + +E + +       +    P VY     + ++DL + H+ LG
Sbjct: 182 DDIIVTAAGNVAHDKLTALLEEFLHGVEPGHGRCESAPPVYERRIELVEKDLEQIHVCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK GL YS+ ++  + +D G L + +
Sbjct: 242 LKGVQQSHPQRYDAFIMNAILGGSMSSRLFQEVREKSGLAYSVYSYIASHADAGSLVVYA 301

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             + EN   L   ++  + +   E +   +++    ++   L+ S E S  R   ++K  
Sbjct: 302 GASPENSKELLEIMLREIGRFKTEPVPADQLEGAREQLKGNLLLSLESSDNRMSRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILG 402
           ++ G+ L    I++    +T E I  +A++I  +   TL +LG
Sbjct: 362 IYFGTPLPLTDIMEGFDRVTSESIQQLAREILDNSALTLVMLG 404


>gi|290957008|ref|YP_003488190.1| M16 family endopeptidase [Streptomyces scabiei 87.22]
 gi|260646534|emb|CBG69631.1| putative M16 family endopeptidase [Streptomyces scabiei 87.22]
          Length = 459

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 124/416 (29%), Positives = 220/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTGRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++ + DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDTVCDMLTGSLIREEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRIRRFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V C G VDH   V QV + F           +    ++  +     G   +  R 
Sbjct: 214 PTHLVVACAGNVDHNKVVRQVRAAFESAGALTRADATPIAPRDGRRALRTAGRVELVGRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   EI++   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDQVAEHGLPDDEIERAIGQLRGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  ++++  ++A+T +++  VA+++    P+L+++GP  D 
Sbjct: 394 IMNRIGKSELCWGEQMSVDEMLARMAAVTPDEVREVAREVLGRRPSLSVIGPLKDK 449



 Score = 37.6 bits (85), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 40/99 (40%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++    MF  +         +DT++A+T + I 
Sbjct: 146 EEDVDVERGAILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              +K +  T  +      +DH     ++  A E   ++
Sbjct: 206 RFYRKHYDPTHLVVACAGNVDHNKVVRQVRAAFESAGAL 244


>gi|284030887|ref|YP_003380818.1| peptidase M16 domain-containing protein [Kribbella flavida DSM
           17836]
 gi|283810180|gb|ADB32019.1| peptidase M16 domain protein [Kribbella flavida DSM 17836]
          Length = 437

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 125/414 (30%), Positives = 221/414 (53%), Gaps = 9/414 (2%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +   SG+ V+++ +P   S    V +  GSR+E  +  G  HFLEH+LFKGT +R A
Sbjct: 18  VKRTVLPSGLRVLSQSVPGFRSVTFGVWVGVGSRDEPVQLSGATHFLEHLLFKGTERRDA 77

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   ++ VGG++NA+T  E+T Y+A VL   +PLA+++I DM+++++  P D+E ER+
Sbjct: 78  LEISASLDAVGGEMNAFTGKEYTCYYARVLDSDLPLAVDVICDMITSATLTPEDVESERD 137

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+ EEI M  D++ D +   F+E +W    +GR I G PE+++  T  +++ +  R YT 
Sbjct: 138 VIDEEIAMHADETSDHIHDLFAEQLWGSSPLGRSITGTPESVAGLTRRQVVGWYRRRYTP 197

Query: 182 DRMYVVCVGAVDHEFCVSQVE----SYFNVCSVAKIKESMKPAVYVGGE---YIQKRDLA 234
           D + V   G V+H   V  V      ++     A           V       + +RD+ 
Sbjct: 198 DNIVVSVAGNVEHADVVRLVRKAFERHWVSAESAPAPVRRGSGRRVPTYGGVRVHRRDVE 257

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + H++LG  G        Y+  +L  I+G GMSSRLFQEVREKRGL YS+      ++D+
Sbjct: 258 QAHLVLGMPGLVRNDDRRYVAGVLHGIVGGGMSSRLFQEVREKRGLAYSVFTFGSAYADS 317

Query: 295 GVLYIASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G++ + +    +    +   I   + +     I   E+ +   ++   ++   E +  + 
Sbjct: 318 GMVGVYAGCLPKKAPEVLDVIRGELATLAAGGITPDELLRGKGQMRGSVVMGLEDTGAKM 377

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
             I+K  +  G +   ++I+  I A+T +D+  +A ++++ TP L ++GP  ++
Sbjct: 378 TRIAKAELVYGELPTVDEILGRIDAVTLDDVHALAAELYAGTPALTVMGPFAEN 431


>gi|159899139|ref|YP_001545386.1| peptidase M16 domain-containing protein [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159892178|gb|ABX05258.1| peptidase M16 domain protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 422

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 120/413 (29%), Positives = 212/413 (51%), Gaps = 6/413 (1%)

Query: 8   TSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT-AKEIV 65
             +G+ + T+ MP   S  + +  + GSR E     G++HFLEHM FKGT K   AK++ 
Sbjct: 8   LPNGLRIYTDEMPHTHSVSMGIFTQVGSRYENARLTGISHFLEHMFFKGTAKYPTAKDLS 67

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           E IE +GG INA TS + T Y+  V   H    ++++ DML+ + F+P +IE+ER V+ E
Sbjct: 68  EAIEGIGGYINATTSYDTTCYYCKVANIHTERGIDVLTDMLNAALFDPKEIEKERGVIQE 127

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI MS D    ++     E++W DQ +GR I G  E++ +F+ E ++++  ++Y A    
Sbjct: 128 EIKMSLDVPAQWVHQLLDELMWGDQPLGRDIAGTLESVGAFSREDLLNYRDQHYVAGNTV 187

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--KRDLAEEHMMLGFN 243
           +   G  +    V ++ S F+   V  + + +    +     +    +   + + +LG  
Sbjct: 188 ISLAGNFNSTEIVDRLTSLFSHYRVLDVPKPITTNSFGTAPVVHLLNKPTEQTNFVLGLK 247

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
              Y   D +  ++L SILG GMSSRLFQE+RE+RGL YS+ ++   + D G   +    
Sbjct: 248 SFGYGDSDRWALSVLDSILGGGMSSRLFQEIREERGLAYSVGSYTAEYDDAGKWIVYGGV 307

Query: 304 AKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
                +   ++I+E ++ L    +   E+ +   ++   ++   E ++  A   ++  + 
Sbjct: 308 EVSKAVDAIAAIIEELRKLRDHGVTAAELHRIKEQVKGGMLLGLEDTWSVANRNARHELR 367

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHVPTTSEL 414
            G ++  E+I+  I A+T EDI  VA+++       LAI+GP  +       +
Sbjct: 368 YGEVIPVEQIVAWIEAVTLEDIQRVAQRLIRPDNLYLAIIGPHAEAAEFEQAI 420


>gi|195998121|ref|XP_002108929.1| hypothetical protein TRIADDRAFT_63547 [Trichoplax adhaerens]
 gi|190589705|gb|EDV29727.1| hypothetical protein TRIADDRAFT_63547 [Trichoplax adhaerens]
          Length = 473

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 105/429 (24%), Positives = 199/429 (46%), Gaps = 12/429 (2%)

Query: 5   ISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           ++   +G+ + +E     +A + + I AGSR E  + +G+AHFLEHM+FKGT +R+   +
Sbjct: 45  VTTIDNGLRIASEDSGSLTATIGLWIDAGSRFENDDTNGVAHFLEHMIFKGTKRRSQLAL 104

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
             EIE +GG +NAYTS E T Y A VL + +P A+EI+ D++ N     +++ERER V+L
Sbjct: 105 EVEIENMGGHLNAYTSREMTVYFAKVLSKDIPKAVEILADIVQNPLLGEAEMERERGVIL 164

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
            E+   +  + + +        ++   + R ILG  + I S T + ++ ++S +YTA R+
Sbjct: 165 REMQEVDTQTDEVVFDHLHSTAYQGTNLARTILGPSKNIRSITRDDLLDYISTHYTAPRI 224

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKES--MKPAVYVGGEYIQKRDLAEEHMMLGF 242
            +   G V H+  +   E  F     A  K S             ++  ++   H+ +  
Sbjct: 225 VLAGAGGVKHDDLLRLAEQNFKNIPTASDKFSGLTHCRYTGSEILVRDDNMPLAHIAIAV 284

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFSDN 294
            GC +   D++   +  +I+G+   S    +    R         L +S  + +  ++D 
Sbjct: 285 EGCGWTHPDYFPLLVANAIIGNWDRSFASGQNSGSRLARIVRENDLAHSYMSFNTCYTDT 344

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+      T +  I  +  S+ +    +   I + E+ +    +   L +  + S     
Sbjct: 345 GLWGAYFVTDRMKIDDMVFSLQKEWMRVCTGITENEVKRAKNMLKTTLFQQLDGSTQICE 404

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++  G  +   ++   I  +T   I  VA K      P +A +GP ++ +P  + 
Sbjct: 405 DIGRQILTYGRRIPLAEVDARIEQVTAGVIKSVASKYIYDQCPAVAAVGP-IEQLPDYNR 463

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 464 IRSGMYWLR 472


>gi|303239216|ref|ZP_07325745.1| peptidase M16 domain protein [Acetivibrio cellulolyticus CD2]
 gi|302593261|gb|EFL62980.1| peptidase M16 domain protein [Acetivibrio cellulolyticus CD2]
          Length = 417

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 128/404 (31%), Positives = 210/404 (51%), Gaps = 4/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           L+     +G+ +I E +P + S  V V +  GSRNE  E +G++HF+EHMLFKGT KR+A
Sbjct: 2   LKRITLDNGVRIICEKIPYVRSVSVGVWVGTGSRNETIEINGVSHFIEHMLFKGTNKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI E I+ +GG INA+T  E T Y+   L  H+ +AL+++ DM  NS+F+  DI+ ER 
Sbjct: 62  KEIAESIDSIGGQINAFTGKECTCYYTKTLDTHIDIALDLLTDMFFNSTFSKKDIDVERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEIGM ED   D +     E VW    +G PILG  + +     + II ++S +Y  
Sbjct: 122 VVIEEIGMYEDSPEDLVHDYLPETVWDGDALGMPILGTHDCLHKINRDTIIDYISGHYLP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-IKESMKPAVYVGGEYIQKRDLAEEHMML 240
               +   G  D    V  ++  F      K ++       +   + I+++D  + H+ L
Sbjct: 182 SNTVIAVAGNYDENSLVESIKRNFGSWHTDKTLENQFGKVSFKASKKIKEKDTEQMHICL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G  + + D Y    + ++ G GMSSRLFQ++RE+ GL YSI ++  ++ + G+  I 
Sbjct: 242 GFEGIEHGNDDLYPLLAVNNVFGGGMSSRLFQKIREEMGLVYSIYSYPSSYKNAGLYTIY 301

Query: 301 SATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +     +       ++  ++      I + E+ K   ++    I   E +  R   + K 
Sbjct: 302 AGMNPRHQDTFLRLVMNDIRILEKYGISEDELAKSKEQLKGSYILGLESTSSRMNSLGKS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
            +  G I   E++++ I A+  E +  V K++F     +LA +G
Sbjct: 362 ELMLGIINSPEEVLNKIDAVNNEKVNEVIKRVFQIEKISLAAVG 405


>gi|241043304|ref|XP_002407106.1| processing peptidase beta subunit, putative [Ixodes scapularis]
 gi|215492104|gb|EEC01745.1| processing peptidase beta subunit, putative [Ixodes scapularis]
          Length = 479

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 100/431 (23%), Positives = 194/431 (45%), Gaps = 17/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V TE     +  V V I AGSR E ++ +G+AHFLEHM FKGT+KR+  +
Sbjct: 45  RVTTLDNGVRVATEDSGNPTCTVGVWIDAGSRYENEKNNGVAHFLEHMAFKGTSKRSQTD 104

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T Y+A  L + +P A+EI+ D+L NS F  ++IERER V+
Sbjct: 105 LELEVENMGAHLNAYTSREQTVYYAKCLSKDMPRAVEILSDILQNSKFGEAEIERERGVI 164

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +      + ++   +G  ILG  E I S   + ++ ++S +Y   R
Sbjct: 165 LREMQEVETNLQEVVFDHLHSVAFQGTPLGLTILGPTENIKSIQRQDLVDYISLHYKGPR 224

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + +   G V+H+  V     +F               +          ++  D+   H+ 
Sbjct: 225 IVLAGAGGVNHDELVKLASQHFGSIKTDYDAKVPPLDLPCRFTGSEVRVRDDDMPYAHVA 284

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSR----------LFQEVREKRGLCYSISAHHE 289
           +    C +   D     +  +++G+   S             + V++    C+S  + + 
Sbjct: 285 IAVESCGWADPDNIPLMVANTLIGNWDRSHGGGANVSSRLAEECVKDPDNACHSFQSFNT 344

Query: 290 NFSDNGVLYIASATAKENIMAL-TSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
            + D G+  I   +     M     +I      +  +  + E+ +    +   ++   + 
Sbjct: 345 CYKDTGLWGIYFVSEGREEMDFLVHAIQREWMRICMSATEGEVTRAKNLLKTNMLLQLDG 404

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDH 407
           +     +I +Q++  G  +   ++   I A+T + +  V  K      P +A +GP ++ 
Sbjct: 405 TTPVCEDIGRQMLCYGRRIPLPELEARIDAVTAQTVRDVCTKYIYDRCPAVAGVGP-VEA 463

Query: 408 VPTTSELIHAL 418
           +   + +   +
Sbjct: 464 LTDYANVRSNM 474


>gi|116063388|gb|AAI23110.1| MGC78954 protein [Xenopus laevis]
          Length = 479

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 193/429 (44%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E Q  +G AHFLEHM FKGT  R+  +
Sbjct: 51  KVTALENGLRVASEDSGLLTCTVGLWIDAGSRYENQMNNGTAHFLEHMAFKGTKNRSQLD 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 111 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        + +  +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 171 LREMQEVETNLQEVVFDYLHATAYHNTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  +   + +F         E++ P  + G E   + D +   H+ +  
Sbjct: 231 IVLSAAGGVSHDELLHLAKFHFGNLPSIYDGETLPPCSFTGSEIRVRDDKMPLAHIAVAV 290

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFSDN 294
               +   D     +  +++G+   S            ++     LC+S  + +  ++D 
Sbjct: 291 EAVGWSHPDTIPLMVANTLIGNWDRSFGGGVNLSSKLAQLTCHGNLCHSFQSFNTCYTDT 350

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +   +      L  N+ + E+ +    +   ++   + S     
Sbjct: 351 GLWGLYMVCEPNTVEDMMHFVQREWIRLCTNVTENEVARAKNLLKTNMLLQLDGSTPICE 410

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I  I+ E I  V  K   + +P +A +GP +  +P    
Sbjct: 411 DIGRQMLCYNRRIPLPELEARIDLISAETIREVCTKYIYNKSPAVAAVGP-IGQLPDYDR 469

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 470 IRSGMYWLR 478


>gi|170055460|ref|XP_001863592.1| mitochondrial processing peptidase beta subunit [Culex
           quinquefasciatus]
 gi|167875415|gb|EDS38798.1| mitochondrial processing peptidase beta subunit [Culex
           quinquefasciatus]
          Length = 474

 Score =  205 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 98/431 (22%), Positives = 188/431 (43%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +++  SG+ V +E     +A V + I AGSR E    +G+AHFLEHM FKGT KR+  +
Sbjct: 44  EVTQLDSGLRVASEDSGSQTATVGLWIDAGSRYEDARNNGVAHFLEHMAFKGTAKRSQTD 103

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP A+E++ D++ NS    ++IERER V+
Sbjct: 104 LELEVENMGAHLNAYTSREQTVFYAKCLSKDVPKAVEVLSDIIQNSKLGEAEIERERGVI 163

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G  ILG  + I S     + +++  +Y A R
Sbjct: 164 LREMQEVESNLQEVVFDHLHATAYQGTPLGNTILGPTKNIQSIGKADLQAYIDSHYKAPR 223

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   V   ES           K               ++   L   H+ +
Sbjct: 224 IVLAAAGGVKHGDLVKLAESSLGKVGSTFDGKAPALTPCRFTGSEVRVRDDSLPLAHVAI 283

Query: 241 GFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHENFS 292
              GC +  +D     +  +++G           ++        +  LC+S  + +  + 
Sbjct: 284 AVEGCGWTDQDNVPLMVANTLIGAWDRSQGGGANNASKLAAAAAEDNLCHSFQSFNTCYK 343

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I           +  ++      L   +   E+D+    +   ++   + +   
Sbjct: 344 DTGLWGIYFVCDPLKCEDMVFNLQNEWMRLCTMVTDSEVDRAKNLLKTNMLLQLDGTTPI 403

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I  +  +++  VA K  F   P +A +GP ++++P  
Sbjct: 404 CEDIGRQMLCYNRRIPLHELEKRIDNVNAQNVRDVAMKYIFDRCPAIAAVGP-IENLPDY 462

Query: 412 SELIHALEGFR 422
             +  ++   R
Sbjct: 463 MRIRSSMYWVR 473


>gi|302542112|ref|ZP_07294454.1| M16 family peptidase [Streptomyces hygroscopicus ATCC 53653]
 gi|302459730|gb|EFL22823.1| M16 family peptidase [Streptomyces himastatinicus ATCC 53653]
          Length = 459

 Score =  205 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 124/416 (29%), Positives = 216/416 (51%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPSGLRILTETLPSVRSATFGIWAHVGSRDETPTLNGATHYLEHLLFKGTRRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S  + +D++ ER
Sbjct: 94  ALDISAAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSVIDAADVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   FS  +  D  +GRP+LG  +T++    ++I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFSHTMLGDTPLGRPVLGTVDTVNGLGRDQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH+  V QV   F           +    +   K     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHDTVVRQVSDAFEQAGALTRGDATPIAPRSGSKAIRTAGRVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L + LG GMSSRLFQEVREKRGL YS+ +++  F+
Sbjct: 274 TEQAHVILGMPGIPRTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYNSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + Q   + +   E+ +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDQVARDGLTDEELRRAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +     +  + ++  I ++T +++  VA+ +    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWADQMSVDDMLARIQSVTPDEVREVARDVLGQRPSLSVIGPLKDK 449


>gi|157109957|ref|XP_001650897.1| mitochondrial processing peptidase beta subunit [Aedes aegypti]
 gi|157109959|ref|XP_001650898.1| mitochondrial processing peptidase beta subunit [Aedes aegypti]
 gi|108878872|gb|EAT43097.1| mitochondrial processing peptidase beta subunit [Aedes aegypti]
 gi|108878873|gb|EAT43098.1| mitochondrial processing peptidase beta subunit [Aedes aegypti]
          Length = 473

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 99/431 (22%), Positives = 188/431 (43%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +++  SG+ V +E     +A V + I AGSR E    +G+AHFLEHM FKGT KR+  +
Sbjct: 43  EVTQLDSGLRVASEDSGSQTATVGLWIDAGSRYEDARNNGVAHFLEHMAFKGTAKRSQTD 102

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L   VP A+EI+ D++ NS    ++IERER V+
Sbjct: 103 LELEVENMGAHLNAYTSREQTVFYAKCLSRDVPKAVEILSDIIQNSKLGEAEIERERGVI 162

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G  ILG  + I S     + +++  +Y A R
Sbjct: 163 LREMQEVESNLQEVVFDHLHATAYQGTPLGNTILGPTKNIQSIGKSDLQAYIDSHYKAPR 222

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   V   +S           K  +            ++   L   H+ +
Sbjct: 223 IVLAAAGGVKHNDLVKLAQSSLGKVGSTFDGKAPQLSPCRFTGSEVRVRDDSLPLAHVAI 282

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              GC +  +D     +  +++G    S+        +         LC+S  + +  + 
Sbjct: 283 AVEGCGWTDQDNVPLMVANTLIGAWDRSQGGGTNNASKLAAAAAEDNLCHSFQSFNTCYK 342

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I           +  ++      L   +   E+D+    +   ++   + +   
Sbjct: 343 DTGLWGIYFVCDPLKCEDMVFNLQNEWMRLCTMVTDSEVDRAKNLLKTNMLLQLDGTTPI 402

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I  +  +++  VA K  F   P +A +GP ++++P  
Sbjct: 403 CEDIGRQMLCYNRRIPLHELEKRIDNVNAQNVRDVAMKYIFDRCPAIAAVGP-IENLPDY 461

Query: 412 SELIHALEGFR 422
             +  ++   R
Sbjct: 462 MRIRGSMYWLR 472


>gi|29829064|ref|NP_823698.1| protease [Streptomyces avermitilis MA-4680]
 gi|29606170|dbj|BAC70233.1| putative protease [Streptomyces avermitilis MA-4680]
          Length = 459

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 129/416 (31%), Positives = 216/416 (51%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPTLNGATHYLEHLLFKGTHKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D+  ER
Sbjct: 94  ALDISSALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILEEDVNVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  +  D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK--------RD 232
              + V C G VDH   V QV + F      K  ++   A   G   I+         R 
Sbjct: 214 PTHLVVACAGNVDHNKVVRQVRAAFEKAGALKQPDATPIAPRDGRRAIRTAGRVELLGRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDHVAEHGLSDDEIARAIGQLKGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+ +T +D+  VA+ I    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLARITEVTPDDVRSVARDILGQRPSLSVIGPLKDK 449



 Score = 38.0 bits (86), Expect = 3.1,   Method: Composition-based stats.
 Identities = 15/99 (15%), Positives = 39/99 (39%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + +++ E   I  ++  +++       ++    M   +         +DT++A+T + I 
Sbjct: 146 EEDVNVERGAILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              KK +  T  +      +DH     ++  A E   ++
Sbjct: 206 RFYKKHYDPTHLVVACAGNVDHNKVVRQVRAAFEKAGAL 244


>gi|193683602|ref|XP_001948008.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Acyrthosiphon pisum]
          Length = 477

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 109/430 (25%), Positives = 195/430 (45%), Gaps = 14/430 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V TE     +A V + I AGSR E    +G+AHF+EHMLFKGT  R+   
Sbjct: 46  KVTTLENGMRVATEDNGSQTATVGLWIDAGSRWETASNNGVAHFVEHMLFKGTPTRSQTA 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  LK  VP A+EI+ D+L NS+F  ++I+RER V+
Sbjct: 106 LELEIENIGAHLNAYTSREQTVFYAKSLKSDVPKAVEILSDILQNSNFGENEIDRERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  E I+S   +++  +V   Y   R
Sbjct: 166 LREMQEVETNLQEVVFDYLHATAYQGTPLGQTILGPTENINSLKRKELKEYVDLFYRPSR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV----AKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           + +   G VDHE  V   +S F   +     A +    K          +   +   H+ 
Sbjct: 226 LVLAGAGGVDHEELVCLAKSLFKNPTNLNMEADVPHYSKCRFTGSEIKARDDSIPLAHVA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +    C +   D     +  +I+G    S+        R         LC+S  + +  +
Sbjct: 286 IAVESCGWADADNIPLMVANTIIGSWDRSQGGGNNNANRLARFADSLDLCHSFQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+        K  I   T  + E    L  ++   E+++    +   ++   + S  
Sbjct: 346 KDTGLWGAYFVCDKMKIAEFTFHLQEEWMRLCASVTDAEVERAKNVLKTNMLLQLDTSTQ 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I+ ++ ++I  +A K  F   P +A +GP ++ +  
Sbjct: 406 VCEDIGRQLLCYNRRIPPHELEARINDVSAKNIHDIAMKYLFDRCPAVAAVGP-VEQLVD 464

Query: 411 TSELIHALEG 420
            + L  A+  
Sbjct: 465 YNRLRAAMRW 474


>gi|121601771|ref|YP_988730.1| M16 family peptidase [Bartonella bacilliformis KC583]
 gi|120613948|gb|ABM44549.1| peptidase, M16 family [Bartonella bacilliformis KC583]
          Length = 422

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 171/420 (40%), Positives = 255/420 (60%), Gaps = 3/420 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ IS+ S+G+T+ T  M  IDS  + + ++ GSRNE+  +HG+AH LEHM FKGT  R
Sbjct: 1   MSVDISRLSNGLTIATHTMQHIDSVALGIWVKVGSRNEKSTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  EIE VGG+INA TS+E T+Y A VLK  + LA++I+ D+++ S F+  ++ERE
Sbjct: 61  TAFKIASEIEDVGGEINATTSIETTAYFARVLKNDISLAIDILSDIMTCSKFDEEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++DQ +GR ILG P+TI S T + + SF++  Y
Sbjct: 121 KQVVFQEIGATCDVPDDIIFDHFTETAFRDQSLGRSILGTPKTIQSLTSDDLRSFMNEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VES  ++            A Y GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVQHESFLREVESRLSIFRPYSKTPLANFAHYTGGKFHEHRDLMDTQIV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y ++DFY   IL+ ILG GMSSRLFQE+REKRGLCYSI A H  FSD G+  I
Sbjct: 241 LGFEGYPYHTQDFYTAQILSIILGGGMSSRLFQEIREKRGLCYSIYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +  +  L   I++ +  + +NI   E+ +  A+  A LI SQE    +A  I++Q
Sbjct: 301 HTATGQRELETLFPVILDELSKVGQNIHISELQRAQAQYRANLIMSQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   +    +  +T + +  +A  +  +S PTLA +GP    +    +L    
Sbjct: 361 ILLYGRPIPISETTGHLDLVTPQRLTNLANNLITNSKPTLATVGPARSLI-NFDDLKSIF 419


>gi|148230160|ref|NP_001085137.1| peptidase (mitochondrial processing) beta [Xenopus laevis]
 gi|47939684|gb|AAH72067.1| MGC78954 protein [Xenopus laevis]
          Length = 479

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 98/429 (22%), Positives = 193/429 (44%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E Q  +G AHFLEHM FKGT  R+  +
Sbjct: 51  KVTALENGLRVASEDSGLLTCTVGLWIDAGSRYENQMNNGTAHFLEHMAFKGTKNRSQLD 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 111 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        + +  +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 171 LREMQEVETNLQEVVFDYLHATAYHNTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  +   + +F         E++ P  + G E   + D +   H+ +  
Sbjct: 231 IVLAAAGGVSHDELLHLAKFHFGNLPSIYDGETLPPCSFTGSEIRVRDDKMPLAHIAVAV 290

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFSDN 294
               +   D     +  +++G+   S            ++     LC+S  + +  ++D 
Sbjct: 291 EAVGWSHPDTIPLMVANTLIGNWDRSFGGGVNLSSKLAQLTCHGNLCHSFQSFNTCYTDT 350

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +   +      L  ++ + E+ +    +   ++   + S     
Sbjct: 351 GLWGLYMVCEPNTVEDMMHFVQREWIRLCTSVTENEVARAKNLLKTNMLLQLDGSTPICE 410

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I  I+ E I  V  K   + +P +A +GP +  +P    
Sbjct: 411 DIGRQMLCYNRRIPLPELEARIDLISAETIREVCTKYIYNKSPAVAAVGP-IGQLPDYDR 469

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 470 IRSGMYWLR 478


>gi|229544444|ref|ZP_04433502.1| peptidase M16 domain protein [Bacillus coagulans 36D1]
 gi|229324929|gb|EEN90606.1| peptidase M16 domain protein [Bacillus coagulans 36D1]
          Length = 412

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 137/410 (33%), Positives = 232/410 (56%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGT KR+A
Sbjct: 2   IQKYTCHNGLRIVLEEIPTVRSVAIGIWIGTGSRNENEKNNGISHFLEHMFFKGTEKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E  + +GG +NA+TS E+T ++A VL  H PLALEI+ DM  +S+F+  ++ERE++
Sbjct: 62  KDIAEAFDAIGGQVNAFTSKEYTCFYAKVLDTHAPLALEILSDMFFHSTFSEDEMEREKS 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +     + ++++  +G PILG  ET++SFT + +  +V   YT 
Sbjct: 122 VVNEEIKMYEDTPDDIVHDLLGKAIYENHPLGYPILGTEETLASFTSDDLHQYVYDMYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ V   G V     V ++E+ F      K +   + AV+   +  +K++  + H+ LG
Sbjct: 182 DRVVVSVAGNVLPS-FVKEIEALFGSYEGGKEETGGETAVFHTNDLARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G    S D Y   +L +ILG  MSSRLFQ VRE+RGL YS+ ++H  + D+G+L I  
Sbjct: 241 FEGKKIGSDDIYELIVLNNILGGSMSSRLFQNVREQRGLAYSVYSYHTAYKDSGILTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  ++ E +Q+   + + ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGASQLDELFETVQETLQTLKAKGVTEKEVRNCKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +        +++++ I  +T E +   A++IFS   + +++ P    +P 
Sbjct: 361 LLLKKHRSLDEMLEEIDRVTVEKVNACAREIFSKPYSASLISPD-GKLPE 409


>gi|163852668|ref|YP_001640711.1| processing peptidase [Methylobacterium extorquens PA1]
 gi|163664273|gb|ABY31640.1| processing peptidase [Methylobacterium extorquens PA1]
          Length = 431

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 145/418 (34%), Positives = 240/418 (57%), Gaps = 3/418 (0%)

Query: 5   ISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S+  +G+TV TE +P   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+A++
Sbjct: 16  VSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRSARK 75

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+ V+
Sbjct: 76  IAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREKGVI 135

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y  +R
Sbjct: 136 LQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYVPER 195

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAV+H   V   E +F               VY GGE   ++ L + +++LG  
Sbjct: 196 MVLAAAGAVEHAEIVEAAERHFGGLKPVAAP-PAVAGVYGGGERRMQKRLEQANLVLGLP 254

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I + T
Sbjct: 255 GLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIGAGT 314

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
           +  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q++  
Sbjct: 315 SGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQLLAW 374

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
           G ++  +++I  + A+  E +    + +    PTLA +GP +  +P+ + +  AL+  
Sbjct: 375 GRVIPPQELIAKVDAVEVEHVRAAGRTLLRGAPTLAAIGP-VKGLPSLARVASALQAA 431


>gi|157803431|ref|YP_001491980.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           canadensis str. McKiel]
 gi|157784694|gb|ABV73195.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Rickettsia
           canadensis str. McKiel]
          Length = 413

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 156/406 (38%), Positives = 242/406 (59%), Gaps = 3/406 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +S   +G+T++T  MP ++S  + + ++ GSR E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFHVSTLKNGLTILTYNMPYVNSVAINLIVKVGSRYENPEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE +++GG  NAYT  E T Y+A VL E+   AL I+ D++ NS F+  DI +E 
Sbjct: 64  AKQIAEEFDEIGGHFNAYTGHEKTVYYARVLSENCNKALNILADIIQNSIFSEEDIVKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  S+D+  D +  +F   V+KDQ +G+ ILG  +T++SFT E  +SF+ ++Y 
Sbjct: 124 QVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGKSILGTSKTLASFTKEHFLSFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  +Y+   G VDH   V   E  F+      IK S  PA Y+GG    K+DLA+  ++L
Sbjct: 184 ARNLYLSVAGNVDHNKIVCTAEQLFSSLKQG-IKSSFLPAKYIGGNSFIKKDLAQTTLIL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G  Y      Y T + A I G GMSSRLFQ +RE+ GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTPYINLERLYRTQLFAIIFGGGMSSRLFQHIRERLGLAYAVGSYNSTYIDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   +   +  + E + + E+ +   ++ + L+ +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLCKELKNEITKMTEKVNEEEMIRAKTQLRSNLLMAQEKVAYKSEEIGKH 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPM 405
               G  +  E+I++ I+ I  +DI+  A KIFS T T AI+GP +
Sbjct: 363 YAAFGKYISPEEIMEIITNIKADDIINTANKIFSGTTTSAIIGPSI 408


>gi|332373534|gb|AEE61908.1| unknown [Dendroctonus ponderosae]
          Length = 475

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 111/431 (25%), Positives = 199/431 (46%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++  S+GI V TE     +A V + I AGSR E ++ +G+AHF+EHM FKGT KRT  +
Sbjct: 45  KVTTLSNGIRVATEDWGSQTATVGIWIDAGSRYENEKNNGVAHFMEHMAFKGTGKRTQSQ 104

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y++  L + VP A+EI+ D++ N+    ++IERER V+
Sbjct: 105 LELEIEDLGAQLNAYTSREQTVYYSKCLAKDVPKAVEILSDIVQNAKLGEAEIERERGVI 164

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +      + ++   +   ILG    I S     +  ++  +Y A R
Sbjct: 165 LREMQEVESNLQEVVFDHLHSVAYQGTPLANTILGPTANIRSINATDLRYYLDNHYKASR 224

Query: 184 MYVVCVGAVDHEFCVSQVES---YFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + V   G V HE  V   ES     N     +I +            ++   L   H+ +
Sbjct: 225 IVVSGAGGVCHEDLVKLAESSLGQLNNTYTGEIPKLTSCRFTGSEVRVRDDTLPLAHIAM 284

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              G  +   D     + +++LG    S+   +              LC+S  + +  + 
Sbjct: 285 AVEGAGWSDPDTLSLMVGSTLLGAWDRSQASAKQNATNLARASGEEDLCHSFQSFNTCYK 344

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        I  +  +I E    L  ++ + E+++  A + A  +   + S   
Sbjct: 345 DTGLWGIYFVCDPLKIEDMVFNIQEEFMRLCTSVTEGEVERAKALLTANTLLQLDTSTAV 404

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++  G  L   ++   I++IT  ++  V  K      P +A +GP ++++P  
Sbjct: 405 CEDIGRQLLCYGRRLPPHELTHRINSITARNVRDVMYKYLYDRCPAIAAVGP-VENLPDY 463

Query: 412 SELIHALEGFR 422
           + +  ++   R
Sbjct: 464 NNIRSSMYWIR 474


>gi|120403342|ref|YP_953171.1| peptidase M16 domain-containing protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119956160|gb|ABM13165.1| peptidase M16 domain protein [Mycobacterium vanbaalenii PYR-1]
          Length = 451

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 136/408 (33%), Positives = 213/408 (52%), Gaps = 7/408 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++   G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RTA
Sbjct: 28  VRRTQLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N    P D+E ER+
Sbjct: 88  VQIAQAVDAVGGELNAFTAREHTCYYAHVLDSDLELAVDLVADVVLNGRCAPGDVEVERD 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+IS+ T  ++ SF  R YT 
Sbjct: 148 VVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVIGSVESISAMTRSQLHSFHVRRYTP 207

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQ--KRDLAEE 236
           DRM V   G V+H+  V  V  +F        A +          G   +    RD  + 
Sbjct: 208 DRMVVAVAGNVEHDMVVKLVREHFGPRLERGRAPVPPRKGAGRVGGQPTLHLVSRDAEQT 267

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L S LG G+SSRLFQ++RE RGL YS+ +  + F+++G 
Sbjct: 268 HLSLGVRTPGRHWDHRWALSVLNSALGGGLSSRLFQQIRETRGLAYSVYSTVDTFAESGA 327

Query: 297 LYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L I +    E    +     +V+ +   + I   E       +   L+   E S  R   
Sbjct: 328 LSIYAGCLPERFDEVVRVTTDVLTEVARDGITADECRIAKGSLRGGLVLGLEDSASRMNR 387

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           I +  +  G      + +  I  +T ED+  VA+++ +     A+LGP
Sbjct: 388 IGRSELNYGKHRSIAETLARIDEVTLEDVNAVARQLLTKPFGAAVLGP 435


>gi|122065519|sp|Q03346|MPPB_RAT RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP; AltName: Full=P-52; Flags:
           Precursor
 gi|51259291|gb|AAH78826.1| Peptidase (mitochondrial processing) beta [Rattus norvegicus]
 gi|149046592|gb|EDL99417.1| peptidase (mitochondrial processing) beta, isoform CRA_c [Rattus
           norvegicus]
          Length = 489

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 94/431 (21%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   I +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  QVTCLENGLRVASENSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   +   + +F          +              ++   +   H+ +
Sbjct: 239 IVLAAAGGVCHNELLELAKFHFGDSLCAHKGDVPALPPCKFTGSEIRVRDDKMPLAHLAV 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AIEAVGWTHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +     +  +  +  ++ +    L   + + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEQATVADMLHAVQKEWMRLCTAVSESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E +  V  K     +P +A LGP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVDAEMVREVCTKYIYGKSPAIAALGP-IERLPDF 477

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 478 NQICSNMRWTR 488


>gi|49475244|ref|YP_033285.1| processing protease protein [Bartonella henselae str. Houston-1]
 gi|49238049|emb|CAF27256.1| Processing protease protein [Bartonella henselae str. Houston-1]
          Length = 426

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 175/421 (41%), Positives = 259/421 (61%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+  +G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLRNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS E T+Y A VLK  +PLA++I+ D+L +S F+  ++ERE
Sbjct: 61  TAFQIASDIEDVGGEINATTSTETTAYFARVLKNDIPLAIDILADILMHSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV +EIG + D   D +   F+E  ++ Q +GR ILG P+T+ SFT   + SF++++Y
Sbjct: 121 KQVVFQEIGAARDVPDDVVFDYFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMNKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV HE  + +VES  +       +     A YVGG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVQHENFLQEVESRLSTFRPHSTEPLTNLANYVGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI A H  FSD G+  +
Sbjct: 241 LGFEGRPYHARDFYAAQILSIILGGGMSSRLFQEVREKRGLCYSIYAFHWGFSDIGLFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +  + +NI   E+ +  A+  A L  +QE    +A  I++Q
Sbjct: 301 HAATGQEKLKELLPVILDELSKVSKNIHTNELQRARAQYRATLTMAQENPSSQANFIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++  G  +   + I+ +  IT   +  +A ++F ++TPTLA +GP +  +     L   L
Sbjct: 361 ILLYGREIPLSETIERLELITPARLTDLAGRLFINATPTLAAVGP-VGSLMNFDNLTSTL 419

Query: 419 E 419
            
Sbjct: 420 S 420


>gi|332026485|gb|EGI66611.1| Mitochondrial-processing peptidase subunit beta [Acromyrmex
           echinatior]
          Length = 477

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 107/432 (24%), Positives = 202/432 (46%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E     +A V + I +GSR E  + +G+AHF+EHM FKGT KR+  +
Sbjct: 46  RVTTLDSGMRVASEDSGAATATVGLWIDSGSRYETDDNNGVAHFMEHMAFKGTAKRSQTD 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVFYAKCLSQDVPKAIEILSDIIQNSKLGENEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  + I + + + ++ +V  +Y   R
Sbjct: 166 LREMQEVETNLQEVVFDHLHAAAYQGTALGRTILGPTKNIKNISRDDLVKYVKNHYGPSR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAK---IKESMKPAVYVGGEYIQKRD-LAEEHMM 239
             +   G VDH   +   + YF   +  +   I + +K   Y G E   + D +   H+ 
Sbjct: 226 FVLAGAGGVDHNQLIELADKYFGKMTGPEYDVIPDYIKACRYTGSEIRIRDDSIPLAHIA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENF 291
           +   G  +   D     +  +++G    S+           +   + GLC+S  + +  +
Sbjct: 286 IAVEGAGWAEADNIPLMVANTLIGGWDRSQGGGVNNASNLAKACAEEGLCHSYQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  I           +   I +    L   + ++++ +    +   +    + +  
Sbjct: 346 KDTGLWGIYFVCDPMKCEEMVFCIQQEWMKLCTTVTEKDVTRAKNILKTNMFLQLDGTTA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I ++T E I  V  K IF   P +A +GP ++++  
Sbjct: 406 ICEDIGRQMLCYNRRIPLHELEMRIDSVTAETIQNVGMKYIFDHCPVVAAVGP-VENLTD 464

Query: 411 TSELIHALEGFR 422
            + +  A+  FR
Sbjct: 465 YNNIRGAMYWFR 476


>gi|261751828|ref|ZP_05995537.1| processing peptidase [Brucella suis bv. 5 str. 513]
 gi|261741581|gb|EEY29507.1| processing peptidase [Brucella suis bv. 5 str. 513]
          Length = 460

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 159/388 (40%), Positives = 251/388 (64%), Gaps = 1/388 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 61  MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 120

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 121 TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 180

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 181 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 240

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 241 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 300

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 301 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 360

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 361 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 420

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGV 387
            +  G  + + +++D +S IT E +   
Sbjct: 421 FLLYGRPVENSELLDRLSLITPERLTDA 448


>gi|254701287|ref|ZP_05163115.1| Insulinase-like peptidase, family M16 [Brucella suis bv. 5 str.
           513]
          Length = 400

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 159/388 (40%), Positives = 251/388 (64%), Gaps = 1/388 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + +++  +G+T+ T+ MP ++S  + + ++AG+RNE  + HG+AH LEHM FKGT  R
Sbjct: 1   MGVEVTRLPNGLTIATDTMPHVESVALGIWVKAGARNEAPDRHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA TS+E TSY+A VL+  +PLA++I+ D+L+ S F+  ++ERE
Sbjct: 61  TAWQIASDIENVGGEINAATSVETTSYYARVLRNDMPLAIDILSDILTASKFDEGELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +  RF+E  ++ Q IGR ILG+PET+ SFT + +  ++   Y
Sbjct: 121 KQVIMQEIGAAHDTPDDIVFDRFTETAYRHQPIGRAILGEPETVMSFTSDDLRQYMQEQY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM V   G +DH+  V +VE             ++  A YVGG++ + R+L +  ++
Sbjct: 181 SADRMVVTAAGGIDHDEFVREVEKRLGSFRPHNTAPTLDLAHYVGGDFRENRELMDAQVL 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF G AY  RDFY + +L+ ILG GMSSRLFQEVREKRGLCYS+ A H  FSD G+  I
Sbjct: 241 IGFEGRAYHVRDFYASQLLSMILGGGMSSRLFQEVREKRGLCYSVYAFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT ++ ++ L   I++ +    ++I   E+D+  A+  A L+ SQE +  RA +I++Q
Sbjct: 301 HAATGRDELVELVPVIIDELHKAADSIGIEEVDRARAQYRASLLMSQESAASRAGQIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGV 387
            +  G  + + +++D +S IT E +   
Sbjct: 361 FLLYGRPVENSELLDRLSLITPERLTDA 388


>gi|212639513|ref|YP_002316033.1| Zn-dependent peptidase [Anoxybacillus flavithermus WK1]
 gi|212560993|gb|ACJ34048.1| Zn-dependent peptidase [Anoxybacillus flavithermus WK1]
          Length = 413

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 135/404 (33%), Positives = 230/404 (56%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E +P + S  + + I  GSRNE ++ +G++HFLEHM FKGT  RTA
Sbjct: 2   IKTYTCQNGVRVVLEHIPTVRSVAIGIWIGTGSRNENEQNNGISHFLEHMFFKGTKTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  +++GG +NA+TS E+T Y+A VL  H   AL+I+ DM  +S+F   ++++E+N
Sbjct: 62  RDIAESFDRIGGQVNAFTSKEYTCYYAKVLDTHASFALDILADMFFHSTFVDEELQKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  +T+++FT + +  ++   YT 
Sbjct: 122 VVFEEIKMYEDTPDDLVHDLLSKASYGNHPLGYPILGTEQTLATFTGDTLRQYMYETYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD    + QVE+YF   +  K  +      +   +  +K++  + H+ +G
Sbjct: 182 DRVVISIAGNVDES-FIQQVEAYFGSFTRQKGNDVYVAPSFYPNKIARKKETEQAHVCIG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   IL +ILG  MSSRLFQEVRE+RGL YSI ++H  + D G++ I  
Sbjct: 241 FNGLPIGHEDVYSLIILNNILGGSMSSRLFQEVREQRGLAYSIFSYHSAYRDGGMVTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  +I + ++    + I ++E++    ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDLLFDTIQQTIEQLKQDGITEKELENSKEQMKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
           +  G     ++II++I  +T E +  +A+ IF+   ++A++ P 
Sbjct: 361 LLLGRHRSLDEIIESIDRVTKESVDRMAQTIFTDDFSVALISPE 404


>gi|149704558|ref|XP_001488876.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           [Equus caballus]
          Length = 490

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 60  RVTCLENGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 119

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 120 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 179

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S   + ++ +++ +Y   R
Sbjct: 180 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRKDLVDYITTHYKGPR 239

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         ++              ++   +   H+ +
Sbjct: 240 IVLAAAGGVSHDELLELAKLHFGESLSRHTGEMPALPPCRFTGSEIRVRDDKMPLAHLAV 299

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 300 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLSCHGNLCHSFQSFNTSYT 359

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 360 DTGLWGIYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 419

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A++ E I  V  K      P LA +GP ++ +P  
Sbjct: 420 CEDIGRQMLCYNRRIPIPELEARIDAVSAETIREVCTKYIYEKSPALAAVGP-IEQLPEF 478

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 479 NQICSNMRWLR 489


>gi|260428266|ref|ZP_05782245.1| processing peptidase subunit beta [Citreicella sp. SE45]
 gi|260422758|gb|EEX16009.1| processing peptidase subunit beta [Citreicella sp. SE45]
          Length = 420

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 154/418 (36%), Positives = 233/418 (55%), Gaps = 2/418 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +  +   +G+ +++E M    SA + + + AG RNER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVEQTTLKNGLRIVSERMDGLQSASLGIWVTAGGRNERVEQNGIAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL+   PLA+++IGD+L N  F+  +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLENDTPLAMDVIGDILMNPVFDTREIETE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  +++Q +GR ILG+   + +F  E + +FV+ +Y
Sbjct: 121 RHVILQEIGQALDTPDDVIFDWLQERAYQNQPLGRTILGEAANVKAFGREDLETFVTEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             ++M +   GAVDH   V Q E+ F   S  K     + A + GGE   ++ L + H  
Sbjct: 181 GPEQMILSAAGAVDHGALVKQAEALFGGLSSRKSNAP-EGARFTGGETRHEKALEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y    FY   I A  LG GMSSRLFQE+REKRGLCY+I A    ++D G+  I
Sbjct: 240 LAFEGPGYSDPAFYAAQIYAIALGGGMSSRLFQEIREKRGLCYTIFAQTGAYADTGLTTI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ E +  L    ++ ++   E++   E+ +  A++ A L+   E S  RA  +++ 
Sbjct: 300 YAGTSGEELGELAGITIDEMKRAAEDMSPEEVARARAQMKAGLLMGLESSSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           V   G +   E+ +  I  +T  D+   A++  SS P    L  P+   P    L   
Sbjct: 360 VQIWGEVPAIEETVARIDNVTTGDVRVFAEQAASSAPAALALYGPVSGAPGLEALQAR 417


>gi|313901842|ref|ZP_07835263.1| peptidase M16 domain protein [Thermaerobacter subterraneus DSM
           13965]
 gi|313467885|gb|EFR63378.1| peptidase M16 domain protein [Thermaerobacter subterraneus DSM
           13965]
          Length = 432

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 126/409 (30%), Positives = 217/409 (53%), Gaps = 2/409 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            RI+   SG+ V+TE +P   S  + +  R GSR E +E+ G+AH LEHM FKGT  R+A
Sbjct: 18  YRITTLPSGLRVVTETVPGVRSVTLGIWFRTGSRFEPEEQAGIAHLLEHMAFKGTESRSA 77

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +E+ E +++VGG +NAYTS E TS++  VL EH  L +EI+ DML +S  +  ++E+E+ 
Sbjct: 78  RELAEAVDRVGGQMNAYTSKEDTSFYIKVLDEHFGLGMEILADMLLHSRLDGEELEKEKR 137

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M EDD  D +       +W    +GRP++G   T+ +   E ++ F  R+Y  
Sbjct: 138 VILEEIKMYEDDPEDVVHDLAVRTLWPGHPLGRPVIGFESTVGAVDREALVDFWRRHYEP 197

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            R  +   G + H+  + +V+ +F   +    +    P V    E  +++ + + H+ + 
Sbjct: 198 GRTVIAAAGHISHQQVLEEVQRWFGSWARTGERARQTPPVPQAAEAWRQKPVEQVHLCVV 257

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
               AY S + Y   +L+SILG   SSRLFQ +RE  GL YS+  +H ++SD GV  + +
Sbjct: 258 APAAAYGSDEIYPEMVLSSILGGASSSRLFQVIREDHGLAYSVYTYHVSYSDAGVFGLYA 317

Query: 302 ATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           AT+ +    +      E  +   E +   E+ +   +I A L+   E +  R   + + +
Sbjct: 318 ATSPDTAARVLELVGRECRKVRREGVTAAELARTRDQIKANLLMGLESTGSRMNRLGRTL 377

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +    ++  E+++  + A+T E +   A+++      +     P + +P
Sbjct: 378 LMLDRVVTVEEVVRRVEAVTAEQVAAAAERLLDPDRWVVAGVGPAESLP 426


>gi|256396975|ref|YP_003118539.1| processing peptidase [Catenulispora acidiphila DSM 44928]
 gi|256363201|gb|ACU76698.1| processing peptidase [Catenulispora acidiphila DSM 44928]
          Length = 439

 Score =  205 bits (520), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 133/415 (32%), Positives = 223/415 (53%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE MP + S    +    GSR+E  EE G  H+LEH+LFKGT KR+
Sbjct: 16  TVRRTVLPGGLRVVTETMPSVRSVTFGIWTGIGSRDEHAEESGATHYLEHLLFKGTAKRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   ++ VGG++NA+T+ E+T Y+A VL   +PLA+++I D+++++   P D+  ER
Sbjct: 76  ALEISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVICDLVTSALIRPEDVASER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV+LEE+ M+ED+  D +   F+  +  D  +GRPILG  E++++ T + I  +   +YT
Sbjct: 136 NVILEEMAMTEDEPADQIHDEFAYALLGDSPLGRPILGSAESVNALTRDAIAEYYHSHYT 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKR--------D 232
            D + V   G +DH+  V+ V++ F      +  +       +GG+              
Sbjct: 196 DDHLVVSAAGNLDHDVVVALVDAAFAQARGVRDADRQPVVPRIGGDCGVAHSGLRLVSKQ 255

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A   R  Y   IL++ILG GMSSRLFQEVREKRGL YS+ +   + +
Sbjct: 256 TEQTHVVLGVPGVARNDRRRYPLGILSTILGGGMSSRLFQEVREKRGLAYSVYSFSSHHA 315

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +    EN   +     + V  + +  + + E+ +   ++    + S E +  
Sbjct: 316 DCGTFGVYAGCQPENFTEVLKICRDEVAKIADGGVTEEELRRGIGQVRGSTVLSLEDTGS 375

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           +   I K  +  G  L  E+++  + ++T ED+  VA++       +A++G   D
Sbjct: 376 QMTRIGKNELVYGEHLTIEELLARVESVTLEDVKAVAEEFLRQPQAIAVIGDYED 430


>gi|228992533|ref|ZP_04152460.1| Uncharacterized zinc protease ymxG [Bacillus pseudomycoides DSM
           12442]
 gi|228767167|gb|EEM15803.1| Uncharacterized zinc protease ymxG [Bacillus pseudomycoides DSM
           12442]
          Length = 431

 Score =  205 bits (520), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 130/409 (31%), Positives = 232/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVFEEIKMYEDTPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D    V  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNIDET-FVQTVEQYFGNYEGTTNREQVHSPIFHFNKVTRKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 FQGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYDTMQETLETLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T  D+  + + IF++  + A++ P  + +P
Sbjct: 380 LLLRKHRSLDEIIESVNKVTKTDVDQLIRSIFTNEFSTALISPNGE-LP 427


>gi|295836211|ref|ZP_06823144.1| M16 family peptidase [Streptomyces sp. SPB74]
 gi|197699244|gb|EDY46177.1| M16 family peptidase [Streptomyces sp. SPB74]
          Length = 471

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 133/415 (32%), Positives = 224/415 (53%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 46  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTARRT 105

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S+ + +DI+ ER
Sbjct: 106 ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSTLDAADIDAER 165

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   E+I  F  R+Y 
Sbjct: 166 GVILEEIAMTEDDPGDVVHDLFAHTMLGDTPLGRPVLGTVDTINALGREQIARFYKRHYD 225

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV + F+          +    +E  +     G   +Q R 
Sbjct: 226 PTHLVVAAAGNVDHAKVVRQVRAAFDRAGALGRAEAAPLGPREGTRLIRAAGRVEVQNRR 285

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 286 TEQAHVVLGMPGIARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 345

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     E ++++    +   EI +   ++    +   E +  
Sbjct: 346 DCGLFGVYAGCRPSQVDDVLKICREELETVAAHGLADEEIRRAVGQLAGSTVLGLEDTGA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G  L  + ++  I+A+T +++  VA+ I    P+L+++GP  +
Sbjct: 406 LMNRIGKSELCWGEQLSVDDMLARIAAVTPDEVRAVARDILGQRPSLSVIGPLKE 460


>gi|31789376|gb|AAP58493.1| putative protease [uncultured Acidobacteria bacterium]
          Length = 444

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 130/415 (31%), Positives = 221/415 (53%), Gaps = 7/415 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M +R     +G+ +ITE MP + S  + V +  GSR+E  E  G+AHF+EHMLFKGT  R
Sbjct: 26  MVVRE-VLDNGLRLITETMPHVRSVTIGVWLMRGSRHESDERSGIAHFVEHMLFKGTDTR 84

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I + I+ +GG ++A+T+ E+ SY+  VL EH+PLA++++ D++   +F+  +IERE
Sbjct: 85  SAEDIAQAIDSIGGQLDAFTAKEYASYYIKVLDEHLPLAVDLLSDIVLRPAFSAEEIERE 144

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+LEEI M ED   D +   F++  W+   +GRPILG  ET+ SFT   ++ +    Y
Sbjct: 145 KKVILEEIKMVEDTPDDLVHELFTQHFWEGHPLGRPILGSKETVESFTATSLLDYFHGAY 204

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   G ++H      VE  F          S +    V     + ++L + H+ 
Sbjct: 205 VARNMIISAAGNLEHAHVRELVERAFGAVPSEGEPFSAEAPRVVPQVITRTKELEQSHIC 264

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG N       D Y++ I+ ++LG  MSSRLFQ VREKRGL Y++ +    + D G + I
Sbjct: 265 LGTNSYPQNHDDRYVSYIMNTVLGGSMSSRLFQNVREKRGLAYAVFSGLSAYRDAGNITI 324

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +  + + +  +    VE ++ +    +   E+ +    +   L+ S E +  R   +++
Sbjct: 325 YAGCSNQAVGEVIDLCVEELRGMKRAPVPDSELRRAKDHLKGSLMLSLENTASRMSHLAR 384

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHVPTTS 412
           Q ++       ++ +  +  +T  D+  VA+ +FS  +    +LGP    VP   
Sbjct: 385 QEIYFDRHFGLDETLAGVERVTDADVQRVAQDLFSDGSLAATVLGP---SVPALD 436


>gi|169831099|ref|YP_001717081.1| peptidase M16 domain-containing protein [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637943|gb|ACA59449.1| peptidase M16 domain protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 420

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 125/399 (31%), Positives = 218/399 (54%), Gaps = 3/399 (0%)

Query: 8   TSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVE 66
             +G+ ++TE +P + SA V   + AGSR+E     G+ HF+EHMLFKGT  R+AK+I E
Sbjct: 7   LDNGVCILTEEIPHVRSAAVGFWVDAGSRDEADSVSGVCHFIEHMLFKGTENRSAKDIAE 66

Query: 67  EIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEE 126
            +++VGG +NA+T+ E+T Y+A VL EH+ LA++++ DML +S F P D+ERERNV++EE
Sbjct: 67  ALDRVGGQLNAFTTKEYTCYYARVLDEHLELAVDVLTDMLFHSRFAPEDVERERNVIVEE 126

Query: 127 IGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYV 186
           I M ED   + +    ++ +W    +GRP++G    I + +   ++ +  R+Y   R  +
Sbjct: 127 IKMYEDTPDELVHDVLAKALWNTHALGRPVIGSAGVIQNLSWGDLLDYYDRHYRHGRYVI 186

Query: 187 VCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
              G V HE     +   F+         ++           +++D  + H+ +G  G  
Sbjct: 187 AVAGNVKHERVTELLSRIFSDLPAGGPPRAVVAPHPSQRVECREKDTEQVHLCIGSQGLR 246

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
                 Y+  +L ++LG GMSSRLFQ+VRE+ GL Y+I ++H ++ D G+  I +  ++E
Sbjct: 247 LDDEHIYVLQVLNTLLGGGMSSRLFQKVREQLGLAYNIYSYHSSYRDTGLFGIYAGLSRE 306

Query: 307 NIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
           N+  +   +++ V  L    + + E+ +   ++    + S E    R   + K  ++ G 
Sbjct: 307 NVGTVLDIVLDEVNDLRNGGVSEEEMTRAKEQLKGSFLLSLESVNARMSRLGKSQLYLGR 366

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           +   E+I+  ++ +  E I  V  +IF     +LA +GP
Sbjct: 367 VQTPEEIVRELARVKTEQIAAVCDQIFRRDKLSLASIGP 405


>gi|170740578|ref|YP_001769233.1| processing peptidase [Methylobacterium sp. 4-46]
 gi|168194852|gb|ACA16799.1| processing peptidase [Methylobacterium sp. 4-46]
          Length = 431

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 160/421 (38%), Positives = 249/421 (59%), Gaps = 3/421 (0%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            LR+++  +G TV TE MP   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+
Sbjct: 13  TLRVTRLPNGFTVATEPMPGVATATLGVWVGAGSRHERPQEHGLSHLIEHMAFKGTRTRS 72

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ + E+IE VGGDINA TS E TSY A VL E V +AL++IGD+L+NS +  +++ RE+
Sbjct: 73  ARAVAEDIENVGGDINAATSAEQTSYTARVLGEDVGVALDVIGDILTNSVYEEAELAREK 132

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    ED   D +   F+E  + DQ IGRPILG+PETI  F    I ++++R YT
Sbjct: 133 GVILQEHAAVEDTPDDVVYDAFTEAAFPDQPIGRPILGRPETIQGFDRPAIEAYLAREYT 192

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            DRM +   GAV HE  V+  E +F +       E+  P +Y GGE    R L + +++L
Sbjct: 193 PDRMVLAAAGAVSHEAIVAAAERHFGILPARAAPEA-VPGLYRGGERRMARKLEQANLVL 251

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +++   +Y  ++ A +LG G++SRL+ EVRE RGL Y I A H  FSD G+  I 
Sbjct: 252 GLPGLSFRDEGYYALHLFAQVLGGGLTSRLWHEVRETRGLAYEIHAFHWPFSDCGLFGIG 311

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + TA  ++ AL    +  + +    IE  E+ +  A++   L+ + E    R   I++Q+
Sbjct: 312 AGTAGADLSALVEVTIGCLGAAAGAIELAELARAKAQLKVSLLSALETPGGRIERIARQL 371

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEG 420
           +  G ++ +E+II  + A+T + +    + + +  PTLA +GP +  + +   +  AL  
Sbjct: 372 LAWGRVIPAEEIIAKVDAVTLDQVRAAGRSVMAGAPTLAAIGP-IRRLQSLDAVGRALRA 430

Query: 421 F 421
            
Sbjct: 431 A 431


>gi|115526748|ref|YP_783659.1| peptidase M16 domain-containing protein [Rhodopseudomonas palustris
           BisA53]
 gi|115520695|gb|ABJ08679.1| peptidase M16 domain protein [Rhodopseudomonas palustris BisA53]
          Length = 429

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 150/404 (37%), Positives = 239/404 (59%), Gaps = 2/404 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M++ ++K +SG+TV+T+ MP +++A + V    G R+ER  EHG++H LEHM FKGT  R
Sbjct: 1   MSVEVTKLASGLTVVTDHMPHLETAALGVWTGVGGRDERPNEHGISHLLEHMAFKGTLTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +++EIVEEIE VGGD+NA TS E T+Y+A VLK  VPLAL+++ D+L+N +F P ++ERE
Sbjct: 61  SSREIVEEIEAVGGDLNAATSTETTAYYARVLKADVPLALDVLSDILANPAFEPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG ++D   D +    +E+ + +Q +GR +LG P+T+ +F  + + S++S +Y
Sbjct: 121 KSVIVQEIGAAQDTPDDVVFEYLNELCYPEQPMGRSLLGTPQTLKAFDRDTLQSYLSTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH+  V +V   F      K           GG  +  RDL + H+ 
Sbjct: 181 RGPEMVVSAAGAVDHKQVVEEVTRRFASFQNHKAPLPQPAMFGAGGTKVVHRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  + LG GMSSRLFQEVREKRGLCYSI   H  +SD G   +
Sbjct: 241 LALEGLPQLDPSLFSLQVFTNALGGGMSSRLFQEVREKRGLCYSIYTFHAPYSDTGFFGL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T  E+   +   IV+V+   ++ + + E+ +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPEDAPEMMEVIVDVIGETVDTLTEAEVARAKAQMKAGLLMALESCSSRAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           +M  G  L + ++I  I A++ E      + +   S P +A LG
Sbjct: 361 MMAYGRPLPAAELIARIEAVSVESAGKAGRALLERSRPAVAALG 404


>gi|302537282|ref|ZP_07289624.1| protease [Streptomyces sp. C]
 gi|302446177|gb|EFL17993.1| protease [Streptomyces sp. C]
          Length = 459

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 129/416 (31%), Positives = 223/416 (53%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPALNGATHYLEHLLFKGTAQRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIREEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F++ ++ D  +GRP+LG  +TI++   ++I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDMVHDLFAQTMYGDSPLGRPVLGTVDTINALGADRIRRFWKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV + F      K  +++      G + I+         R 
Sbjct: 214 PTHLVVAAAGNVDHNKVVRQVRAAFEKAGALKQTDAVPLGPRTGTKRIRTAGRVDLVNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + ++  E +   EI +   ++    +   E +  
Sbjct: 334 DTGLFGVYAGCRPSQVHDVLRICRQELDTVASEGLTDEEIRRAVGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+++T +D+  VA+ + +  P+LA++GP  + 
Sbjct: 394 IMNRIGKSELCWGDQMSVDDMLARIASVTPDDVRAVAQDVLAQRPSLAVIGPLKEK 449



 Score = 36.4 bits (82), Expect = 8.8,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 40/99 (40%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++  Q M+  S         +DTI+A+  + I 
Sbjct: 146 EEDVDAERGVILEEIAMTEDDPGDMVHDLFAQTMYGDSPLGRPVLGTVDTINALGADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              KK +  T  +      +DH     ++  A E   ++
Sbjct: 206 RFWKKHYDPTHLVVAAAGNVDHNKVVRQVRAAFEKAGAL 244


>gi|307331544|ref|ZP_07610656.1| peptidase M16 domain protein [Streptomyces violaceusniger Tu 4113]
 gi|306882815|gb|EFN13889.1| peptidase M16 domain protein [Streptomyces violaceusniger Tu 4113]
          Length = 459

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 125/416 (30%), Positives = 219/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E     G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPTLGGATHYLEHLLFKGTRRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I++VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S    +D++ ER
Sbjct: 94  ALDISAAIDEVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSVIGAADVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M+EDD  D +   F+  +  D  +GRP+LG  +T+++   ++I  F  ++Y 
Sbjct: 154 GVVLEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALGRDQIARFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH+  V QV + F+               +  ++     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHDDVVRQVHAAFDGAGALSRTDALPVAPRSGIRAIRTAGKVGLLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G        +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 274 TEQAHVVLGMPGIPRTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + Q     +   E+ +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPNQVHDVLKICRDELTQVAENGLSDEELRRAVGQLAGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + +++ I+A+T +++  VA+ +    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLERIAAVTPDEVREVARDVLGQRPSLSVIGPLKDK 449


>gi|149182490|ref|ZP_01860964.1| zinc protease [Bacillus sp. SG-1]
 gi|148849821|gb|EDL63997.1| zinc protease [Bacillus sp. SG-1]
          Length = 414

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 128/406 (31%), Positives = 221/406 (54%), Gaps = 3/406 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +     S+G+ ++ E +P + S  + + I  GSR+E +E +G++HFLEHM FKGT  R+A
Sbjct: 2   INKYTCSNGLRIVLEEIPTVRSVAIGIWIGTGSRHENKENNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL  H   ALE + DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDNHAKYALETLADMFFNSAFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+ V+++  +G PILG  ET+ +F  + +  ++   YT 
Sbjct: 122 VVYEEIKMYEDTPDDIVHDVLSKAVYENHPLGYPILGTEETLDTFNGQTLREYMHNMYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G +D    + +VE  F      K  E      +   +  +K++  + H+ LG
Sbjct: 182 DDVVISVAGNIDAS-FIKEVEKLFGQYEGGKGHEQNAKPSFHHNKVSKKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H  + D+G+L I  
Sbjct: 241 YPGLQIGHDDIYSLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSAYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++   + +   E I  +E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGAKQLNQLFDTVQSTLATLKAEGISSKELSNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           +        ++I+D I  +T + +  +  +IF++  ++A++ P  +
Sbjct: 361 LLLKKHRSLDEIVDEIDGVTIDRVNNLGNEIFNNDFSVALISPDGE 406


>gi|218531509|ref|YP_002422325.1| processing peptidase [Methylobacterium chloromethanicum CM4]
 gi|218523812|gb|ACK84397.1| processing peptidase [Methylobacterium chloromethanicum CM4]
          Length = 431

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 145/418 (34%), Positives = 240/418 (57%), Gaps = 3/418 (0%)

Query: 5   ISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S+  +G+TV TE +P   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+A++
Sbjct: 16  VSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRSARK 75

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+ V+
Sbjct: 76  IAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREKGVI 135

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y  +R
Sbjct: 136 LQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYVPER 195

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAV+H   V   E +F               VY GGE   ++ L + +++LG  
Sbjct: 196 MVLAAAGAVEHAEIVEAAERHFGGLKPVAAP-PAVAGVYGGGERRMQKRLEQANLVLGLP 254

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I + T
Sbjct: 255 GLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIGAGT 314

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
           +  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q++  
Sbjct: 315 SGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQLLAW 374

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
           G ++  +++I  + A+  E +    + +    PTLA +GP +  +P+ + +  AL+  
Sbjct: 375 GRVIPPQELIAKVDAVEVEHVRAAGRALLRGAPTLAAIGP-VKGLPSLARVASALQAA 431


>gi|11693166|ref|NP_071790.1| mitochondrial-processing peptidase subunit beta precursor [Rattus
           norvegicus]
 gi|294589|gb|AAA41633.1| mitochondrial processing peptidase beta-subunit [Rattus norvegicus]
          Length = 489

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 94/431 (21%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   I +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  QVTCLENGLRVASENSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   +   + +F          +              ++   +   H+ +
Sbjct: 239 IVLAAAGGVCHNELLELAKFHFGDSLCAHKGDVPALPPCKFTGSEIRVRDDKMPLAHLAV 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AIEAVGWTHPDTIRLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +     +  +  +  ++ +    L   + + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEQATVADMLHAVQKEWMRLCTAVSESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E +  V  K     +P +A LGP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVDAEMVREVCTKYIYGKSPAIAALGP-IERLPDF 477

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 478 NQICSNMRWTR 488


>gi|239928582|ref|ZP_04685535.1| protease [Streptomyces ghanaensis ATCC 14672]
 gi|291436907|ref|ZP_06576297.1| protease [Streptomyces ghanaensis ATCC 14672]
 gi|291339802|gb|EFE66758.1| protease [Streptomyces ghanaensis ATCC 14672]
          Length = 441

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 126/416 (30%), Positives = 218/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E     G  H+LEH+LFKGT +R+
Sbjct: 16  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALGGATHYLEHLLFKGTARRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 76  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSVIREEDVDVER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  ET++S T ++I  F  ++Y 
Sbjct: 136 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVETVNSLTADRIRRFYRKHYD 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V C G +DH   V QV + F      K   +   A   G   ++         R 
Sbjct: 196 PTHLVVACAGNIDHGKVVRQVRAAFEAAGALKDPGARPIAPRGGRRALRTAGRVDLVDRS 255

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G +      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 256 TEQAHVILGMPGLSRTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 315

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   E+++   ++    +   E +  
Sbjct: 316 DCGLFGVYAGCRPSQVHDVLKICRDELDHVAEHGLPDDEMERAVGQLRGSTVLGLEDTGA 375

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+++T +D+  VA+ +    P+L+++GP  D 
Sbjct: 376 LMNRIGKSELCWGEQMSVDDMLARIASVTPDDVRLVARDVLGQRPSLSVIGPLKDK 431



 Score = 37.2 bits (84), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/99 (14%), Positives = 40/99 (40%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++    MF  +         ++T++++T + I 
Sbjct: 128 EEDVDVERGAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVETVNSLTADRIR 187

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              +K +  T  +      +DH     ++  A E   ++
Sbjct: 188 RFYRKHYDPTHLVVACAGNIDHGKVVRQVRAAFEAAGAL 226


>gi|115942950|ref|XP_001176813.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           isoform 2 [Strongylocentrotus purpuratus]
 gi|115942952|ref|XP_785521.2| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           isoform 3 [Strongylocentrotus purpuratus]
 gi|115953918|ref|XP_001177797.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           isoform 2 [Strongylocentrotus purpuratus]
 gi|115953920|ref|XP_001177920.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           isoform 3 [Strongylocentrotus purpuratus]
          Length = 476

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/431 (24%), Positives = 198/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++  ++G  V +E   I +A V + I AGSR E  + +G+AH+LEHM FKGT+ RT  E
Sbjct: 46  RVTTLNNGFRVSSEDSGIPTATVGLWIDAGSRYENAKNNGVAHYLEHMAFKGTSNRTQME 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A   +  VP A+EI+ D++ NS+   ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVYYAKCFESDVPRAVEILADIIQNSTLGEAEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S   + + +++S +Y   R
Sbjct: 166 LREMQEVETNLQEVIFDHLHATAYQGTPLGRTILGPTENIRSINRDDLQNYISTHYKGPR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V+H+  V   E +F         +I           G  ++   +   H+ L
Sbjct: 226 IVLSGAGGVNHDELVKLAEKHFGNLGTEYENEIPALTPCRFTGSGITVRDDKMPLAHIAL 285

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              G  +   D     +  +++G    S         R         +C+S  A +  ++
Sbjct: 286 CVEGVGWAHPDNIPLMVANTLIGSWDRSFGGGANTSSRLARVAYEDNICHSFQAFNTCYT 345

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +   +   ++  +   +      L  ++ + E+ +    +   ++   + S   
Sbjct: 346 DTGLWGVYMVSDPLSVEDMVYHVQNQWMYLCTSVTESEVARAKNLLRTNMLLQLDGSTPI 405

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++  G  +   ++   I +I+ + I  V  +      P +A +GP ++ +P  
Sbjct: 406 CEDIGRQMLCYGRRIPLPELEARIDSISAKTIRDVCTRYIYDKCPAVAGVGP-VEQLPDY 464

Query: 412 SELIHALEGFR 422
           + +  ++   R
Sbjct: 465 NRIRASMYWIR 475


>gi|295399862|ref|ZP_06809843.1| processing peptidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312111626|ref|YP_003989942.1| processing peptidase [Geobacillus sp. Y4.1MC1]
 gi|294978265|gb|EFG53862.1| processing peptidase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311216727|gb|ADP75331.1| processing peptidase [Geobacillus sp. Y4.1MC1]
          Length = 413

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 142/409 (34%), Positives = 234/409 (57%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ ++ E +P + S  + V I  GSRNE ++ +G++HFLEHM FKGTT RTA
Sbjct: 2   INKYTCKNGVRIVLEQIPTVRSVAIGVWIGTGSRNETEQNNGISHFLEHMFFKGTTTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI E  + +GG +NA+TS E+T Y+A VL EH   ALE++ DM  +S+F   ++++ERN
Sbjct: 62  KEIAEAFDSIGGQVNAFTSKEYTCYYAKVLDEHASFALEMLADMFFHSTFVDEELQKERN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +    S+  + +  +G PILG  ET+ +FT + +  +++  YT 
Sbjct: 122 VVLEEIKMYEDTPDDIVHDLLSKACYANHPLGYPILGTEETLRTFTGDSLRGYMADYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD    + +VESYF   +  +        ++   +  ++++  + H+ +G
Sbjct: 182 DRVVISVAGNVDES-FIQKVESYFGFFTAKRKASESPAPLFQPQKLARQKETEQAHLCIG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   +L +ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G+L I +
Sbjct: 241 FNGLPVGHPDIYTLIVLNNILGGSMSSRLFQEVREQRGLAYSVFSYHSSYQDSGLLAIYA 300

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  +I E ++ L  + I ++E+     ++   L+   E +  R     K  
Sbjct: 301 GTGNSQLDLLFETIQETIEKLKEDGITEKELKNSKEQMKGSLMLGLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +  G     ++II+ I+ +T E +  +A++IF+    LA++  P   +P
Sbjct: 361 LLLGRHRTLDEIIEEINGVTVEKVNELARRIFAEDCALALI-SPSGQLP 408


>gi|271963664|ref|YP_003337860.1| peptidase M16 domain-containing protein [Streptosporangium roseum
           DSM 43021]
 gi|270506839|gb|ACZ85117.1| peptidase M16 domain protein [Streptosporangium roseum DSM 43021]
          Length = 436

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 136/414 (32%), Positives = 218/414 (52%), Gaps = 9/414 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +    G+ V+TE MP + S  V + +  GSR+E  E  G +HFLEH+LFKGT  R A
Sbjct: 15  VQRTVLPGGLRVVTESMPTVRSVAVGMWVGIGSRDEAPEHMGSSHFLEHLLFKGTPTRDA 74

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   IE +GG+INA+T+ E+T Y+A VL E + +A++++ D++++S   P D+E ER 
Sbjct: 75  LEISAAIEGIGGEINAFTAKEYTCYYARVLDEDLRVAIDVLADVVTSSLITPEDVEAERG 134

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +  +FS  ++ D  IGRPILG  ++I++ + ++I  +  R Y  
Sbjct: 135 VILEEIAMHDDDPSDMVHEQFSAEMYGDTPIGRPILGTVDSINAASRDRIAEYYRRYYLP 194

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFN-------VCSVAKIKESMKPAVYVGGEYIQKRDLA 234
               V   G V+HE  V+ V + +          S    + S   A    G  +  R   
Sbjct: 195 THTVVSVAGNVNHEQVVALVAAAYERAGALGGDASPIAPRVSGPGAEARPGVRVVHRPTE 254

Query: 235 EEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN 294
           + +++LG  G        +   +  + LG GMSSRLFQE+REKRGL YS  ++  +++D 
Sbjct: 255 QANLVLGTTGLTRTDERRFALGVFNAALGGGMSSRLFQEIREKRGLAYSAYSYTSSYADT 314

Query: 295 GVLYIASATAKENIMALTSSIVEV-VQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G   I        I  +     E  ++ + E I + EI +   ++   L+   E +  R 
Sbjct: 315 GQFGIYVGCLPSKIDDVLKICREEVLRVVAEGITEEEIVRGKGQMRGGLVLGLEDTGSRM 374

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
             I K  +    +L  + ++  I A+T E I  VA+ + +   TLA++GP  D 
Sbjct: 375 SRIGKGELVYDELLSVDDVLARIEAVTPEQISEVARDVLTRPMTLAVIGPYEDK 428


>gi|222055787|ref|YP_002538149.1| processing peptidase [Geobacter sp. FRC-32]
 gi|221565076|gb|ACM21048.1| processing peptidase [Geobacter sp. FRC-32]
          Length = 418

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 139/404 (34%), Positives = 226/404 (55%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +   +G+ VI+E +P + S  + + +  GSR+ER+E +G+AHF+EH+LFKGTT RTA
Sbjct: 2   IKKTTLKNGVRVISEALPNLSSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTTNRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL   +P A++I+ D+ +NS F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGILNAFTSREYVCYYAKVLDRFLPKAVDILADIFTNSIFDPEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EI M ED+  D +   F +  WK   +G  ILG  +++S  T EKII F  R Y A
Sbjct: 122 VILQEINMVEDNPEDLVHDLFHQKFWKHHPLGMSILGDQQSVSGLTREKIIGFKDRMYRA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G VDH+  ++ +E      +    +E+    V+       +RDL + HM LG
Sbjct: 182 EDIIIAAAGNVDHQELLALLEKNLPRIATGNGRETSTEPVHKKRIETVERDLEQVHMCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        +   ++ +ILG  MSSRLFQEVREKRGL YSI ++  + +D G L I +
Sbjct: 242 IRGLPQNHPRRFDAFVMNTILGGSMSSRLFQEVREKRGLAYSIYSYMASHADTGSLVIYA 301

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            +   +   +    +  ++    E + Q E+D    ++   +I S E S  R  +++K  
Sbjct: 302 GSGPGHYREVMELSLGELKRLKREPVPQVELDAAREQLKGNMILSLESSDNRMSKLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP 403
           ++ G     + II     +T + I+ +A ++      TL +LG 
Sbjct: 362 IYFGQYQPLDAIIAGFDLVTTDSIMEIAGQLLDDDYLTLVMLGK 405


>gi|12802327|gb|AAK07827.1|AF297643_1 mitochondrial processing peptidase beta subunit [Cucumis melo]
          Length = 528

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 121/424 (28%), Positives = 206/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++  S+G+ V TE      +A V V I AGSR E +E +G AHFLEHM+FKGT KR+A+
Sbjct: 95  RVTTLSNGLRVATESNLAARTATVGVWIDAGSRFETEETNGTAHFLEHMIFKGTEKRSAR 154

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VL + VP AL+I+ D+L NS F+   I RER+V
Sbjct: 155 QLEEEIENMGGHLNAYTSREQTTYYAKVLDKDVPKALDILADILQNSKFDEHRISRERDV 214

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + I + T + + S++  +YTA 
Sbjct: 215 ILREMEEVEGQTEEVIFDHLHATAFQYTPLGRTILGPAQNIRTITKDHLQSYIQTHYTAP 274

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGEYIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      +                I   D+    
Sbjct: 275 RMVIAASGAVKHEDFVEQVKKLFTKLSAEPTTAAQLVAKEPAIFTGSEVRIVDDDVPLAQ 334

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHE 289
             + FNG ++   D     ++ ++LG                 +      +  S+ A + 
Sbjct: 335 FAIAFNGASWTDPDSIALMVMQAMLGSWNKSAGGGKHMGSELAQRVAINEVAESMMAFNT 394

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I+     L   + + ++ +   ++ + L+   + +
Sbjct: 395 NYKDTGLFGVYAVAKPDCLDDLAYAIMYETTKLAYRVSEADVTRARNQLKSSLLLHIDGT 454

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I A+    I  VA + I+     +A LGP +  +
Sbjct: 455 SPVAEDIGRQLLTYGRRIPFAELFARIDAVDASTIKRVANRFIYDRDIAIAALGP-IQGL 513

Query: 409 PTTS 412
           P  +
Sbjct: 514 PDYN 517


>gi|157692354|ref|YP_001486816.1| M16B subfamily peptidase [Bacillus pumilus SAFR-032]
 gi|194014929|ref|ZP_03053546.1| peptidase, M16 family [Bacillus pumilus ATCC 7061]
 gi|157681112|gb|ABV62256.1| M16B subfamily peptidase [Bacillus pumilus SAFR-032]
 gi|194013955|gb|EDW23520.1| peptidase, M16 family [Bacillus pumilus ATCC 7061]
          Length = 409

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 133/407 (32%), Positives = 235/407 (57%), Gaps = 3/407 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT  R+A
Sbjct: 2   VKTYTCQNGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  +++GG +NA+TS E+T Y+A VL  H   AL+++ DM  +S+F+  ++++E+N
Sbjct: 62  RDIAESFDRIGGQVNAFTSKEYTCYYAKVLDSHAGYALDVLSDMFFHSAFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+ ++ D  +G PILG  ET+S+F  + + +++   YT 
Sbjct: 122 VVYEEIKMYEDTPDDIVHDLLSKAIYGDHSLGFPILGTEETLSTFNGDSLRAYMDEFYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD +  +S+VE  F        K+ ++   +   +  +K++  + H+ +G
Sbjct: 182 DRVVISVAGNVD-DTFISEVEKLFGSYETKGKKQPVEAPQFHYDKLTRKKETEQAHLCMG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG     +  Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H +F+DNG+L I  
Sbjct: 241 FNGLPAGDKGIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVFSYHSSFADNGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L+ +I++ +     E I Q+E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGAKQLNLLSETILQTLDVLKREGITQKELENSKEQMKGNLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           +  G     ++IID I+ +T + +  ++K+IF+    L+++ P  D 
Sbjct: 361 LLLGKHRTLDEIIDEINKVTLDGVNNLSKRIFTEDYALSLISPTGDQ 407


>gi|222624442|gb|EEE58574.1| hypothetical protein OsJ_09894 [Oryza sativa Japonica Group]
          Length = 480

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 114/424 (26%), Positives = 198/424 (46%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E ++  G+AHF+EHMLFKGT  R A 
Sbjct: 47  RVTTLPNGLRVATESSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHMLFKGTGDRNAA 106

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VL + VP AL I+ D+L +S    S IERER+V
Sbjct: 107 QLEEEIENIGGHLNAYTSREQTTYYAKVLDKDVPRALNILADILQHSKLEESRIERERDV 166

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + +        ++   +GRPILG  E + S T E +  ++  +YTA 
Sbjct: 167 ILREMEEVEGQYEEVIFDHLHATAFQYTSLGRPILGSAENVKSITQEDLQKYIETHYTAP 226

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   GAV H+  V      FN         SM  +         +  + ++ M L  
Sbjct: 227 RMVITAAGAVKHDDIVEMATKLFNDLPTDPTTTSMLVSTQPACFTGSEVRIIDDDMPLAQ 286

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYS-------------ISAHHE 289
              A+    +   + +A ++   M     +     + +                I A + 
Sbjct: 287 FAVAFNGASWIDPDSIALMVMQSMLGSWNKSAGGGKHMGSELVQRVAINDIAESIMAFNT 346

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I++ +  L   + + ++ +   ++ + +    + S
Sbjct: 347 NYKDTGLFGVYAVAKPDCLDDLAFAIMQEISKLSYRVTEEDVIRARNQLKSSIQLHLDGS 406

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q++  G  +   ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 407 TAVVEDIGRQLLIYGRRIPIPELFARIDAVDASTVKRVANRFIFDQDIAIAAMGP-IQGL 465

Query: 409 PTTS 412
           P  +
Sbjct: 466 PDYN 469


>gi|115451513|ref|NP_001049357.1| Os03g0212700 [Oryza sativa Japonica Group]
 gi|108706819|gb|ABF94614.1| Mitochondrial processing peptidase beta subunit, mitochondrial
           precursor, putative, expressed [Oryza sativa Japonica
           Group]
 gi|113547828|dbj|BAF11271.1| Os03g0212700 [Oryza sativa Japonica Group]
          Length = 533

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 114/424 (26%), Positives = 198/424 (46%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E ++  G+AHF+EHMLFKGT  R A 
Sbjct: 100 RVTTLPNGLRVATESSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHMLFKGTGDRNAA 159

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VL + VP AL I+ D+L +S    S IERER+V
Sbjct: 160 QLEEEIENIGGHLNAYTSREQTTYYAKVLDKDVPRALNILADILQHSKLEESRIERERDV 219

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + +        ++   +GRPILG  E + S T E +  ++  +YTA 
Sbjct: 220 ILREMEEVEGQYEEVIFDHLHATAFQYTSLGRPILGSAENVKSITQEDLQKYIETHYTAP 279

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   GAV H+  V      FN         SM  +         +  + ++ M L  
Sbjct: 280 RMVITAAGAVKHDDIVEMATKLFNDLPTDPTTTSMLVSTQPACFTGSEVRIIDDDMPLAQ 339

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYS-------------ISAHHE 289
              A+    +   + +A ++   M     +     + +                I A + 
Sbjct: 340 FAVAFNGASWIDPDSIALMVMQSMLGSWNKSAGGGKHMGSELVQRVAINDIAESIMAFNT 399

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I++ +  L   + + ++ +   ++ + +    + S
Sbjct: 400 NYKDTGLFGVYAVAKPDCLDDLAFAIMQEISKLSYRVTEEDVIRARNQLKSSIQLHLDGS 459

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q++  G  +   ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 460 TAVVEDIGRQLLIYGRRIPIPELFARIDAVDASTVKRVANRFIFDQDIAIAAMGP-IQGL 518

Query: 409 PTTS 412
           P  +
Sbjct: 519 PDYN 522


>gi|89268963|emb|CAJ83610.1| peptidase (mitochondrial processing) beta [Xenopus (Silurana)
           tropicalis]
          Length = 479

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 97/429 (22%), Positives = 193/429 (44%), Gaps = 11/429 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E Q  +G A+FLEHM FKGT  R+  +
Sbjct: 51  KVTTLENGLRVSSEDSGLLTCTVGLWIDAGSRYENQMNNGTAYFLEHMAFKGTKNRSQLD 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 111 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        + +  +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 171 LREMQEVETNLQEVVFDYLHATAYHNTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H+  +   + +F         E++ P  + G E   + D +   H+ +  
Sbjct: 231 IVLAAAGGVSHDELLHLAKFHFGNLPSTYEGETLPPCSFTGSEIRVRDDKMPLAHIAVAV 290

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFSDN 294
               +   D     +  +++G+   S            ++     LC+S  + +  ++D 
Sbjct: 291 EAVGWSHPDTIPLMVANTLIGNWDRSFGGGVNLSSKLAQLTCHGNLCHSFQSFNTCYTDT 350

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +   +      L  ++ + E+ +    +   ++   + S     
Sbjct: 351 GLWGLYMVCEPNTVEDMMHFVQREWIRLCTSVTENEVARAKNLLKTNMLLQLDGSTPICE 410

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I  I+ E I  V  K   + +P +A +GP +  +P    
Sbjct: 411 DIGRQMLCYNRRIPLPELEARIDLISAETIREVCTKYIYNKSPAVAAVGP-IGQLPDYDR 469

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 470 IRSGMYWLR 478


>gi|254562428|ref|YP_003069523.1| protease [Methylobacterium extorquens DM4]
 gi|254269706|emb|CAX25678.1| putative protease [Methylobacterium extorquens DM4]
          Length = 431

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 145/418 (34%), Positives = 240/418 (57%), Gaps = 3/418 (0%)

Query: 5   ISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S+  +G+TV TE +P   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+A++
Sbjct: 16  VSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRSARK 75

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+ V+
Sbjct: 76  IAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREKGVI 135

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y  +R
Sbjct: 136 LQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYVPER 195

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAV+H   V   E +F               VY GGE   ++ L + +++LG  
Sbjct: 196 MVLAAAGAVEHAEIVEAAERHFGGLKSVAAP-PAVAGVYGGGERRMQKRLEQANLVLGLP 254

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I + T
Sbjct: 255 GLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIGAGT 314

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
           +  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q++  
Sbjct: 315 SGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQLLAW 374

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
           G ++  +++I  + A+  E +    + +    PTLA +GP +  +P+ + +  AL+  
Sbjct: 375 GRVIPPQELIAKVDAVEVEHVRAAGRALLRGAPTLAAIGP-VKGLPSLARVASALQAA 431


>gi|158423864|ref|YP_001525156.1| mitochondrial processing peptidase-like protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330753|dbj|BAF88238.1| mitochondrial processing peptidase-like protein [Azorhizobium
           caulinodans ORS 571]
          Length = 426

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 153/421 (36%), Positives = 258/421 (61%), Gaps = 4/421 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +   +GITV+++ MP + +A + + + AG+R+E ++EHG++H LEHM FKGT +R+A
Sbjct: 8   VKTTTLPNGITVVSDAMPHLGTASLGIWVGAGARDEGEQEHGISHLLEHMAFKGTRRRSA 67

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           + I EEIE+VGGDINA TS+E TSY+  VL E V L ++I+ D+L+  +F P ++ RE+N
Sbjct: 68  RRIAEEIEQVGGDINAATSVEQTSYNVRVLGEDVGLGMDILSDILTEPAFAPEELAREKN 127

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+++EIG   D   D +   F E  +  Q +GR ILG P+T+ SF P  + +++ R Y  
Sbjct: 128 VIVQEIGAVMDTPDDLVFDLFQERAFPGQAVGRSILGTPDTVRSFDPAGLGAYLGRTYRG 187

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            RM V   GAV+H+  V++           + K    PA+Y GG  +  RDL + H++LG
Sbjct: 188 PRMVVSAAGAVNHDQLVAEAAERLGTI-AGETKPEAAPALYAGGSILTPRDLEQVHVVLG 246

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G +Y+   ++   +L++ILG GMSSRLFQ+VRE+RGLCYSI + H +++D G+  I +
Sbjct: 247 LEGRSYKHPQYHAAQVLSNILGGGMSSRLFQDVREERGLCYSIYSFHWSYADTGIFAIYA 306

Query: 302 ATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
            T + ++  LT+ +++ +++  E I + E+ +  A++   L+ + E S  RA ++++Q++
Sbjct: 307 GTDEGDVGELTNVVIDQLEAAGETITETELARAKAQMKVGLLAALESSGARADQLARQLL 366

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHALEG 420
               I+  E+I+  + A+T + +   A+ + +   PTLA +GP     P    +   L G
Sbjct: 367 AFNRIIPVEEIVAKVEAVTVDAVRQAARDLVAGGRPTLAAIGPGKGLDPAARAV-ERLAG 425

Query: 421 F 421
            
Sbjct: 426 A 426


>gi|145593930|ref|YP_001158227.1| peptidase M16 domain-containing protein [Salinispora tropica
           CNB-440]
 gi|145303267|gb|ABP53849.1| peptidase M16 domain protein [Salinispora tropica CNB-440]
          Length = 466

 Score =  204 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 126/412 (30%), Positives = 215/412 (52%), Gaps = 10/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P   S    + +  GSR+E   + G AHFLEH+LFKGT +RT
Sbjct: 39  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVSVGSRDETGPQSGAAHFLEHLLFKGTHRRT 98

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S   P D+E ER
Sbjct: 99  ALEISSGIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLTPEDVEVER 158

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ +  +GR I G  +T++  T  +I  F  R+YT
Sbjct: 159 GVILEEIAMHDDEPGDEVHDLFARAVYGEHPLGRLISGTEQTVTPMTRRQIQGFYRRHYT 218

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
           A R+ +   G +DH   V  V        +     +  P                   ++
Sbjct: 219 APRIVIAAAGNLDHSSVVKLVRQALRGSPLDTDPAAPAPYRSATPVVRTKPATTLVGPKE 278

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG +G   +    +   +L +ILG GMSSRLFQE+RE+RGL YS+ ++    +
Sbjct: 279 TEQAHVVLGCSGIDRRDERRFALGVLNNILGGGMSSRLFQEIREQRGLAYSVYSYASQHA 338

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D+G+  + +  A      +   I   + +   + +   E+ +         +   E S  
Sbjct: 339 DSGLFSVYAGCAPGRANEVLELIRAELARVAADGLTAAELARGKGMSKGGFVLGLEDSGS 398

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   ++K  +  G ++  + ++  + A+T  D+  +A ++ S   +LA++GP
Sbjct: 399 RMSRLAKGELLYGELMPVDTLLARVDAVTVADVNTLAAELLSRPMSLAVVGP 450


>gi|188582690|ref|YP_001926135.1| processing peptidase [Methylobacterium populi BJ001]
 gi|179346188|gb|ACB81600.1| processing peptidase [Methylobacterium populi BJ001]
          Length = 431

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 145/418 (34%), Positives = 241/418 (57%), Gaps = 3/418 (0%)

Query: 5   ISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S+  +G+TV TE +P   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+A++
Sbjct: 16  VSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRSARK 75

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+ V+
Sbjct: 76  IAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREKGVI 135

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y  +R
Sbjct: 136 LQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYVPER 195

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAV+H   V   E +F      +   ++   +Y GGE   ++ L + +++LG  
Sbjct: 196 MVLAAAGAVEHAEIVEAAERHFGGLKSVEAP-AVVAGIYGGGERRMQKRLEQANLVLGLP 254

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  FSD G+  I + T
Sbjct: 255 GLSFRDEGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFSDCGLFGIGAGT 314

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
           +  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q++  
Sbjct: 315 SGADLAELVDVTIATTRETAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQLLAW 374

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
           G ++  +++I  + A+  E +    + +    PTLA +GP +  +P    +  AL+  
Sbjct: 375 GRVIPPQELIAKVDAVEIEHVRAAGRTLLQGAPTLAAIGP-VKGLPPLPRVAAALQAA 431


>gi|240140001|ref|YP_002964478.1| putative protease [Methylobacterium extorquens AM1]
 gi|240009975|gb|ACS41201.1| putative protease [Methylobacterium extorquens AM1]
          Length = 431

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 145/418 (34%), Positives = 240/418 (57%), Gaps = 3/418 (0%)

Query: 5   ISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +S+  +G+TV TE +P   +A + V + AGSR+ER +EHG++H +EHM FKGT  R+A++
Sbjct: 16  VSRLDNGLTVATETIPGVATATLGVWVGAGSRHERPDEHGLSHLIEHMAFKGTATRSARK 75

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I E+IE VGG+INA TS E TSY A VL E   +AL+++GD+L+ S F+  ++ RE+ V+
Sbjct: 76  IAEDIENVGGEINAATSTESTSYTARVLGEDAGVALDVLGDILTRSVFDAGELAREKGVI 135

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E    ED   D +   F E  + DQ IGRPILG+PETI SF    I ++++R Y  +R
Sbjct: 136 LQEYAAVEDTPDDVVYDAFIETAFPDQPIGRPILGRPETIQSFDRAAIEAYIAREYVPER 195

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAV+H   V   E +F               VY GGE   ++ L + +++LG  
Sbjct: 196 MVLAAAGAVEHAEIVEAAERHFGGLKPVAAP-PAVAGVYGGGERRMQKRLEQANLVLGLP 254

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G +++   +Y  ++ + +LG G++SRL+ EVRE RGL Y I A H  F+D G+  I + T
Sbjct: 255 GLSFRDDGYYALHLFSQVLGGGLTSRLWHEVRETRGLAYDIQAFHWPFNDCGLFGIGAGT 314

Query: 304 AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
           +  ++  L    +   +   E ++  E+ +  A++   L+ + E    R    ++Q++  
Sbjct: 315 SGADLAELVDVTIATTREAAERLDAAELARAKAQLKVSLLTALETPGGRIERNARQLLAW 374

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
           G ++  +++I  + A+  E +    + +    PTLA +GP +  +P+ + +  AL+  
Sbjct: 375 GRVIPPQELIAKVDAVEVEHVRAAGRALLRGAPTLAAIGP-VKGLPSLARVATALQAA 431


>gi|197099530|ref|NP_001127198.1| mitochondrial-processing peptidase subunit beta precursor [Pongo
           abelii]
 gi|75042519|sp|Q5REK3|MPPB_PONAB RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP; Flags: Precursor
 gi|55726057|emb|CAH89804.1| hypothetical protein [Pongo abelii]
          Length = 489

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEPSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IEQLPDF 477

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 478 KQICSNMCWLR 488


>gi|160932219|ref|ZP_02079610.1| hypothetical protein CLOLEP_01054 [Clostridium leptum DSM 753]
 gi|156868821|gb|EDO62193.1| hypothetical protein CLOLEP_01054 [Clostridium leptum DSM 753]
          Length = 416

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 110/402 (27%), Positives = 200/402 (49%), Gaps = 2/402 (0%)

Query: 7   KTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
              +G+ V+ E    + S      I++GS  E   E+G++HF+EHM FKGT +++A++I 
Sbjct: 5   TFPNGLRVLMEKQDHVRSVSFGFWIKSGSAYETAAENGVSHFMEHMAFKGTAEKSARQIA 64

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           EE++ +GG +NAYT+ E+T Y+   L EH+  A  I+  M++    +P DI+ E++V++E
Sbjct: 65  EEMDAIGGQMNAYTAKEYTCYYGRTLTEHLEKAFSILAGMVTRPKLDPGDIQTEKSVIME 124

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI M+ED   D +       VW+    GRPILG  E++      ++   + + Y+ DR+ 
Sbjct: 125 EISMTEDMPEDRVVENQYAGVWRKSSYGRPILGTRESLRRIGRGELKRVLRKRYSPDRVV 184

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGC 245
               G    E  +     +F                Y     +Q+ D  + H+ L   G 
Sbjct: 185 AAVCGNFCREQFLELAHRFFGGQRKGPALVDDCRMAYTRSCVLQEEDQEQTHICLCLPGL 244

Query: 246 AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAK 305
              S      N+L  + G   SSRLFQ +RE+ GL YS+ +    +   G+  I +A + 
Sbjct: 245 DSLSPQLQPLNVLNLVTGGSTSSRLFQRLREELGLAYSVDSGTTAYLSGGLFEIQTAVSP 304

Query: 306 ENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
           E        I++ ++ L   +   E  +   ++ A L+   E +  R   + +  +  G 
Sbjct: 305 ETAERTVEEILKTLEELKTGVSPTEFSRAREQLKAGLVMGMESTSSRVGHMGRNELLKGR 364

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMD 406
           +L  +++++ I+++T E++  VA  IF  S  +++++GP ++
Sbjct: 365 VLTEDELLERINSVTIEEVNQVASHIFDLSRLSVSVVGPKLN 406


>gi|228998581|ref|ZP_04158168.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock3-17]
 gi|229006080|ref|ZP_04163768.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock1-4]
 gi|228755156|gb|EEM04513.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock1-4]
 gi|228761049|gb|EEM10008.1| Uncharacterized zinc protease ymxG [Bacillus mycoides Rock3-17]
          Length = 431

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 130/409 (31%), Positives = 232/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVFEEIKMYEDTPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D    V  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNIDET-FVQTVEQYFGNYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 FQGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYDTMQETLETLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T  D+  + + IF++  + A++ P  + +P
Sbjct: 380 LLLRKHRSLDEIIESVNKVTKTDVDQLIRSIFTNEFSAALISPNGE-LP 427


>gi|226313010|ref|YP_002772904.1| zinc protease [Brevibacillus brevis NBRC 100599]
 gi|226095958|dbj|BAH44400.1| probable zinc protease [Brevibacillus brevis NBRC 100599]
          Length = 417

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 119/410 (29%), Positives = 221/410 (53%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++TE +P + S  + + +  GS+ E ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IQRHTCDNGLRIVTERIPSVRSVALGIWVGTGSKYENEKNNGISHFLEHMFFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI E  +++GG++NA+TS E+T Y+A VL +H P+AL+++ DM  NS F+  ++E+E+N
Sbjct: 62  KEIAETFDEIGGNVNAFTSKEYTCYYARVLDQHAPIALDVLSDMYFNSVFDADELEKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV+EEI M ED   D +    +   +    +G  ILG  + + S   + +       +  
Sbjct: 122 VVIEEISMYEDTPDDLVHDLIARASYSTHPLGYSILGTEDVLRSLKRDDL-LAYIDQHYL 180

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
               V+ V     +  +  ++  F   S + I  ++    + G      +   + H+ L 
Sbjct: 181 PTNTVITVAGNFEDSLIEDIQKRFQAFSRSGIMPTLSTPDFAGNVIAHHKATEQAHLCLS 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G      + Y   +L ++LG  MSSRLFQE+RE+RGL YS+ ++H ++ + G  ++ +
Sbjct: 241 LPGFKVGHPEVYSLILLNNVLGGSMSSRLFQEIREERGLAYSVYSYHSSYKEAGTFHVYT 300

Query: 302 ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            TA E +  +   +  V++ +    I  +E++K   ++   L+ S E +  R   + K  
Sbjct: 301 GTAPEQVGQVFDIVSRVLRDVADHGITDKELNKGKEQLKGSLMLSLESTNSRMSRLGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +  G  L  ++II  I  ++ E ++ VA+++F S  ++A++  P+D  P 
Sbjct: 361 LLLGRHLSLDEIIAKIDRVSHESVLAVAQQLFRSKMSMAMV-SPLDGFPE 409


>gi|253701573|ref|YP_003022762.1| peptidase M16 domain protein [Geobacter sp. M21]
 gi|251776423|gb|ACT19004.1| peptidase M16 domain protein [Geobacter sp. M21]
          Length = 418

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 133/403 (33%), Positives = 227/403 (56%), Gaps = 3/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +  ++GI VITE +P   S  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R++
Sbjct: 2   IKKTILNNGIRVITERIPYASSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTERRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++++ D+  +S+F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPKAVDLLTDIFLHSTFDPEEIEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D +   F +  WK   +G  ILG  E+++  + + II++  + Y +
Sbjct: 122 VVLQEINMMEDTPDDLIHDLFHQHFWKGHPLGMSILGDAESVTGLSRDSIIAYKEQMYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + V   G + H+   + +E Y +       + +  P VY     + ++DL + H+ LG
Sbjct: 182 DDVIVTAAGNLTHDKLTALLEEYLHSVPSGNGRTASTPPVYERRIELVEKDLEQIHVCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK GL YS+ ++  + +D G L + +
Sbjct: 242 LKGVQQSHPQRYDAFIMNAILGGSMSSRLFQEVREKSGLAYSVYSYIASHADAGSLVVYA 301

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             + EN   L   ++  + +   E +   ++D    ++   L+ S E S  R   ++K  
Sbjct: 302 GASPENQAELVEIMLREIGRFKREPVPAEQLDGAREQLKGNLLLSLESSDNRMSRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILG 402
           ++ G+ L   +I++    +T E I  +A  I  +   TL +LG
Sbjct: 362 IYFGTPLPLSEIMEGFDRVTAESIQTLAVDILDNSALTLVMLG 404


>gi|269784705|ref|NP_001161452.1| mitochondrial-processing peptidase subunit beta [Nasonia
           vitripennis]
          Length = 477

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 109/432 (25%), Positives = 201/432 (46%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           + S   +G+ V +E     +A V + I AGSR E  E +G+AHF+EHM FKGT KR+  +
Sbjct: 46  KTSTLDNGMRVASEDSGAATATVGLWIDAGSRYETDENNGVAHFMEHMAFKGTAKRSQTD 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    S+IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVFYAKCLSQDVPKAVEILSDIIQNSKLGESEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +      + ++   +GR ILG  E I S + + ++S+V  NY   R
Sbjct: 166 LREMQEVETNLQEVVFDHLHSVAYQGTPLGRTILGPTENIKSISRKDLVSYVRNNYGPPR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRD-LAEEHMM 239
             +   G VDH   V   + +F         +I +      Y G E   + D +   H+ 
Sbjct: 226 FVLAGAGGVDHNQLVQLADQHFGKMKGPIYDEIPDLNPVYRYTGSEIRVRDDSMPLAHVA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   G  ++  D     +  +++G    S+                  LC+S  + +  +
Sbjct: 286 IAVEGAGWRDADNIPLMVANTLMGAWDRSQGGGANNATTLARIAASGELCHSFQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  I           +  ++ +    L  +I ++E+++    +   ++   + +  
Sbjct: 346 KDTGLWGIYFVCEPMQCHDMVWNVQQEWMRLSTSITEKEVNRAKNILKTNMLLQLDGTTA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   +I   I ++T + I  +  K I+   P +A +GP ++++  
Sbjct: 406 VCEDIGRQMLCYDRRIPLHEIEARIESVTAKTIQDIGMKYIYDRCPVIAAVGP-VENLTD 464

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 465 YNRIRGAMYWLR 476


>gi|327273548|ref|XP_003221542.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Anolis carolinensis]
          Length = 486

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 98/432 (22%), Positives = 189/432 (43%), Gaps = 13/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           + S   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 56  KTSLLENGLRVASENSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 115

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 116 LELEIENMGAHLNAYTSREQTVYFAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 175

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  + I S     ++ +++ +Y   R
Sbjct: 176 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTDNIKSINRNDLVEYITTHYKGPR 235

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCS---VAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           M +   G V H+  +   + +F                         ++   +   H+ +
Sbjct: 236 MVLAAAGGVAHDELLELAKYHFGNLPSVERGGAPALPLCHFTGSEIRVRDDKMPLAHIAI 295

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S            +V     LC+S  + +  ++
Sbjct: 296 AVEAAGWCHPDTLPLMVANTLIGNWDRSFGGGVNLSSKLAQVACHGNLCHSFQSFNTCYT 355

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        I  +   +      L  ++ + E+ +    +   ++   + S   
Sbjct: 356 DTGLWGVYMVCEATTIEEMMHFVQREWIRLCTSVTEDEVARTRNLLKTNMLLQLDGSTPI 415

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I AI  + I  V  K      P +A +GP ++H+P  
Sbjct: 416 CEDIGRQMLCYNRRIPIPELEARIEAIDAQTIRDVCTKYIYDKCPAVAAVGP-LEHLPDY 474

Query: 412 SELIHALEGFRS 423
           + L   +   R+
Sbjct: 475 NRLRSGMYWLRA 486


>gi|319408227|emb|CBI81880.1| processing protease protein [Bartonella schoenbuchensis R1]
          Length = 430

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 172/420 (40%), Positives = 262/420 (62%), Gaps = 3/420 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + IS+ S+G+T+ T  M  IDS  + + ++ GSRNE   +HG+AH LEHM FKGT  R
Sbjct: 1   MGVDISRLSNGLTIATHTMQQIDSVALGIWVKVGSRNETFTQHGIAHLLEHMAFKGTENR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I  +IE VGG+INA+TS+E T+Y A VLK+ +PLA++I+ D++  S F+  ++ERE
Sbjct: 61  TAFKIAADIEDVGGEINAHTSIETTAYFARVLKDDIPLAIDILSDIMICSKFDEDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + V+++EIG + D   D +   F+E  ++ Q +GR ILG P+T+ SFT   + SF++++Y
Sbjct: 121 KQVIIQEIGATYDVPDDIVFDHFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMNKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           +ADRM VV  GAV+HE  + +VES  +             A Y+GG++ + RDL +  ++
Sbjct: 181 SADRMIVVAAGAVNHESFLREVESRLSTFRSHSTTSFTNLANYIGGDFREYRDLMDTQVV 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LGF G  Y +RDFY   IL+ ILG GMSSRLFQEVREKRGLCYSI + H  FSD G+  I
Sbjct: 241 LGFEGRPYHARDFYTAQILSIILGGGMSSRLFQEVREKRGLCYSIYSFHWGFSDTGLFGI 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT +E +  L   I++ +    +NI + E+ +  A+  A    SQE    +A  I++Q
Sbjct: 301 HAATGQEGLETLLPVILDELSKASKNIHESELQRARAQYRANFTISQENPSSQAHLIARQ 360

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHAL 418
           ++     +   ++I+ +  IT + +  +A  +F +S PTLA +GP +  +    +L   L
Sbjct: 361 MLLYDRPIPVSEMIERLELITPKRLTELATHLFTNSKPTLAAIGP-VGRLINFDDLTSTL 419


>gi|294631767|ref|ZP_06710327.1| M16 family peptidase [Streptomyces sp. e14]
 gi|292835100|gb|EFF93449.1| M16 family peptidase [Streptomyces sp. e14]
          Length = 459

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 126/416 (30%), Positives = 219/416 (52%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E     G  H+LEH+LFKGT++R+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALGGATHYLEHLLFKGTSERS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIREEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDSPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAK--------IKESMKPAVYVGGEYIQKRD 232
              + V C G +DH   V +V + F      +         ++  +     G   IQ R 
Sbjct: 214 PTHLVVACAGNIDHHKVVRRVRAAFEKAGAFRNAEAVPIAPRDGRRSLRTAGRVEIQGRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHIVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLRICRDELDQVADNGLPDDEIARAIGQLQGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+A+T +++  VA+ I    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQISVDDMLARIAAVTPDEVRAVARDILGQRPSLSVIGPLKDK 449



 Score = 36.8 bits (83), Expect = 7.2,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 37/96 (38%), Gaps = 2/96 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++    MF  S         +DT++A+T + I 
Sbjct: 146 EEDVDVERGAILEEIAMTEDDPGDCVHDLFAHTMFGDSPLGRPVLGTVDTVNALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
              KK +  T  +      +DH      +  A E  
Sbjct: 206 RFYKKHYDPTHLVVACAGNIDHHKVVRRVRAAFEKA 241


>gi|297156776|gb|ADI06488.1| putative protease [Streptomyces bingchenggensis BCW-1]
          Length = 441

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 125/416 (30%), Positives = 215/416 (51%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 16  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPVLNGATHYLEHLLFKGTQRRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S  + +D+E ER
Sbjct: 76  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIDAADVEAER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI M+EDD  D +   F+  +  D  +GRP+LG  +T++    ++I  F  ++Y 
Sbjct: 136 GVVLEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNGLGRDQIARFYKKHYD 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F+               ++  +     G   +Q R 
Sbjct: 196 PTHLVVAAAGNVDHAAVVRQVRKAFDKAGALSRTDAVPVAPRDGTRTIRAAGRVEVQGRK 255

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 256 TEQAHVVLGMPGIARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 315

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +         +     + +  +    +   E+ +   ++    +   E +  
Sbjct: 316 DCGLFGVYAGCRPSQAADVLKICRDELDHVAQHGLTDEELRRAVGQLRGSTVLGLEDTGA 375

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  ++A+T +++  VA  +    P+L+++GP  D 
Sbjct: 376 LMNRIGKSELCWGDQMSVDDMLARMAAVTPDEVREVAHDVLGQRPSLSVIGPLKDK 431


>gi|294500889|ref|YP_003564589.1| zinc protease [Bacillus megaterium QM B1551]
 gi|294350826|gb|ADE71155.1| zinc protease [Bacillus megaterium QM B1551]
          Length = 414

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 132/409 (32%), Positives = 226/409 (55%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + V I  GSR+E  E +G++HFLEHM FKGT  R+A
Sbjct: 2   IKRYTCKNGVRIVLENIPTVRSVAIGVWIGTGSRSEHPEINGVSHFLEHMFFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  NSSF+  ++ RE+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHADQALDVLADMFFNSSFDEEELAREKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +     + V+ +  +G PILG  +T+ +F  + +  ++ + Y  
Sbjct: 122 VVYEEIKMYEDTPDDIVHDLLGKAVYGNHPLGYPILGTEDTLKTFNGDSLRQYMEQMYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G +D    + QVE+YF   + +          +      +K++  + H+ LG
Sbjct: 182 ENIVISVAGNIDES-FIQQVENYFGTYTSSHSAHQYVQPEFHTNHIARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G++ I  
Sbjct: 241 FKGLPIGGEDVYSLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYRDSGLVTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  ++ E +  L +  I  +E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSHQLDVLYDTVQETLYDLKDKGITDKELSNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +  G     ++I+D ++A+T + + G+A+ IF     L+++ P  D +P
Sbjct: 361 LMLGYHRSLDEILDLVNAVTKDSVNGLARDIFKDEFALSLISPSGD-LP 408


>gi|225452974|ref|XP_002284370.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 523

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 119/424 (28%), Positives = 207/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT +RTA+
Sbjct: 90  RVTTLPNGLRVATESNLAARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTAQRTAR 149

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A V+ + VP AL+I+ D+L NS F+ + I RER+V
Sbjct: 150 DLEEEIENMGGHLNAYTSREQTTYYAKVMDKDVPKALDILSDILQNSKFDENRINRERDV 209

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + I + T   + +++S +YTA 
Sbjct: 210 ILREMEEVEGQTEEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKAHLQNYISTHYTAP 269

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      S                +   D+    
Sbjct: 270 RMVIAASGAVKHEDIVEQVKKLFTKLSTDPTTASQLVVEQPAIFTGSEVRMIDDDIPLAQ 329

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + FNG ++   D     ++ S+LG    +    +              +  S+ A + 
Sbjct: 330 FAVAFNGASWTDPDSIALMVMQSMLGSWNKNAGGGKHMGSELAQRVGINEIAESMMAFNT 389

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + L+   + +
Sbjct: 390 NYKDTGLFGVYAIAKPDCLDDLAYAIMYEISKLCYRVSEADVTRARNQLKSSLLLHIDGT 449

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 450 SPVAEDIGRQLLTYGRRIPFAELFARIDAVDASTVKRVANRFIFDRDVAIAAMGP-IQGL 508

Query: 409 PTTS 412
           P  +
Sbjct: 509 PDYN 512


>gi|294815458|ref|ZP_06774101.1| Protease [Streptomyces clavuligerus ATCC 27064]
 gi|294328057|gb|EFG09700.1| Protease [Streptomyces clavuligerus ATCC 27064]
          Length = 441

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 126/415 (30%), Positives = 218/415 (52%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 16  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPSLNGATHYLEHLLFKGTERRS 75

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 76  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILQEDVDAER 135

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T +++  F  ++Y 
Sbjct: 136 GVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVRRFYRKHYD 195

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F                ++  +     G   +  R 
Sbjct: 196 PTHLVVAAAGNVDHATVVRQVRRAFERAGALDRVDAVPLAPRDGQRAVRTAGRVELIDRR 255

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 256 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 315

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +     ++  EI +   ++    +   E +  
Sbjct: 316 DCGLFGVYAGCRPSQVHDVLKICRDELDRVASHGLDDDEIGRAIGQLSGSTVLGLEDTGA 375

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G+ +  + ++  I+A+T +++  VA ++    P+LA++GP  D
Sbjct: 376 LMNRIGKSELCWGAQMSVDDMLTRIAAVTPDEVREVAAEVLGRRPSLAVIGPLKD 430



 Score = 36.4 bits (82), Expect = 8.1,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 38/94 (40%), Gaps = 2/94 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           Q ++D E   I  ++  +++       ++    MF  +         +DT++A+T + + 
Sbjct: 128 QEDVDAERGVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVR 187

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
              +K +  T  +      +DH     ++  A E
Sbjct: 188 RFYRKHYDPTHLVVAAAGNVDHATVVRQVRRAFE 221


>gi|254393065|ref|ZP_05008226.1| protease [Streptomyces clavuligerus ATCC 27064]
 gi|326443809|ref|ZP_08218543.1| M16 family endopeptidase [Streptomyces clavuligerus ATCC 27064]
 gi|197706713|gb|EDY52525.1| protease [Streptomyces clavuligerus ATCC 27064]
          Length = 459

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 126/415 (30%), Positives = 218/415 (52%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRRTTLPGGLRVVTETLPSVRSATFGIWAHVGSRDETPSLNGATHYLEHLLFKGTERRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILQEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T +++  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVRRFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F                ++  +     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFERAGALDRVDAVPLAPRDGQRAVRTAGRVELIDRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +     ++  EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDRVASHGLDDDEIGRAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G+ +  + ++  I+A+T +++  VA ++    P+LA++GP  D
Sbjct: 394 LMNRIGKSELCWGAQMSVDDMLTRIAAVTPDEVREVAAEVLGRRPSLAVIGPLKD 448



 Score = 36.4 bits (82), Expect = 8.1,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 38/94 (40%), Gaps = 2/94 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           Q ++D E   I  ++  +++       ++    MF  +         +DT++A+T + + 
Sbjct: 146 QEDVDAERGVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALE 419
              +K +  T  +      +DH     ++  A E
Sbjct: 206 RFYRKHYDPTHLVVAAAGNVDHATVVRQVRRAFE 239


>gi|108799068|ref|YP_639265.1| peptidase M16-like protein [Mycobacterium sp. MCS]
 gi|119868183|ref|YP_938135.1| peptidase M16 domain-containing protein [Mycobacterium sp. KMS]
 gi|126434671|ref|YP_001070362.1| peptidase M16 domain-containing protein [Mycobacterium sp. JLS]
 gi|108769487|gb|ABG08209.1| peptidase M16-like protein [Mycobacterium sp. MCS]
 gi|119694272|gb|ABL91345.1| peptidase M16 domain protein [Mycobacterium sp. KMS]
 gi|126234471|gb|ABN97871.1| peptidase M16 domain protein [Mycobacterium sp. JLS]
          Length = 429

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 210/409 (51%), Gaps = 7/409 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RT
Sbjct: 5   TVRRTTLPGGLRVVTERIPSVRSASVGVWVNVGSRDEGPTVAGAAHFLEHLLFKSTPTRT 64

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++        D+E ER
Sbjct: 65  AVDIAQAVDAVGGELNAFTAREHTCYYAHVLDADLELAVDLVADVVLRGRCAVEDVEVER 124

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +VVLEEI M +DD  D L   F   ++    +GRP++G  E+I + T  ++ SF  R Y 
Sbjct: 125 DVVLEEIAMRDDDPEDTLGDVFLSAMFGSHPVGRPVIGSVESIEAMTRNQLHSFHVRRYV 184

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNV-----CSVAKIKESMKPAVYVGGEYIQKRDLAE 235
            +RM +   G ++H+  V+    YF        S    ++            +  RD  +
Sbjct: 185 PERMVLAVAGNIEHDDVVAMARKYFGPRLIRGQSAVPPRKGTGRVPGRPTLQLINRDAEQ 244

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H+ +G           +   +L + LG G+SSRLFQE+RE RGL YS+ +  + FSD+G
Sbjct: 245 THLSMGVRTPGRHWDHRWALAVLNTALGGGLSSRLFQEIRETRGLAYSVYSTVDTFSDSG 304

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRAL 354
            L I +A   E    +      V++++    I + E       +   L+   E S  R  
Sbjct: 305 ALSIYAACQPERFDEVVRVTTAVLENVARDGITESECRIAKGSLRGGLVLGLEDSGSRMH 364

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            I +  +  G     +  ++ I A+T +++  VA+++ + +   A+LGP
Sbjct: 365 RIGRSELNYGKHRSIDHTLEQIGAVTRDEVNAVARQLLTRSFGAAVLGP 413


>gi|125542883|gb|EAY89022.1| hypothetical protein OsI_10505 [Oryza sativa Indica Group]
          Length = 533

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 114/424 (26%), Positives = 197/424 (46%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E ++  G+AHF+EHMLFKGT  R A 
Sbjct: 100 RVTTLPNGLRVATESSLASRTATVGVWIDAGSRYETEDSAGVAHFVEHMLFKGTGDRNAA 159

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VL + VP AL I+ D+L  S    S IERER+V
Sbjct: 160 QLEEEIENIGGHLNAYTSREQTTYYAKVLDKDVPRALNILADILQRSKLEESRIERERDV 219

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + +        ++   +GRPILG  E + S T E +  ++  +YTA 
Sbjct: 220 ILREMEEVEGQYEEVIFDHLHATAFQYTSLGRPILGSAENVKSITQEDLQKYIETHYTAP 279

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   GAV H+  V      FN         SM  +         +  + ++ M L  
Sbjct: 280 RMVITAAGAVKHDDIVEMATKLFNDLPTDPTTTSMLVSTQPACFTGSEVRIIDDDMPLAQ 339

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYS-------------ISAHHE 289
              A+    +   + +A ++   M     +     + +                I A + 
Sbjct: 340 FAVAFNGASWVDPDSIALMVMQSMLGSWNKSAGGGKHMGSELVQRVAINDIAESIMAFNT 399

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I++ +  L   + + ++ +   ++ + +    + S
Sbjct: 400 NYKDTGLFGVYAVAKPDCLDDLAFAIMQEISKLSYRVTEEDVIRARNQLKSSIQLHLDGS 459

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q++  G  +   ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 460 TAVVEDIGRQLLIYGRRIPIPELFARIDAVDASTVKRVANRFIFDQDIAIAAMGP-IQGL 518

Query: 409 PTTS 412
           P  +
Sbjct: 519 PDYN 522


>gi|197117697|ref|YP_002138124.1| zinc-dependent peptidase PqqL family protein [Geobacter
           bemidjiensis Bem]
 gi|197087057|gb|ACH38328.1| zinc-dependent peptidase, PqqL family [Geobacter bemidjiensis Bem]
          Length = 418

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 134/403 (33%), Positives = 226/403 (56%), Gaps = 3/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +  ++GI VITE +P   S  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R++
Sbjct: 2   IKKTILNNGIRVITERIPYASSVSIGIWVANGSRHERRESNGVAHFIEHLLFKGTERRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P A++++ D+  +S+F+P +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPKAVDLLTDIFLHSTFDPEEIEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D +   F +  WK   +G  ILG  E+++  T + II++  + Y +
Sbjct: 122 VVLQEINMMEDTPDDLIHDLFHQHFWKGHPLGMSILGDAESVTGLTRDAIIAYKEQMYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + V   G + H+   + +E Y +       +    P VY     + ++DL + H+ LG
Sbjct: 182 DDVIVTAAGNLTHDKLTALLEEYLHCVPSGNGRTESAPPVYERRIELVEKDLEQIHVCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
             G        Y   I+ +ILG  MSSRLFQEVREK GL YS+ ++  + +D G L + +
Sbjct: 242 LKGVQQSHPQRYDAFIMNAILGGSMSSRLFQEVREKSGLAYSVYSYIASHADAGSLVVYA 301

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             + EN   L   ++  + +   E +   ++D    ++   L+ S E S  R   ++K  
Sbjct: 302 GASPENQAELLEIMLREIGRFKREPVPAEQLDGAREQLKGNLLLSLESSDNRMSRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILG 402
           ++ G+ L   +I++    +T E I  +A  I  +   TL +LG
Sbjct: 362 IYFGTPLPLSEIMEGFDRVTAESIQTLAVDILDNSALTLVMLG 404


>gi|147765656|emb|CAN71501.1| hypothetical protein VITISV_006460 [Vitis vinifera]
          Length = 523

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 119/424 (28%), Positives = 207/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT +RTA+
Sbjct: 90  RVTTLPNGLRVATESNLAARTATVGVWIDAGSRFETDETNGTAHFLEHMIFKGTAQRTAR 149

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A V+ + VP AL+I+ D+L NS F+ + I RER+V
Sbjct: 150 DLEEEIENMGGHLNAYTSREQTTYYAKVMDKDVPKALDILSDILQNSKFDENRINRERDV 209

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + I + T   + +++S +YTA 
Sbjct: 210 ILREMEEVEGQTEEVIFDHLHATAFQYTPLGRTILGPAQNIKTITKAHLQNYISTHYTAP 269

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      S                +   D+    
Sbjct: 270 RMVIAASGAVKHEDIVEQVKKLFTKLSTDPTTASQLVVEQPAIFTGSEVRMIDDDIPLAQ 329

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + FNG ++   D     ++ S+LG    +    +              +  S+ A + 
Sbjct: 330 FAVAFNGASWTDPDSIALMVMQSMLGSWNKNAGGGKHMGSELAQRVGINEIAESMMAFNT 389

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + L+   + +
Sbjct: 390 NYKDTGLFGVYAIAKPDCLDDLAYAIMYEISKLCYRVSEADVTRARNQLKSSLLLHIDGT 449

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 450 SPVAEDIGRQLLTYGRRIPFAELFARIDAVDASTVKRVANRFIFDRDVAIAAMGP-IQGL 508

Query: 409 PTTS 412
           P  +
Sbjct: 509 PDYN 512


>gi|91205337|ref|YP_537692.1| protease [Rickettsia bellii RML369-C]
 gi|122425770|sp|Q1RJ61|Y522_RICBR RecName: Full=Uncharacterized zinc protease RBE_0522
 gi|91068881|gb|ABE04603.1| protease [Rickettsia bellii RML369-C]
          Length = 412

 Score =  202 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 153/405 (37%), Positives = 241/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + GSR E   E G+AHFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGSRYENPGEEGIAHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E T Y++ VL E+   AL II D++ NS+F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHEKTVYYSRVLSENCNKALAIIADIVQNSAFAEEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  ++D+  D +  +F   V+KDQ +G+PILG  +TI +F  +  + F  ++Y 
Sbjct: 124 QVILQEIAHAQDNPDDLVYEKFYNSVFKDQPLGKPILGTSKTIETFNRDHFLKFTGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+  Y+   G VDHE  V + E  F+  +  + K +  PA Y+GG     +DL +  ++L
Sbjct: 184 AENFYLSIAGNVDHEEIVKEAERLFSSLTQGE-KSNFSPAKYIGGHSFINKDLEQTTLIL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T +LA I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLERLYQTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSPYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L + +   ++ + E ++Q EI++   +I + L  +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLAAELKNEIKRMAEQVKQEEIERARTQIRSNLQMAQEKVAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I  I   DI+  A +IFSS+ T A++GP 
Sbjct: 363 YAVFGKYISPEEIMEIIMNIKAADIIQTANRIFSSSATSAVIGPN 407


>gi|114764938|ref|ZP_01444111.1| peptidase, M16 family protein [Pelagibaca bermudensis HTCC2601]
 gi|114542650|gb|EAU45674.1| peptidase, M16 family protein [Roseovarius sp. HTCC2601]
          Length = 420

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 143/392 (36%), Positives = 224/392 (57%), Gaps = 2/392 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + ++   +G+ +++E M    SA + V + AG RNER E++G+AHFLEHM FKGT  R
Sbjct: 1   MTVELTTLKNGLRIVSERMDGLQSASIGVWVTAGGRNERIEQNGVAHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A +I E IE VGG INAYTS E T+Y+A VL+    LAL++I D+L N  F+  +IE E
Sbjct: 61  SALQIAEAIEDVGGYINAYTSREVTAYYARVLENDTKLALDVIADILRNPVFDEREIETE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R+V+L+EIG + D   D +     E  ++ Q +GR ILG+   +  F    + +FV  +Y
Sbjct: 121 RHVILQEIGQALDTPDDVIFDWLQERAYQKQPLGRTILGEEANVRGFGKGDLETFVDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             +++ +   G+VDHE  VSQ E+ F      K     + A + GGE  +++ L + H  
Sbjct: 181 GPEQLIISAAGSVDHEALVSQAEALFGDMGSRKAAGP-ETARFTGGEIRREKQLEQAHFA 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y+   FY + I +  LG GMSSRLFQE+REKRGLCY+I A    + D G++ +
Sbjct: 240 LAFEGPGYRDPGFYTSQIYSIALGGGMSSRLFQEIREKRGLCYTIFAQSGAYEDTGLMTV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T+ + +  L    ++ ++   E++   EI +  A++ A L+   E S  RA  +++ 
Sbjct: 300 YAGTSGDELADLAHLTIDEMKRAAEDMSPEEIARARAQMKAGLLMGLESSSSRAERMARM 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKI 391
           V   G +   E  +  I  +T  D+   A+++
Sbjct: 360 VQIWGKVPPIEDTVAKIDNVTTGDVRLFAEQM 391


>gi|297191696|ref|ZP_06909094.1| protease [Streptomyces pristinaespiralis ATCC 25486]
 gi|297151024|gb|EDY65356.2| protease [Streptomyces pristinaespiralis ATCC 25486]
          Length = 459

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 131/428 (30%), Positives = 224/428 (52%), Gaps = 12/428 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E     G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTTLPGGLRVVTETLPSVRSATFGIWANVGSRDETPSLGGATHYLEHLLFKGTHKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISAAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILQEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T +++  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F+               ++  +     G   +Q R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFDKAGALSRTDAVPTPPRDGSRALRTAGKVELQNRR 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGVPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +   + +   EI++   ++    +   E +  
Sbjct: 334 DTGLFGVYAGCRPSQVHDVLKICRDELDRVASDGLPDEEIERAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
               I K  +  GS +  ++++  ISA+T +++  VA ++    P+L+++GP  D     
Sbjct: 394 LMNRIGKSELCWGSQMSVDEMLARISAVTPDEVRAVAGEVLGQRPSLSVIGPLKDK--QA 451

Query: 412 SELIHALE 419
             L  A+ 
Sbjct: 452 DRLHEAVS 459



 Score = 37.2 bits (84), Expect = 4.7,   Method: Composition-based stats.
 Identities = 16/99 (16%), Positives = 40/99 (40%), Gaps = 2/99 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           Q ++D E   I  ++  +++       ++    MF  +         +DT++A+T + + 
Sbjct: 146 QEDVDAERGVILEEIAMTEDDPGDCVHDLFAHTMFGDTPLGRPVLGTVDTVNALTADRVR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGFRSM 424
              KK +  T  +      +DH     ++  A +   ++
Sbjct: 206 RFYKKHYDPTHLVVAAAGNVDHATVVRQVRRAFDKAGAL 244


>gi|298290606|ref|YP_003692545.1| peptidase M16 domain protein [Starkeya novella DSM 506]
 gi|296927117|gb|ADH87926.1| peptidase M16 domain protein [Starkeya novella DSM 506]
          Length = 428

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 150/420 (35%), Positives = 251/420 (59%), Gaps = 3/420 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+K  SG+TV+T+ MP + +A + +   AGSR+E  +EHG++H LEHM FKGT +R+A+
Sbjct: 10  RITKLDSGVTVVTDAMPHLATASLGIWAGAGSRDEEPDEHGISHLLEHMAFKGTKRRSAR 69

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I EEIE VGGDINA TS+EHT+Y+A VL E VPLA++++ D+L+  +F+P ++ RE NV
Sbjct: 70  AIAEEIEAVGGDINAATSVEHTTYNARVLAEDVPLAIDVLSDILAEPAFDPEELTREHNV 129

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +++EIG + D   D +   F E  +  Q IGR ILG P+++ SF P+++ ++++RNY A 
Sbjct: 130 IVQEIGAALDTPDDLVFDLFQERAFPGQPIGRSILGTPQSVRSFGPDRLRAYLARNYRAP 189

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           ++ V   GAVDH+  V++V+              +      G E    RDL + H+++G 
Sbjct: 190 KLIVAAAGAVDHDSIVAEVDRRLGGFGREDKPAPVAGHYQGGVEIGGGRDLEQAHLLIGL 249

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
            G +Y+   F+   +  ++LG GMSSRLFQEVRE RGLCY++ + H  ++D G+  + + 
Sbjct: 250 PGLSYRDPGFHALQVFTNVLGGGMSSRLFQEVREARGLCYAVYSFHWGYADTGLFGVYAG 309

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T   ++  L   +V+ +   ++ + + E+ +  A+    L+ + E S  RA ++++Q++ 
Sbjct: 310 TDGGDVDELVDVVVDEIAGAIDTMTEVELARSKAQAKVGLLAALESSGARADQLARQMLA 369

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHALEGF 421
            G  +  E+I+  + A+T E      + + +   PT A LGP    + + + +   L   
Sbjct: 370 FGRPIPLEEIVAKVEAVTLEGAKAAGRALIARGRPTFAALGPAK-PLESAARIAERLSAA 428


>gi|288921718|ref|ZP_06415985.1| peptidase M16 domain protein [Frankia sp. EUN1f]
 gi|288346890|gb|EFC81200.1| peptidase M16 domain protein [Frankia sp. EUN1f]
          Length = 467

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 131/413 (31%), Positives = 211/413 (51%), Gaps = 7/413 (1%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ VITE +P   S  + V +  GSR+E     G +H+LEH+LFKGT  R 
Sbjct: 47  TVRRTVLPGGLRVITEKVPGVRSVAIGVWVGVGSRDETPLTGGCSHYLEHLLFKGTPSRD 106

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I   IE VGGD+NA+T+ E+T Y+A VL   + LA++++ DM++NS     D+E ER
Sbjct: 107 ALSISAAIEAVGGDLNAFTAKEYTCYYARVLDSDLDLAVDVVCDMVANSLVTADDVEAER 166

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M EDD  D +   F++ V    ++GRP+LG  +TI +   E I  +    Y 
Sbjct: 167 GVILEEIAMHEDDPGDVVHDVFADAVLGSSVLGRPVLGTVDTIQALGRETIFDYYRERYA 226

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGEYIQKRDLAE 235
              + +   G ++H+  + +V   F        +         P     G  + +R   +
Sbjct: 227 PPALVISIAGNLEHDQALDRVVRAFADHLGGPARPQDVRRGEYPFPPPPGIVVDRRPTEQ 286

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H++LG  G +      Y   +L++ LG GMSSRLFQEVREKRGL YS+ +    F+D G
Sbjct: 287 AHVVLGTVGLSRHDPRRYALGVLSTALGGGMSSRLFQEVREKRGLAYSVYSFDNQFADAG 346

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           +  + +         +     E VQ +    I Q E+D+   +    L+ + E +  R  
Sbjct: 347 LFGVYAGCTPGRADNVLEICREQVQQIAEHGITQEELDRARGQNRGGLVLNLEDTGSRMS 406

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
            + K  +  G +L  ++++  + A+T +D+  +A ++      L ++GP  DH
Sbjct: 407 RLGKSELVHGELLSVDEVLARVEAVTLDDVRALAGELVDQPWALGVIGPFDDH 459


>gi|118479025|ref|YP_896176.1| zinc protease [Bacillus thuringiensis str. Al Hakam]
 gi|118418250|gb|ABK86669.1| zinc protease [Bacillus thuringiensis str. Al Hakam]
          Length = 432

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 427


>gi|47569082|ref|ZP_00239771.1| peptidase, M16 family [Bacillus cereus G9241]
 gi|47554244|gb|EAL12606.1| peptidase, M16 family [Bacillus cereus G9241]
          Length = 432

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 427


>gi|13959067|gb|AAK51086.1|AF363285_1 mitochondrial processing peptidase [Avicennia marina]
          Length = 527

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 117/425 (27%), Positives = 207/425 (48%), Gaps = 17/425 (4%)

Query: 4   RISKTSSGITVITEVMPIDS-AFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ + TE   + + A V V I AGSR E +E +G AHFLEHM+FKGT +R A+
Sbjct: 93  RVTTLPNGLRIATESTLVSTTATVGVFIDAGSRFESEESNGTAHFLEHMIFKGTERRNAR 152

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ EEIE +GG +NAYTS E T+Y+A V+ + VP AL+I+ D+L NS F+   I RER+V
Sbjct: 153 ELEEEIENMGGHLNAYTSREQTTYYAKVMDKDVPRALDILSDILQNSRFDEQRIIRERDV 212

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  E I     E + +++S +YTA 
Sbjct: 213 ILREMEEVEGQTEEVIFDHLHASAFQYTPLGRTILGPAENIKKIGKEHLRTYISTHYTAP 272

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAK------IKESMKPAVYVGGEYIQKRDLAEE 236
           R  VV  GAV HE  V +V+  F   S         + +            +   D+   
Sbjct: 273 RTVVVASGAVKHEDFVEEVKKLFTRLSSDPTTASELVAKEPAIFFTGSEVRMLDDDIPLA 332

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHH 288
              + F G ++   D     ++ S+LG    + +  +              +  S+ A +
Sbjct: 333 QFAVAFEGASWTDPDSIALMVMQSMLGSWNKNAVGGKHMGSELAQRVGINEIAESMMAFN 392

Query: 289 ENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQER 348
            N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + L+   + 
Sbjct: 393 TNYKDTGLFGVYAIAKPDCLDDLAYAIMYEITKLCYRVSEADVIRARNQLKSSLLLHMDG 452

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDH 407
           +   A +I +Q++  G  +   ++   I A+    I  VA + IF     ++ +GP +  
Sbjct: 453 TSPVAEDIGRQLLTYGRRIPYAELFARIDAVDPSTIKRVANRFIFDRDVAISAVGP-IQG 511

Query: 408 VPTTS 412
           +P  +
Sbjct: 512 LPDYN 516


>gi|225871754|ref|YP_002753208.1| insulinase family protein [Acidobacterium capsulatum ATCC 51196]
 gi|225791408|gb|ACO31498.1| insulinase family protein [Acidobacterium capsulatum ATCC 51196]
          Length = 424

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 127/410 (30%), Positives = 218/410 (53%), Gaps = 3/410 (0%)

Query: 2   NLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R +   +G+T++TE M  + S  + V I  GSR+E  E +G++HF+EHM+FKGT  R+
Sbjct: 6   DIRRTVLPNGLTILTERMEHVRSVAMGVWINTGSRHELPEVNGISHFVEHMVFKGTRNRS 65

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I  E++ +GG+++A+T  E   ++  VL EHVP A E++ D++ N  F+  +I RER
Sbjct: 66  AQRIAREVDAIGGNMDAFTGKETICFNMKVLDEHVPTATEVLSDLVLNPVFSHEEITRER 125

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            VVLEEI + ED+    +   F +  WKD  +G+PILG  ET+  F  + +  +    + 
Sbjct: 126 GVVLEEIKIDEDNPDYLVHELFVQSFWKDHPLGKPILGTRETVKRFEQDTLFGYYGDRFL 185

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
              M     G ++H+  V Q+   F      + + S  P        ++ +   E+  + 
Sbjct: 186 GGNMTFSAAGHLEHDAFVEQIRRRFESLPAGRSELSQTPPTTTARIQMRNKKSLEQVQLC 245

Query: 241 -GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
            G       S D Y+T +L +ILG GMSSRLFQ VRE+ GL YSI +    + D G L +
Sbjct: 246 LGVPAPHVSSEDRYITLMLNTILGGGMSSRLFQTVREEHGLAYSIYSDLAPYRDTGSLCV 305

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T+  N+  + + ++  +Q + +  +   E+ +   ++   L+ S E S  R   +++
Sbjct: 306 YAGTSAANVERMITLVMAELQRMKQEPVTADELRRAKDQLKGNLLLSLESSMSRMSNLAR 365

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHV 408
           Q M+ G     + I+  + A+T E I+ +A+++F        L   +D V
Sbjct: 366 QEMYFGHFFSFDDILTQVEAVTVEQIMQLAQRLFRPELVAVTLLGRLDGV 415


>gi|313747444|ref|NP_001186401.1| mitochondrial-processing peptidase subunit beta [Gallus gallus]
          Length = 486

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 98/431 (22%), Positives = 192/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R+S   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 56  RVSPLENGLQVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 115

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 116 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 175

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 176 LREMQEVETNLQEVVFDYLHATAYQKTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 235

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F     A    +      +       I+   +   H+ +
Sbjct: 236 IVLAAAGGVCHDELLDLAKCHFGNLPSAPEGGLPPLPPCSFTGSEIRIRDDKMPLAHIAI 295

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S            ++     LC+S  + +  ++
Sbjct: 296 AVEAAGWSDPDTIPLMVANTLIGNWDRSFGGGVNLSSKLAQIACHGNLCHSFQSFNTCYT 355

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   +      L  ++ + E+ +    +   ++   + S   
Sbjct: 356 DTGLWGLYMVCEPSTVQDMVHFVQREWIRLCTSVTENEVARAKNLLKTNMLLQLDGSTPI 415

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I AI  + I  V  K      P +A LGP ++ +P  
Sbjct: 416 CEDIGRQMLCYKRRIPIPELEARIEAIDAQTIREVCTKYIYDKHPAVAALGP-IEQLPEY 474

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 475 NKICSGMYWLR 485


>gi|318062385|ref|ZP_07981106.1| putative protease [Streptomyces sp. SA3_actG]
 gi|318078518|ref|ZP_07985850.1| putative protease [Streptomyces sp. SA3_actF]
          Length = 470

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 131/415 (31%), Positives = 224/415 (53%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 45  TVRRTTLPGGLRVVTETLPSVRSATFGIWAGVGSRDESPTLNGATHYLEHLLFKGTRRRT 104

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S+ + +D++ ER
Sbjct: 105 ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSTLDAADVDAER 164

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   ++I  F  R+Y 
Sbjct: 165 GVILEEIAMTEDDPGDVVHDLFAHTMLGDTPLGRPVLGTVDTINALGRDQIARFYKRHYD 224

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV + F+               +E  +     G   +Q R 
Sbjct: 225 PTHLVVAAAGNVDHAKVVRQVRAAFDRAGSLGRGDAVPLAPREGTRLIKAAGRVEVQNRR 284

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 285 TEQAHVVLGMPGIARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 344

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + ++++    I+  EI +   ++    +   E +  
Sbjct: 345 DCGLFGVYAGCRPSQVDDVLKICRDELETVAAHGIDDDEIRRAVGQLAGSTVLGLEDTGA 404

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G  L  + ++  I+A+T +++  VA+ I    P+L+++GP  +
Sbjct: 405 LMNRIGKSELCWGEQLSVDDMLAKIAAVTPDEVRAVARDILGQRPSLSVIGPLKE 459


>gi|289742983|gb|ADD20239.1| mitochondrial processing peptidase beta subunit [Glossina morsitans
           morsitans]
          Length = 454

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 98/431 (22%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   + + V +E     +A V + I AGSR+E  + +G+AHFLEHM FKGT+KR+  +
Sbjct: 24  QVTALDNCLRVASEDSGASTATVGLWIDAGSRSETPQNNGVAHFLEHMAFKGTSKRSQTD 83

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + V  A+EI+ D++ NS    S+IERER+V+
Sbjct: 84  LELEVENMGAHLNAYTSREQTVFYAKCLSKDVSKAIEILADIIQNSKLGESEIERERSVI 143

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     + +++S +Y A R
Sbjct: 144 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIKSIGKNDLQAYISTHYKASR 203

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H   V+  + +          K               ++   L   H+ +
Sbjct: 204 IVLSGAGGVKHNELVTMAQQHLGKLENTFDGKPPSVAPCRFTGSEVRVRDDSLPLAHVAI 263

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              GC +  +D     +  +++G    S+                  LC+S  + +  + 
Sbjct: 264 AVEGCGWTDQDNIPLMVANTLIGAWDRSQGGGVNNASNLARASAEDNLCHSFQSFNTCYK 323

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I           +  ++      L   + + E+++    +   ++   + +   
Sbjct: 324 DTGLWGIYYVCDPLECENMLFNVQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPI 383

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++  G  +   ++   I A+  ++I  VA K      P +A +GP ++++P  
Sbjct: 384 CEDIGRQMLCYGRRIPLHELEQRIEAVDVKNIRDVAMKYIYDRCPAVAAVGP-VENLPDY 442

Query: 412 SELIHALEGFR 422
           + +  ++   R
Sbjct: 443 NRIRSSMYWLR 453


>gi|158313042|ref|YP_001505550.1| peptidase M16 domain-containing protein [Frankia sp. EAN1pec]
 gi|158108447|gb|ABW10644.1| peptidase M16 domain protein [Frankia sp. EAN1pec]
          Length = 477

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 127/412 (30%), Positives = 209/412 (50%), Gaps = 7/412 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P   S  + + +  GSR+E     G +H+LEH+LFKGT  R A
Sbjct: 58  VRRTVLPGGLRVVTEKVPGVRSVAIGIWVGVGSRDETPLTGGCSHYLEHLLFKGTPSRDA 117

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I   IE VGGD+NA+T+ E+T Y+A VL   + LA++++ DM++NS     D+E ER 
Sbjct: 118 LSISASIEAVGGDLNAFTAKEYTCYYARVLDVDMDLAIDVVCDMVANSLVTADDVEAERG 177

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M EDD  D +   F++ V    ++GRP+LG  +TI +   E +  +    Y  
Sbjct: 178 VILEEIAMHEDDPGDVVHDVFADAVLGSSVLGRPVLGTVDTIEALGRETVFDYYRERYAP 237

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-----MKPAVYVGGEYIQKRDLAEE 236
             + V   G ++H+  + +V + F        +         P     G  +  R   + 
Sbjct: 238 PALVVSIAGNIEHDHALDRVVAAFADRLTGPARHQEVRRGEYPFPPPPGIVVTNRPTEQA 297

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H++LG  G +      Y   +L++ LG GMSSRLFQEVREKRGL YS+ +    F+D G+
Sbjct: 298 HVVLGTAGLSRHDPRRYALGVLSTALGGGMSSRLFQEVREKRGLAYSVYSFDNQFADAGL 357

Query: 297 LYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +         +     E V +     I   E+++   +    L+ + E +  R   
Sbjct: 358 FGVYAGCTPGRADEVLEICREQVHRIAEHGITAEELERARGQNRGGLVLNLEDTGSRMSR 417

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           + K  +  G +L  ++++  + A+T +D+  VA ++      L ++GP  DH
Sbjct: 418 LGKSELVHGELLSVDEVLARVEAVTLDDVRAVAGELVDQPWALGVIGPFEDH 469


>gi|302522242|ref|ZP_07274584.1| protease [Streptomyces sp. SPB78]
 gi|302431137|gb|EFL02953.1| protease [Streptomyces sp. SPB78]
          Length = 470

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 131/415 (31%), Positives = 224/415 (53%), Gaps = 10/415 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 45  TVRRTTLPGGLRVVTETLPSVRSATFGIWAGVGSRDESPTLNGATHYLEHLLFKGTRRRT 104

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S+ + +DI+ ER
Sbjct: 105 ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSTLDAADIDAER 164

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++   ++I  F  R+Y 
Sbjct: 165 GVILEEIAMTEDDPGDVVHDLFAHTMLGDTPLGRPVLGTVDTINALGRDQIARFYKRHYD 224

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFN--------VCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV + F+               +E  +     G   +Q R 
Sbjct: 225 PTHLVVAAAGNVDHAKVVRQVRAAFDRAGALGRGDAVPLAPREGTRLIKAAGRVEVQNRR 284

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++  +F+
Sbjct: 285 TEQAHVVLGMPGIARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSSFA 344

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + ++++    ++  EI +   ++    +   E +  
Sbjct: 345 DCGLFGVYAGCRPSQVDDVLKICRDELETVAAHGLDDDEIRRAVGQLAGSTVLGLEDTGA 404

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
               I K  +  G  L  + ++  I+A+T +++  VA+ I    P+L+++GP  +
Sbjct: 405 LMNRIGKSELCWGEQLSVDDMLAKIAAVTPDEVRAVARDILGQRPSLSVIGPLKE 459


>gi|289742991|gb|ADD20243.1| mitochondrial processing peptidase beta subunit [Glossina morsitans
           morsitans]
          Length = 474

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 100/431 (23%), Positives = 197/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   + + V +E     +A V + I AGSR+E  + +G+AHFLEHM FKGT+KR+  +
Sbjct: 44  QVTIMDNSLRVASEDSGASTATVGLWIDAGSRSETAQNNGVAHFLEHMAFKGTSKRSQTD 103

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T ++A  L + VP ++EI+ D++ NS    S+IERER+V+
Sbjct: 104 LELEVENMGAHLNAYTSREQTVFYAKCLSKDVPKSVEILADIIQNSKLGESEIERERSVI 163

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G+ ILG  + I S     + +++S +Y A R
Sbjct: 164 LREMQEVESNLQEVVFDHLHATAYQGTPLGQTILGPTKNIKSIGRNDLQAYISTHYKASR 223

Query: 184 MYVVCVGAVDHEFCVSQVESY---FNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  V   E +    +     K               ++   L   H+ +
Sbjct: 224 IVLSGAGGVKHKELVQLAEQHLGKMDNTYDGKPPSMDPCRFTGSEVRVRDDSLPLAHIAI 283

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              GC +  +D     +  +++G    S+                  LC+S  + +  + 
Sbjct: 284 AVEGCGWSDQDNIPLMVANTLIGAWDRSQGGGVNNASNLARASAEDNLCHSFQSFNTCYK 343

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I           +  +I      L   + + E+++    +   ++   + +   
Sbjct: 344 DTGLWGIYYVCDPLECENMLFNIQTEWMRLCTMVTEAEVERAKNLLKTNMLLQLDGTTPI 403

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++  G  +   ++   I A+  ++I  VA K      P +A +GP ++++P  
Sbjct: 404 CEDIGRQILCYGRRIPLHELEQRIEAVDVKNIRDVAMKYIYDRCPAVAAVGP-VENLPDY 462

Query: 412 SELIHALEGFR 422
           + +  ++   R
Sbjct: 463 NRIRSSMYWLR 473


>gi|3342006|gb|AAC39915.1| mitochondrial processing peptidase beta-subunit [Homo sapiens]
          Length = 489

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP +  +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IKQLPDF 477

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 478 KQIRSNMCWLR 488


>gi|94538354|ref|NP_004270.2| mitochondrial-processing peptidase subunit beta precursor [Homo
           sapiens]
 gi|29840827|sp|O75439|MPPB_HUMAN RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP; AltName: Full=P-52; Flags:
           Precursor
 gi|119603732|gb|EAW83326.1| peptidase (mitochondrial processing) beta, isoform CRA_b [Homo
           sapiens]
          Length = 489

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP +  +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IKQLPDF 477

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 478 KQIRSNMCWLR 488


>gi|311068194|ref|YP_003973117.1| MlpA protein [Bacillus atrophaeus 1942]
 gi|310868711|gb|ADP32186.1| MlpA [Bacillus atrophaeus 1942]
          Length = 410

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 132/406 (32%), Positives = 228/406 (56%), Gaps = 3/406 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ R+A
Sbjct: 2   IKRYTCQNGVRVVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +SSF+ +++++E+N
Sbjct: 62  RDIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSSFDENELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  ET+ SF  + +  ++   YT 
Sbjct: 122 VVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLDSFNGDSLRKYMDDFYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           +R+ +   G V  +  +  VE +F           MK   +   +  +K++  + H+ LG
Sbjct: 182 NRVVISIAGNVT-DSFIKDVEKWFGTYEAKGAASGMKQPEFHYEKLTRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           FNG      D Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I  
Sbjct: 241 FNGLEVGHPDIYNLIVLNNVLGGSMSSRLFQDVREDKGLAYSVFSYHSSYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L+ +I E +     + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGAKQLQLLSETIQETLGTLKRDGITPKELENSKEQMKGNLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           +  G     ++II+ ++ +  E + G+A++IF+    LA++ P  D
Sbjct: 361 LLLGKHKTLDEIINELNEVNLESVNGLARRIFTDDYALALISPSGD 406


>gi|320106613|ref|YP_004182203.1| peptidase M16 domain-containing protein [Terriglobus saanensis
           SP1PR4]
 gi|319925134|gb|ADV82209.1| peptidase M16 domain protein [Terriglobus saanensis SP1PR4]
          Length = 442

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 127/407 (31%), Positives = 221/407 (54%), Gaps = 6/407 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+R +  S+G+ V+TE MP + S  +   +R GSR+E +E +G++HF+EHM+FKGTT R+
Sbjct: 22  NIRTTTLSNGLLVLTESMPHMRSVSMGCWVRTGSRDEPKELNGISHFVEHMVFKGTTTRS 81

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
            +++  E++ +GG+++A+T  E   ++  VL  ++  ALE++ D++ N +FN  D+ RE+
Sbjct: 82  QQQLSREVDAIGGNLDAFTGKETVCFNIKVLDTNLDTALELLSDLVLNPTFNAEDLAREQ 141

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+LEEI M ED+    +   +++ +W    +GRPILG  ET+SSF  E + +F    ++
Sbjct: 142 SVILEEIKMDEDNPDYLVHEIYTQKLWPSDSLGRPILGTVETVSSFNREIVAAFHHERFS 201

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF---NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
              M     G + HE  ++++E+ F      +   +     P +        K+ L +  
Sbjct: 202 PRNMVFSAAGHLSHEDLLAKIEARFGSLEDIAAEDLLHRHAPPMTPHITLHDKKSLEQVQ 261

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LG       S D Y   +L +ILG GMSSRLFQ VRE+ GL YSI +    F D G L
Sbjct: 262 LVLGVPAPPVNSPDRYALYLLNTILGGGMSSRLFQSVREEAGLAYSIYSEMNPFRDTGSL 321

Query: 298 YIASATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + + T+ E    +   I  E  +   E I   E+ +   ++   ++   E S  R   +
Sbjct: 322 AVYAGTSIEKTPEMLRRILAEFTRLKNEPIPDDELLRAQTQLKGNIVLGLESSNARMSNL 381

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           ++Q M  G     +++++ I A+T  D+  +A ++      +L +LG
Sbjct: 382 ARQQMNFGRFASVDEVVEQIDAVTPADMQRIANELLHQDKLSLTLLG 428


>gi|302554540|ref|ZP_07306882.1| protease [Streptomyces viridochromogenes DSM 40736]
 gi|302472158|gb|EFL35251.1| protease [Streptomyces viridochromogenes DSM 40736]
          Length = 459

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 123/416 (29%), Positives = 214/416 (51%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +R+
Sbjct: 34  TVRKTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPALNGATHYLEHLLFKGTNRRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   ++ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S     D++ ER
Sbjct: 94  ALDISAALDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLILEEDVDVER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
             +LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T+++ T ++I  F  ++Y 
Sbjct: 154 GAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVDTVNALTADRIRRFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVE--------SYFNVCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V C G VDH   V QV                    +   +     G   +  R 
Sbjct: 214 PTHLVVACAGNVDHAKVVRQVRAAFEKAGAFRDTGAEPVAPRSGRRALRTAGRVELIDRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G +      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHIVLGMPGLSRTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + +  +    +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVDDVLKICRDELDHVAEHGLSDDEIGRAIGQLQGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I ++T +D+  VA++I    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLSRIVSVTPDDVRSVAREILGRRPSLSVIGPLKDK 449



 Score = 39.9 bits (91), Expect = 0.72,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 38/96 (39%), Gaps = 2/96 (2%)

Query: 328 QREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSI--LCSEKIIDTISAITCEDIV 385
           + ++D E   I  ++  +++       ++    MF  +         +DT++A+T + I 
Sbjct: 146 EEDVDVERGAILEEIAMTEDDPGDCVHDLFAHTMFGDNPLGRPVLGTVDTVNALTADRIR 205

Query: 386 GVAKKIFSSTPTLAILGPPMDHVPTTSELIHALEGF 421
              KK +  T  +      +DH     ++  A E  
Sbjct: 206 RFYKKHYDPTHLVVACAGNVDHAKVVRQVRAAFEKA 241


>gi|90075750|dbj|BAE87555.1| unnamed protein product [Macaca fascicularis]
          Length = 503

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 94/427 (22%), Positives = 193/427 (45%), Gaps = 13/427 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAAEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +       +       ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCAHKGETPALPPCSFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IEQLPDF 477

Query: 412 SELIHAL 418
            ++   +
Sbjct: 478 KQICSNM 484


>gi|270346540|pdb|3HDI|A Chain A, Crystal Structure Of Bacillus Halodurans Metallo Peptidase
 gi|270346541|pdb|3HDI|B Chain B, Crystal Structure Of Bacillus Halodurans Metallo Peptidase
          Length = 421

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 126/411 (30%), Positives = 227/411 (55%), Gaps = 4/411 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ +ITE M  + S  + + +  GSR E  EE+G++HFLEHM FKGT  R+A
Sbjct: 2   INTMTLDNGVRIITEKMSTVRSVSIGIWVGTGSRYESAEENGISHFLEHMFFKGTNTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL +H   A++ + DM  +S+F   ++E+ER 
Sbjct: 62  QEIAEFFDSIGGQVNAFTSKEYTCYYAKVLDDHAGQAIDTLSDMFFHSTFQKEELEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M +D   D +    S   +    +G PILG  ET++SF    +  ++ R YT 
Sbjct: 122 VVFEEIKMVDDTPDDIVHDLLSSATYGKHSLGYPILGTVETLNSFNEGMLRHYMDRFYTG 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G   H+  + +++  F+           +  +++    ++K++  + H+ LG
Sbjct: 182 DYVVISVAGN-VHDELIDKIKETFSQVKPTTYNYQGEKPMFLPNRIVRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G     +D Y   +L ++LG  MSSRLFQ++REKRGLCYS+ ++H +F D+G+L I +
Sbjct: 241 YPGLPIGDKDVYALVLLNNVLGGSMSSRLFQDIREKRGLCYSVFSYHSSFRDSGMLTIYA 300

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  SI E       + + ++E++    ++   L+ S E +  R     K  
Sbjct: 301 GTGHDQLDDLVYSIQETTSALAEKGLTEKELENGKEQLKGSLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
           +        +++I+ I+A+  +D+  +AK + S++P+++++    + +P  
Sbjct: 361 LLLKKHRSLDEMIEQINAVQKQDVSRLAKILLSASPSISLINANGE-LPKA 410


>gi|15614968|ref|NP_243271.1| processing protease [Bacillus halodurans C-125]
 gi|10175025|dbj|BAB06124.1| processing protease [Bacillus halodurans C-125]
          Length = 413

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 126/411 (30%), Positives = 227/411 (55%), Gaps = 4/411 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ +ITE M  + S  + + +  GSR E  EE+G++HFLEHM FKGT  R+A
Sbjct: 2   INTMTLDNGVRIITEKMSTVRSVSIGIWVGTGSRYESAEENGISHFLEHMFFKGTNTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL +H   A++ + DM  +S+F   ++E+ER 
Sbjct: 62  QEIAEFFDSIGGQVNAFTSKEYTCYYAKVLDDHAGQAIDTLSDMFFHSTFQKEELEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M +D   D +    S   +    +G PILG  ET++SF    +  ++ R YT 
Sbjct: 122 VVFEEIKMVDDTPDDIVHDLLSSATYGKHSLGYPILGTVETLNSFNEGMLRHYMDRFYTG 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G   H+  + +++  F+           +  +++    ++K++  + H+ LG
Sbjct: 182 DYVVISVAGN-VHDELIDKIKETFSQVKPTTYNYQGEKPMFLPNRIVRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G     +D Y   +L ++LG  MSSRLFQ++REKRGLCYS+ ++H +F D+G+L I +
Sbjct: 241 YPGLPIGDKDVYALVLLNNVLGGSMSSRLFQDIREKRGLCYSVFSYHSSFRDSGMLTIYA 300

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  SI E       + + ++E++    ++   L+ S E +  R     K  
Sbjct: 301 GTGHDQLDDLVYSIQETTSALAEKGLTEKELENGKEQLKGSLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
           +        +++I+ I+A+  +D+  +AK + S++P+++++    + +P  
Sbjct: 361 LLLKKHRSLDEMIEQINAVQKQDVSRLAKILLSASPSISLINANGE-LPKA 410


>gi|228935120|ref|ZP_04097947.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228824485|gb|EEM70290.1| Uncharacterized zinc protease ymxG [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 432

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 427


>gi|156379647|ref|XP_001631568.1| predicted protein [Nematostella vectensis]
 gi|156218610|gb|EDO39505.1| predicted protein [Nematostella vectensis]
          Length = 485

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 102/432 (23%), Positives = 199/432 (46%), Gaps = 12/432 (2%)

Query: 2   NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           + +++  S+G+ V TE   I +A V + I AGSR E +  +G+AHFLEHM FKGT  R+ 
Sbjct: 54  DTKVTTLSNGLKVATEDSGISTATVGLWIDAGSRFETEANNGVAHFLEHMAFKGTKNRSQ 113

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            ++  E+E +G  +NAYTS E T Y+A V  + +P A++I+ D++ NS+   ++IERER 
Sbjct: 114 MDLELEVENMGAHLNAYTSREQTVYYAKVFSKDIPKAVDILADIIQNSTLGEAEIERERG 173

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L E+   +    + +        ++   +GR ILG    + S T + +  +++++Y+A
Sbjct: 174 VILREMQEVDTQLEEVVFDHLHATAYQGTALGRTILGPSRNVKSITQQDLKDYINKHYSA 233

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVA--KIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            RM +   G V+H+  V   E++F+       +  +            ++  D+   H+ 
Sbjct: 234 PRMVLAAAGGVNHDDLVKLAENHFSGLRSTYEEQDKVEPCRFSGSEIRVRDDDMPLAHVA 293

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLF--------QEVREKRGLCYSISAHHENF 291
           +   GC +   D++   +   ++G    S            +   +  L ++  + +  +
Sbjct: 294 MSVEGCGWTHPDYFALMVANMLVGSWDRSFSAGKNIGSKLAQQIAQNNLAHNFMSFNTCY 353

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           +D G+  I     K  I      I      +  +I   E+ +    +   ++   + S  
Sbjct: 354 TDTGLWGIYFVCDKMKIDDTIYCIQHEWMRICTSITDHEVARAKNLLKTNILMQLDGSTP 413

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              +I +Q++  G  +   +I   I  I  + +  VA K      P +  +GP ++ +P 
Sbjct: 414 ICEDIGRQMLTYGRRIPLPEIDMRIEMIDAKTVKDVATKYIYDRCPAVVGVGP-VEQLPD 472

Query: 411 TSELIHALEGFR 422
            + +   +   R
Sbjct: 473 YNRVRGGMYWLR 484


>gi|52141684|ref|YP_085146.1| zinc protease [Bacillus cereus E33L]
 gi|51975153|gb|AAU16703.1| zinc protease [Bacillus cereus E33L]
          Length = 413

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSVAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 408


>gi|30263809|ref|NP_846186.1| zinc protease [Bacillus anthracis str. Ames]
 gi|47529232|ref|YP_020581.1| zinc protease [Bacillus anthracis str. 'Ames Ancestor']
 gi|49186655|ref|YP_029907.1| zinc protease [Bacillus anthracis str. Sterne]
 gi|165872603|ref|ZP_02217234.1| zinc protease, insulinase family [Bacillus anthracis str. A0488]
 gi|167635817|ref|ZP_02394126.1| zinc protease, insulinase family [Bacillus anthracis str. A0442]
 gi|167639881|ref|ZP_02398150.1| zinc protease, insulinase family [Bacillus anthracis str. A0193]
 gi|170687866|ref|ZP_02879080.1| zinc protease, insulinase family [Bacillus anthracis str. A0465]
 gi|170706822|ref|ZP_02897280.1| zinc protease, insulinase family [Bacillus anthracis str. A0389]
 gi|177652122|ref|ZP_02934668.1| zinc protease, insulinase family [Bacillus anthracis str. A0174]
 gi|190568414|ref|ZP_03021321.1| zinc protease, insulinase family [Bacillus anthracis
           Tsiankovskii-I]
 gi|218904932|ref|YP_002452766.1| zinc protease, insulinase family [Bacillus cereus AH820]
 gi|227813287|ref|YP_002813296.1| zinc protease, insulinase family [Bacillus anthracis str. CDC 684]
 gi|229602115|ref|YP_002868044.1| zinc protease, insulinase family [Bacillus anthracis str. A0248]
 gi|254683488|ref|ZP_05147348.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254722009|ref|ZP_05183798.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           A1055]
 gi|254735843|ref|ZP_05193549.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254739631|ref|ZP_05197325.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Kruger B]
 gi|254755996|ref|ZP_05208027.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Vollum]
 gi|254759343|ref|ZP_05211368.1| zinc protease, insulinase family protein [Bacillus anthracis str.
           Australia 94]
 gi|301055295|ref|YP_003793506.1| peptidase M16 domain-containing protein [Bacillus anthracis CI]
 gi|30258453|gb|AAP27672.1| zinc protease, insulinase family [Bacillus anthracis str. Ames]
 gi|47504380|gb|AAT33056.1| zinc protease, insulinase family [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180582|gb|AAT55958.1| zinc protease, insulinase family [Bacillus anthracis str. Sterne]
 gi|164711635|gb|EDR17181.1| zinc protease, insulinase family [Bacillus anthracis str. A0488]
 gi|167512282|gb|EDR87659.1| zinc protease, insulinase family [Bacillus anthracis str. A0193]
 gi|167528774|gb|EDR91532.1| zinc protease, insulinase family [Bacillus anthracis str. A0442]
 gi|170128240|gb|EDS97109.1| zinc protease, insulinase family [Bacillus anthracis str. A0389]
 gi|170668182|gb|EDT18931.1| zinc protease, insulinase family [Bacillus anthracis str. A0465]
 gi|172082491|gb|EDT67556.1| zinc protease, insulinase family [Bacillus anthracis str. A0174]
 gi|190560418|gb|EDV14396.1| zinc protease, insulinase family [Bacillus anthracis
           Tsiankovskii-I]
 gi|218537897|gb|ACK90295.1| zinc protease, insulinase family [Bacillus cereus AH820]
 gi|227007879|gb|ACP17622.1| zinc protease, insulinase family [Bacillus anthracis str. CDC 684]
 gi|229266523|gb|ACQ48160.1| zinc protease, insulinase family [Bacillus anthracis str. A0248]
 gi|300377464|gb|ADK06368.1| peptidase M16 domain protein [Bacillus cereus biovar anthracis str.
           CI]
          Length = 413

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 408


>gi|193785480|dbj|BAG50846.1| unnamed protein product [Homo sapiens]
          Length = 489

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRMRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K  ++ +P +A +GP +  +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYTYNRSPAIAAVGP-IKQLPDF 477

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 478 KQIRSNMCWLR 488


>gi|296227722|ref|XP_002759503.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Callithrix jacchus]
          Length = 553

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 197/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 123 RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 182

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 183 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 242

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 243 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 302

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 303 IVLAAAGGVSHDELLDLAKLHFGDSLCTHKGEIPALPPCKFTGSEIRMRDDKMPLAHLAI 362

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                +  LC+S  + + +++
Sbjct: 363 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCQGNLCHSFQSFNTSYT 422

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 423 DTGLWGLYMVCEPATVGDMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 482

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP ++ +P  
Sbjct: 483 CEDIGRQMLCYNRRIPIPELEVRIDAVNAETIREVCTKYIYNKSPAIAAVGP-IEQLPDF 541

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 542 NQICSNMCWLR 552


>gi|257462590|ref|ZP_05627000.1| Zinc protease [Fusobacterium sp. D12]
 gi|317060241|ref|ZP_07924726.1| zinc protease [Fusobacterium sp. D12]
 gi|313685917|gb|EFS22752.1| zinc protease [Fusobacterium sp. D12]
          Length = 416

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 132/412 (32%), Positives = 212/412 (51%), Gaps = 6/412 (1%)

Query: 1   MN--LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           MN  +++   S+GITV+ E +P + S  +   +R G+RNER+EE G++HF+EHM+FKGT 
Sbjct: 1   MNEGVQVKTLSNGITVLAEKVPELQSFSLGFFVRTGARNERKEESGISHFIEHMMFKGTE 60

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            RTAKE+ E I+  GG +NAYTS E T Y+  +L   + +A++++ DM+ +S+F   +IE
Sbjct: 61  TRTAKELSEIIDNEGGMMNAYTSRETTVYYVQLLSSKLEIAIDVLSDMMLHSTFTEENIE 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           +ERNV++EEI M ED   D      +       I    I G PE +   T E  + ++  
Sbjct: 121 KERNVIIEEIKMYEDSPED-TVHDENISFALRGIQSNSISGTPEGLKKITREHFMKYLRD 179

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGG-EYIQKRDLAEE 236
            Y A  + +V  G  D E  ++Q+E   +    +  K        +     I  RD  + 
Sbjct: 180 QYVASNLTIVISGNFDEELLMTQLEEKMSAFPSSTEKRDYDNRYEIYSGTQIITRDTQQV 239

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+     G        Y   IL S LG GMS+RLFQ++RE+RGL YS+ ++   + D G+
Sbjct: 240 HICFNTRGIDIHHPKKYAVAILTSALGGGMSARLFQKIREERGLAYSVYSYQSVYEDCGL 299

Query: 297 LYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
               + T +E    + + I E  Q +L   I ++E+ +   +  + L+   E S  R   
Sbjct: 300 FTTYAGTTREAYRDVIAMIREEYQEILEHGITEQELRRCKNQFTSALMFHLESSKGRMSS 359

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           I+   M  G +   E++I  I+A++ EDI  VA+ +F        +   +  
Sbjct: 360 IAASYMNNGRVETKEEVIQNINAVSLEDIQEVARYLFDEKYYSCTILGNIKE 411


>gi|296209879|ref|XP_002751725.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Callithrix jacchus]
          Length = 489

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 197/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKLHFGDSLCTHKGEIPALPPCKFTGSEIRMRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                +  LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCQGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEPATVGDMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP ++ +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEVRIDAVNAETIREVCTKYIYNKSPAIAAVGP-IEQLPDF 477

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 478 NQICSNMCWLR 488


>gi|330466374|ref|YP_004404117.1| peptidase M16 domain-containing protein [Verrucosispora maris
           AB-18-032]
 gi|328809345|gb|AEB43517.1| peptidase M16 domain-containing protein [Verrucosispora maris
           AB-18-032]
          Length = 468

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 121/412 (29%), Positives = 215/412 (52%), Gaps = 10/412 (2%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +   SG+ V+TE +P   S    + +  GSR+E     G AHFLEH+LFKGT KR 
Sbjct: 51  TVRRTVLPSGLRVLTEAIPAMRSVSFGIWVAVGSRDETGPTAGAAHFLEHLLFKGTHKRG 110

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A EI   IE VGG+ NA+T+ E+T Y+A VL E +PLA++++ D++++S   P+D+E ER
Sbjct: 111 ALEISSSIEAVGGETNAFTTKEYTCYYARVLDEDLPLAIDVMCDLVADSVLEPADVETER 170

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M +D+  D +   F+  V+ D  +GR I G  +T++  T  +I +F  R Y 
Sbjct: 171 GVILEEIAMHDDEPGDEVHDLFARAVYGDHPLGRLISGTSDTVTPMTRRQIQTFYRRRYV 230

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCS--------VAKIKESMKPAVYVGGEYIQKRD 232
           A ++ +   G +DH   V  V                      +           +Q ++
Sbjct: 231 APQIVIAAAGNLDHAAVVRLVRQALRGTPLDTEPASPAPHRPAAPAVRTRAASTVVQVKE 290

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG           +   +L ++LG GMSSRLFQE+RE+RGL YS+ ++   ++
Sbjct: 291 TEQAHVVLGCPAIDRLDERRFALGVLNNVLGGGMSSRLFQEIREQRGLAYSVYSYASQYA 350

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D+G+  + +  A   +  +       + ++  + I + E+ +         +   E +  
Sbjct: 351 DSGLFGVYAGCAPGRVDEVLELTRTELARTAEQGITEAELARGKGMSKGSFVLGLEDTGS 410

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   ++K  +  G+++   +++D + ++T +D+  +A  + +   +LA++GP
Sbjct: 411 RMSRLAKGELLYGNLMPVNELLDRVDSVTLDDVNTLAADLLARPMSLAVVGP 462


>gi|65321132|ref|ZP_00394091.1| COG0612: Predicted Zn-dependent peptidases [Bacillus anthracis str.
           A2012]
          Length = 432

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 126/404 (31%), Positives = 229/404 (56%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L   + E +++     I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYEXMQETLETLKXXGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
           +        ++II++++ +T E++  + + +F+   + A++ P 
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD 423


>gi|222097250|ref|YP_002531307.1| zinc protease [Bacillus cereus Q1]
 gi|221241308|gb|ACM14018.1| zinc protease [Bacillus cereus Q1]
          Length = 413

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPN-GKLP 408


>gi|49478384|ref|YP_037866.1| zinc protease [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|196042172|ref|ZP_03109455.1| zinc protease, insulinase family [Bacillus cereus NVH0597-99]
 gi|196044543|ref|ZP_03111778.1| zinc protease, insulinase family [Bacillus cereus 03BB108]
 gi|206978178|ref|ZP_03239059.1| zinc protease, insulinase family [Bacillus cereus H3081.97]
 gi|217961225|ref|YP_002339793.1| zinc protease, insulinase family [Bacillus cereus AH187]
 gi|225865784|ref|YP_002751162.1| zinc protease, insulinase family [Bacillus cereus 03BB102]
 gi|49329940|gb|AAT60586.1| zinc protease [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|196024578|gb|EDX63250.1| zinc protease, insulinase family [Bacillus cereus 03BB108]
 gi|196027024|gb|EDX65648.1| zinc protease, insulinase family [Bacillus cereus NVH0597-99]
 gi|206743595|gb|EDZ55021.1| zinc protease, insulinase family [Bacillus cereus H3081.97]
 gi|217065864|gb|ACJ80114.1| zinc protease, insulinase family [Bacillus cereus AH187]
 gi|225789364|gb|ACO29581.1| zinc protease, insulinase family [Bacillus cereus 03BB102]
 gi|324327699|gb|ADY22959.1| zinc protease [Bacillus thuringiensis serovar finitimus YBT-020]
          Length = 413

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 408


>gi|239944721|ref|ZP_04696658.1| putative protease [Streptomyces roseosporus NRRL 15998]
 gi|239991185|ref|ZP_04711849.1| putative protease [Streptomyces roseosporus NRRL 11379]
 gi|291448179|ref|ZP_06587569.1| protease [Streptomyces roseosporus NRRL 15998]
 gi|291351126|gb|EFE78030.1| protease [Streptomyces roseosporus NRRL 15998]
          Length = 459

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 132/428 (30%), Positives = 220/428 (51%), Gaps = 12/428 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KRT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPALNGATHYLEHLLFKGTAKRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         +++  A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKAGALSRTDAVPMAPREGSRTLRTVGKVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +     ++  EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPNQVHDVLKICRDELDRVATHGLDDDEITRAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
               I K  +  G  +  + ++  I+ +T +D+  VA ++ S  P+L+++GP  D     
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLARIAEVTPDDVRDVAGELLSRRPSLSVIGPLKDK--QA 451

Query: 412 SELIHALE 419
             L  A+ 
Sbjct: 452 DRLDEAVS 459


>gi|297828646|ref|XP_002882205.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297328045|gb|EFH58464.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 531

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 118/429 (27%), Positives = 202/429 (47%), Gaps = 16/429 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT KRT +
Sbjct: 98  RVTTLPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDKRTVR 157

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            + EEIE +GG +NAYTS E T+Y+A VL  +V  AL+++ D+L NS F    I RER+V
Sbjct: 158 ALEEEIEDIGGHLNAYTSREQTTYYAKVLDSNVNQALDVLADILQNSKFEEQRINRERDV 217

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + + S T E + +++  +YTA 
Sbjct: 218 ILREMQEVEGQTDEVVLDHLHATAFQYTPLGRTILGPAQNVKSITREDLQNYIKTHYTAS 277

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGEYIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      S        +       +   DL    
Sbjct: 278 RMVIAAAGAVKHEEVVEQVKKLFTKLSSDPTTTSQLVANEPASFTGSEVRMIDDDLPLAQ 337

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + F G ++   D     ++ ++LG    +    +              +  SI A + 
Sbjct: 338 FAVAFEGASWTDPDSVALMVMQTMLGSWNKNVGGGKHVGSDLTQRVAINEIAESIMAFNT 397

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L+ +I+  V  L   +   ++ +   ++ + L+   + +
Sbjct: 398 NYKDTGLFGVYAVAKADCLDDLSYAIMNEVTKLAYRVSDADVTRARNQLKSSLLLHMDGT 457

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
              A +I +Q++  G  + + ++   I A+    +  VA K        ++ +GP  D +
Sbjct: 458 SPIAEDIGRQLLTYGRRIPTAELFARIDAVDASTVKRVANKYIYDKDIAISAIGPIQD-L 516

Query: 409 PTTSELIHA 417
           P  ++    
Sbjct: 517 PDYNKFRRR 525


>gi|237839413|ref|XP_002369004.1| mitochondrial-processing peptidase beta subunit, putative
           [Toxoplasma gondii ME49]
 gi|211966668|gb|EEB01864.1| mitochondrial-processing peptidase beta subunit, putative
           [Toxoplasma gondii ME49]
          Length = 524

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 111/426 (26%), Positives = 200/426 (46%), Gaps = 22/426 (5%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +   +GI V T+ +P   +A V V I +GSR + +E +G AHFLEHM FKGT +R+  +
Sbjct: 71  TTTLPNGIRVATQRLPFHQTATVGVWIDSGSRYDTKETNGAAHFLEHMTFKGTKRRSRIQ 130

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +EIE +G  +NAYTS E T Y+A   K+ +P  ++I+ D+L NS+ +   ++ E++V+
Sbjct: 131 LEQEIENMGAHLNAYTSREQTVYYAKAFKKDIPQCVDILSDILLNSTIDEEAVQMEKHVI 190

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E  + + +  R     ++D  +G  ILG  E I + T E I+ +++RNYT+DR
Sbjct: 191 LREMEEVERQTEEVIFDRLHTTAFRDSPLGYTILGPEENIRNMTREHILEYINRNYTSDR 250

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEHM 238
           M V   G VDH+   + VE +F      K  + + P            +         H+
Sbjct: 251 MVVAAAGDVDHKELTALVEKHFAGLPQPKRSKIILPTEKPFFCGSELLHRNDDMGPTAHV 310

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSR--------------LFQEVREKRGLCYSI 284
            +GF G  ++S D     ++ +I+G                         +   G     
Sbjct: 311 AVGFEGVPWKSPDAVTFMLMQAIVGSYRKHDEGIVPGKVSANATVRNVCNKMTVGCADMF 370

Query: 285 SAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIK 344
           SA +  +SD G+    +   +  +      I+  + SL   +   E+++  A++  +L+ 
Sbjct: 371 SAFNTCYSDTGLFGFYAQCDEVALEHCVMEIMFGITSLSYAVTDEEVERAKAQLKTQLLG 430

Query: 345 SQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILG 402
             + +   A +I +Q++  G  +   + +  +  I  E++  VA K       P +  LG
Sbjct: 431 HLDSTTAVAEDIGRQMLAYGRRMPLAEFLKRLEVIDAEEVKRVAWKYLHDAVRPKVGALG 490

Query: 403 PPMDHV 408
              + +
Sbjct: 491 SRKEEL 496


>gi|42782893|ref|NP_980140.1| zinc protease [Bacillus cereus ATCC 10987]
 gi|42738820|gb|AAS42748.1| zinc protease, insulinase family [Bacillus cereus ATCC 10987]
          Length = 413

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 129/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I +RE+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITERELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++  + + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDELIRNMFTDEFSAALISPD-GKLP 408


>gi|229086357|ref|ZP_04218534.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-44]
 gi|228696969|gb|EEL49777.1| Uncharacterized zinc protease ymxG [Bacillus cereus Rock3-44]
          Length = 431

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 130/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVFEEIKMYEDTPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  V  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFVQTVEQYFGNYEGTTNREQVHSPIFHFNKVSRKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 FKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYDTMQETLETLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T  D+  + + IF++  + +++ P  + +P
Sbjct: 380 LLLRKHRSLDEIIESVNQVTKTDVDTLIRNIFTNEFSASLISPNGE-LP 427


>gi|332868138|ref|XP_001160333.2| PREDICTED: mitochondrial-processing peptidase subunit beta isoform
           2 [Pan troglodytes]
          Length = 489

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 194/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCTFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEPSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP +  +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IKQLPDF 477

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 478 KQIHSNMCWLR 488


>gi|302810195|ref|XP_002986789.1| hypothetical protein SELMODRAFT_158279 [Selaginella moellendorffii]
 gi|300145443|gb|EFJ12119.1| hypothetical protein SELMODRAFT_158279 [Selaginella moellendorffii]
          Length = 492

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 121/423 (28%), Positives = 210/423 (49%), Gaps = 16/423 (3%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+  S+G+ V TE  M  ++A V V I AGSR E    +G AHFLEHM+FKGT KR+ +
Sbjct: 59  RITTLSNGLRVATESNMAAETATVGVWIDAGSRFETDATNGTAHFLEHMIFKGTKKRSMQ 118

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VLK+ VP+A++I+ D+L NS+F+   I RERNV
Sbjct: 119 KLEEEIENMGGHLNAYTSREQTTYYAKVLKKDVPVAVDILADILQNSNFDEDRIARERNV 178

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + +        ++   +GR ILG  E I S T E + +++S +YT  
Sbjct: 179 ILREMKEVEGQMEEVVFDHLHATAFQYSPLGRTILGPEENIRSITKEDLENYISTHYTGP 238

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCS-----VAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM V   GAV+H+  V  VE  F          A + E             +  D+   +
Sbjct: 239 RMVVSAAGAVNHDALVRDVERLFGSLPSDGTTAADLVEKEPAFFTGSDVRFRDDDIPLAY 298

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHE 289
           + +   G ++   D     ++ ++LG                 +      +  SI A + 
Sbjct: 299 VAIAVKGASWTDPDSIPLMVMQTMLGSWNKNSGAGKHMGSEMAQKVSANNIAESIMAFNT 358

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+SD+G+  + +    + +  L   I   +  ++ ++ + ++ +   ++ A L+   + +
Sbjct: 359 NYSDSGLFGVYAVAKPDVLDDLAWVITREMTHMVYHVREDDVIRARNQLKACLLLHLDGT 418

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I A+    +  VA++ I+     +A +G  +  +
Sbjct: 419 SPIAEDIGRQILTYGRRIPLAELFARIDAVDAATVRRVAERFIYDQDLAVAAVG-SLQIL 477

Query: 409 PTT 411
           P  
Sbjct: 478 PDY 480


>gi|302772162|ref|XP_002969499.1| hypothetical protein SELMODRAFT_146300 [Selaginella moellendorffii]
 gi|300162975|gb|EFJ29587.1| hypothetical protein SELMODRAFT_146300 [Selaginella moellendorffii]
          Length = 492

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 121/423 (28%), Positives = 210/423 (49%), Gaps = 16/423 (3%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+  S+G+ V TE  M  ++A V V I AGSR E    +G AHFLEHM+FKGT KR+ +
Sbjct: 59  RITTLSNGLRVATESNMAAETATVGVWIDAGSRFETDATNGTAHFLEHMIFKGTKKRSMQ 118

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VLK+ VP+A++I+ D+L NS+F+   I RERNV
Sbjct: 119 KLEEEIENMGGHLNAYTSREQTTYYAKVLKKDVPVAVDILADILQNSNFDEDRIARERNV 178

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + +        ++   +GR ILG  E I S T E + +++S +YT  
Sbjct: 179 ILREMKEVEGQMEEVVFDHLHATAFQYSPLGRTILGPEENIRSITKEDLENYISTHYTGP 238

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCS-----VAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM V   GAV+H+  V  VE  F          A + E             +  D+   +
Sbjct: 239 RMVVSAAGAVNHDALVRDVERLFGSLPSDGTTAADLIEKEPAFFTGSDVRFRDDDIPLAY 298

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHE 289
           + +   G ++   D     ++ ++LG                 +      +  SI A + 
Sbjct: 299 VAIAVKGASWTDPDSIPLMVMQTMLGSWNKNSGAGKHMGSEMAQKVSANNIAESIMAFNT 358

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+SD+G+  + +    + +  L   I   +  ++ ++ + ++ +   ++ A L+   + +
Sbjct: 359 NYSDSGLFGVYAVAKPDVLDDLAWVITREMTHMVYHVREDDVIRARNQLKACLLLHLDGT 418

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I A+    +  VA++ I+     +A +G  +  +
Sbjct: 419 SPIAEDIGRQILTYGRRIPLAELFARIDAVDAATVRRVAERFIYDQDLAVAAVG-SLQIL 477

Query: 409 PTT 411
           P  
Sbjct: 478 PDY 480


>gi|154247453|ref|YP_001418411.1| peptidase M16 domain-containing protein [Xanthobacter autotrophicus
           Py2]
 gi|154161538|gb|ABS68754.1| peptidase M16 domain protein [Xanthobacter autotrophicus Py2]
          Length = 421

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 148/413 (35%), Positives = 256/413 (61%), Gaps = 3/413 (0%)

Query: 1   MNLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+++IS   +G+TVIT+ M  + +A + + + AG+R+E+++EHG++H LEHM FKGT +R
Sbjct: 1   MSVKISVLDNGVTVITDEMSHLGTASLGIWVGAGARDEQEDEHGISHLLEHMAFKGTRRR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I EEIE+VGGDINA TS+E T+Y+  VL E V L ++I+ D+L+  +F P ++ERE
Sbjct: 61  SARRIAEEIEQVGGDINAATSVEQTTYNVRVLGEDVGLGIDILADILTEPAFAPDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           +NV+++EIG   D   D +   F E  +  Q +GR ILG P+T+ +F+ +++ +++ R Y
Sbjct: 121 KNVIVQEIGAVMDTPDDLVFDLFQEQAFPGQSVGRSILGTPDTVRAFSRDQLGAYLGRTY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              RM V   GAV+H+  V +      + + A   E +  A Y GG  +  RDL + H++
Sbjct: 181 RGPRMVVAAAGAVEHDRLVEEAGQRLKIIAPATKPE-LPQATYGGGTRLLARDLEQVHVL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG  GC+++  +++   +LA++LG GMSSRLFQ+VRE RGLCYSI A H ++ D G+  +
Sbjct: 240 LGLEGCSFKDPEYHAVQVLANVLGGGMSSRLFQDVREDRGLCYSIYAFHWSYQDTGLFGV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   ++  L++++++ +    E + + E+ +  A++   L+ + E S  RA ++++Q
Sbjct: 300 YAGTDTGDVEELSNAVIDQILDTAETVTELEVARAKAQMKVGLLAALESSGARADQLARQ 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
           ++  G ++  E+I+  + A+    +   A+ +     PTL  +GP     P  
Sbjct: 360 ILGFGRVIPVEEIVARVDAVDVAGVRRAAQGLIGRGRPTLTAIGPGGGLEPAA 412


>gi|152976171|ref|YP_001375688.1| peptidase M16 domain-containing protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024923|gb|ABS22693.1| peptidase M16 domain protein [Bacillus cytotoxicus NVH 391-98]
          Length = 412

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 132/409 (32%), Positives = 229/409 (55%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE  + +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENAKNNGISHFLEHMFFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI E  + +GG +NA+TS E+T Y+  VL EH   AL+++ DM  NS+F+ +++++E+ 
Sbjct: 62  KEIAESFDSIGGQVNAFTSKEYTCYYTKVLDEHAKYALDVLADMFFNSTFDEAELKKEKK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 122 VVFEEIKMYEDTPDDIVHDILTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D    V  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNIDET-FVQTVEQYFGNYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L +ILG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L I  
Sbjct: 241 FKGLQMGHDDIYNLIVLNNILGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  +I E + +L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYDTIQETLDTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++I+ +T  ++  + + IF++  + A++ P  + +P
Sbjct: 361 LLLRKHRSLDEIIESINNVTKPNVDALIRDIFTNEFSAALISPNGE-LP 408


>gi|73667388|ref|YP_303404.1| insulinase-like:peptidase M16, C-terminal [Ehrlichia canis str.
           Jake]
 gi|72394529|gb|AAZ68806.1| Insulinase-like:Peptidase M16, C-terminal [Ehrlichia canis str.
           Jake]
          Length = 421

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 145/421 (34%), Positives = 249/421 (59%), Gaps = 5/421 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+  I++  +  T+IT+ MP ++S  + + I  GSR E     G++HFLEHM FKGT  R
Sbjct: 1   MSPSITQFRNNFTIITDTMPHVESISINIWINVGSRYENTNITGISHFLEHMAFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA +I +  + +GG+ NA+T  EHT YH   LK  + +A+E++ D++ NS F   +I+RE
Sbjct: 61  TALDIAQIFDDIGGNFNAHTDREHTVYHVKTLKRDIKIAIEVLADIILNSQFPQEEIDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL+EI  + D     +  ++ E  + +QI G+ ILG PE++++ + E + +++S  Y
Sbjct: 121 KGVVLQEIYQTNDSPTSIIFDKYIEAAYPNQIFGKSILGTPESVTNLSKEDLQTYMSEYY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  M +   G + HE  +  V  +F+    ++ K +  P+VY  GEY + R+L + H++
Sbjct: 181 HAGNMLLSVAGNITHEEVIDLVSQHFSNMKKSEPK-TAAPSVYYSGEYREIRNLEQVHLV 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +GF   +Y+   FY   IL SILG+GMSSRLFQ++RE+ GL Y+IS+ + ++SDNG+  I
Sbjct: 240 IGFPSVSYKDDLFYTIQILDSILGNGMSSRLFQKIREQLGLVYTISSFNSSYSDNGIFSI 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +AT K N++ L ++I   V+S+  N+E+ EI +   K+ ++++ S+E +  RA  +   
Sbjct: 300 YAATDKNNLIQLLTTIASEVKSITMNLEENEITRAKGKLISEILMSRESTTARAESLGYY 359

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP--TLAILGPPMDHVPTTSELIHA 417
                  +  E++I  IS IT  D+      +  S    TLA +G  ++++P+  +++  
Sbjct: 360 YSHYNRYILKEELIKKISEITLTDLQNCIHNLLGSNNKITLAAIG-QIENLPSYGDIVQM 418

Query: 418 L 418
            
Sbjct: 419 F 419


>gi|328885434|emb|CCA58673.1| peptidase, M16 family [Streptomyces venezuelae ATCC 10712]
          Length = 459

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 129/428 (30%), Positives = 220/428 (51%), Gaps = 12/428 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E     G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTTLPGGLRIVTETLPSVRSATFGIWAHVGSRDETPTLGGATHYLEHLLFKGTRKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML++S     D++ ER
Sbjct: 94  ALDISAAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTDSLILEEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  ++ D  +GRP+LG  +T++  T  +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDVVHELFARTMFGDTPLGRPVLGTVDTVNGLTRGQIARFYRKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF--------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F                +  ++     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKAGALGRTDGVPVAPRTGVRTLRAAGRVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARNDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +   + +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPGQVHDVLKICRDELHKVASDGLTDDEIARAVGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
               I K  +  G+ +  + ++D I+A+T +++  VA+ +    P+L+++GP  D     
Sbjct: 394 LMNRIGKSELCWGTQMSVDDMLDRIAAVTPDEVREVARDVLEQRPSLSVIGPLKDK--QA 451

Query: 412 SELIHALE 419
             L  A+ 
Sbjct: 452 DRLHQAVS 459


>gi|229018999|ref|ZP_04175841.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1273]
 gi|229025244|ref|ZP_04181666.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1272]
 gi|228736072|gb|EEL86645.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1272]
 gi|228742327|gb|EEL92485.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH1273]
          Length = 432

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 127/414 (30%), Positives = 232/414 (56%), Gaps = 4/414 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D    +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNIDES-FLQIVEQYFGNYEGTTNREQVHIPIFHFNKVSRKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +        ++II++++ +T +++  + + +F+   + A++ P    +P   +L
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISPD-GKLPKGMKL 432


>gi|282866916|ref|ZP_06275948.1| peptidase M16 domain protein [Streptomyces sp. ACTE]
 gi|282558229|gb|EFB63799.1| peptidase M16 domain protein [Streptomyces sp. ACTE]
          Length = 459

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 129/416 (31%), Positives = 214/416 (51%), Gaps = 10/416 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   + +  GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 34  TVRRTVLPGGLRVVTETLPSVRSATFGIWVNVGSRDETPTLNGATHYLEHLLFKGTDKRS 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLITPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +T+++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTVNALDRGRIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF--------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F                +   +     G   +  R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFERAGALTRTDAVPTAPRAGSRALRTAGRVDVLDRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHIVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     E + +   E +   EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLGICREELDRVASEGLPDEEISRAVGQLAGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
               I K  +  G  +  + ++  I+A+T +++  VA  +    P+L+++GP  D 
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLARIAAVTPDEVRAVAADVLGHRPSLSVIGPLKDK 449


>gi|229012988|ref|ZP_04170153.1| Uncharacterized zinc protease ymxG [Bacillus mycoides DSM 2048]
 gi|228748242|gb|EEL98102.1| Uncharacterized zinc protease ymxG [Bacillus mycoides DSM 2048]
          Length = 432

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 127/414 (30%), Positives = 233/414 (56%), Gaps = 4/414 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M +D   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYDDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSKQLDTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +        ++II++++ +T +++  + + +F+   + A++ P    +P   +L
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISPD-GKLPKGMKL 432


>gi|218290097|ref|ZP_03494259.1| processing peptide [Alicyclobacillus acidocaldarius LAA1]
 gi|218239806|gb|EED06995.1| processing peptide [Alicyclobacillus acidocaldarius LAA1]
          Length = 422

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 131/410 (31%), Positives = 221/410 (53%), Gaps = 5/410 (1%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  R+    +GI V+ E M    S  + + +  GSR E Q E+G++HFLEHM FKGT++ 
Sbjct: 1   MTYRM-TLRNGIRVVGEEMSSIRSVSLGIWVETGSRYESQNENGISHFLEHMFFKGTSRH 59

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +AKE+    + +GG +NA+T+ E T ++A VL EH  +ALE + +ML++S F P ++E+E
Sbjct: 60  SAKELAHLFDDLGGQVNAFTAKEFTCFYARVLDEHFSIALETLAEMLTDSRFAPEEMEKE 119

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV+EEI M ED   + +    +  V+ +  +G  ILG+ E +  F+ + ++ +V R+Y
Sbjct: 120 KRVVIEEIRMYEDSPDELVMDLIARGVYGEHPLGYNILGRDENLLRFSRDDLVRYVDRHY 179

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVA--KIKESMKPAVYVGGEYIQKRDLAEEH 237
             +RM V   G V  +  + +VE  F   +         + P  +      +++D+ + H
Sbjct: 180 RPERMVVSVAGHVPEDVVIREVERVFGGLAKGADSAAPVLVPPPFHKTVTTEEKDIEQVH 239

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + L   G    SR+ Y   +L ++LG   SSRLFQE+RE+RG+ YS+ + H  + D G+ 
Sbjct: 240 ICLAAPGYPAGSRELYPLLLLNNVLGGTQSSRLFQEIREERGMAYSVYSFHTGYRDAGMF 299

Query: 298 YIASATAKENIMALTSSIVE-VVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I   T+ E    + + + +  V+   E I + E++K   ++   L+   E S  R   +
Sbjct: 300 GIYVGTSPETAEEVLNLVQQVTVRMWQEPISRDELEKAKRQVKGALMLGLESSGSRMSRL 359

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           +K  +     +  E+ I  I A+T EDI  VA+ + S    LA +GP  +
Sbjct: 360 AKNEILLRRDVPLEETIAGIDAVTPEDIQRVAEDVLSHGFALAAVGPLAE 409


>gi|326911191|ref|XP_003201945.1| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Meleagris gallopavo]
          Length = 497

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 99/431 (22%), Positives = 193/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R+S   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 67  RVSPLENGLQVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 126

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 127 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 186

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 187 LREMQEVETNLQEVVFDYLHATAYQKTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 246

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V HE  +   + +F     A    +      +       I+   +   H+ +
Sbjct: 247 IVLAAAGGVCHEELLDLAKCHFGNLPSAPEGGLPPLPPCSFTGSEIRIRDDKMPLAHIAI 306

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S            ++     LC+S  + +  ++
Sbjct: 307 AVEAAGWSDPDTIPLMVANTLIGNWDRSFGGGVNLSSKLAQIACHGNLCHSFQSFNTCYT 366

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   +      L  ++ + E+ +    +   ++   + S   
Sbjct: 367 DTGLWGLYMVCEPSTVQDMVHFVQREWIRLCTSVTENEVARARNLLKTNMLLQLDGSTPI 426

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I AI  + I  V  K   +  P +A LGP ++ +P  
Sbjct: 427 CEDIGRQMLCYKRRIPIPELEARIEAIDAQTIREVCTKYIYNKHPAVAALGP-IEQLPEY 485

Query: 412 SELIHALEGFR 422
           +++   +   R
Sbjct: 486 NKICSGMYWLR 496


>gi|229061408|ref|ZP_04198753.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH603]
 gi|229168544|ref|ZP_04296267.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH621]
 gi|228614950|gb|EEK72052.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH621]
 gi|228717831|gb|EEL69479.1| Uncharacterized zinc protease ymxG [Bacillus cereus AH603]
          Length = 432

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 128/414 (30%), Positives = 233/414 (56%), Gaps = 4/414 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSKQLDTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +        ++II++++ +T +++  + + +F+   + A++ P    +P   +L
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISPD-GKLPKGMKL 432


>gi|229134612|ref|ZP_04263422.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST196]
 gi|228648873|gb|EEL04898.1| Uncharacterized zinc protease ymxG [Bacillus cereus BDRD-ST196]
          Length = 432

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 129/414 (31%), Positives = 233/414 (56%), Gaps = 4/414 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + V I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGVWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSKQLDTLYETMQETLNALKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +        ++II++++ +T +++  + + +F+   + A++ P    +P   +L
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISPD-GKLPKGMKL 432


>gi|320008200|gb|ADW03050.1| peptidase M16 domain protein [Streptomyces flavogriseus ATCC 33331]
          Length = 457

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 130/428 (30%), Positives = 215/428 (50%), Gaps = 12/428 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT KR+
Sbjct: 28  TVRRTVLPGGLRVVTETLPSVRSATFGIWANVGSRDETPTLNGATHYLEHLLFKGTAKRS 87

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 88  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 147

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 148 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 207

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYF--------NVCSVAKIKESMKPAVYVGGEYIQKRD 232
              + V   G VDH   V QV   F                +   +     G   +  R 
Sbjct: 208 PTHLVVAAAGNVDHATVVRQVRRAFERAGALTRTDAVPTAPRAGSRTLRAAGKVELLNRK 267

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 268 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 327

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +     +   EI +   ++    +   E +  
Sbjct: 328 DCGLFAVYAGCRPSQVHDVLKICRDELDRVATHGLGDEEIGRAVGQLAGSTVLGLEDTGA 387

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
               I K  +  G  +  + ++  I+A+T +++  VA  +    P+L+++GP  D     
Sbjct: 388 LMNRIGKSELCWGEQMSVDDMLAKIAAVTPDEVRAVAADVLGQRPSLSVIGPLKDK--QA 445

Query: 412 SELIHALE 419
             L  A+ 
Sbjct: 446 DRLQEAVS 453


>gi|209877471|ref|XP_002140177.1| insulinase [Cryptosporidium muris RN66]
 gi|209555783|gb|EEA05828.1| insulinase, putative [Cryptosporidium muris RN66]
          Length = 497

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 114/441 (25%), Positives = 197/441 (44%), Gaps = 21/441 (4%)

Query: 3   LRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
              S   +G+ V T      +    V I +GSR E +E++G+AHFLEHM+FKGTTKR+  
Sbjct: 58  YNTSVLRNGLRVATYETSDSAITFGVWIDSGSRYESKEKNGVAHFLEHMIFKGTTKRSRY 117

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  EIE +G  +NAYTS E T Y+A    + +P  +E++GD+L NS  +P+ IE ER V
Sbjct: 118 QLESEIENLGAHLNAYTSREQTVYYARCFNKDLPQCMELLGDILQNSVLDPAAIEAERFV 177

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + L  R     +K+  +G  ILG PE I +     ++ ++ +NY A+
Sbjct: 178 ILREMEEIEKTPEEILFDRLHMAAFKNNSLGYTILGPPENIKTINRNDLLDYIQKNYLAE 237

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +V VG + H   V  VE+ F+        E    + Y      +  D+   +  +  
Sbjct: 238 RMVIVGVGNLKHAEFVKHVENNFSNIPSKSKFEIPLDSSYPNFSGSEIVDMNNNYDQIVH 297

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVRE-------------------KRGLCYS 283
              AY+   +   ++ A +L   +     +                       + G  +S
Sbjct: 298 LAVAYEGVPWDHPDMPAFMLMQSIIGSYRKNEDYLIPPKISTNKTIYNIATGSETGDIHS 357

Query: 284 ISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLI 343
            SA +  + D G+    +   ++ +      ++    SL  +I   E+ +   ++  +L 
Sbjct: 358 FSAFNTCYKDTGIFGWYAECDRKAVNYCIDHMMLAFTSLSYSITDEEVFRAKNQLKLQLF 417

Query: 344 KSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
            S E     A EI + ++     +   + I  I AI+ +D+  VA K    +      +G
Sbjct: 418 SSIETPNSIAEEIGRHLLVYNRYVHMLEWIKRIDAISVQDLKRVAFKYLYDAKIAFTTMG 477

Query: 403 PPMDHVPTTSELIHALEGFRS 423
             +D +P  + L       +S
Sbjct: 478 -AIDKIPDYTTLRVKTSQLKS 497


>gi|227204505|dbj|BAH57104.1| AT3G02090 [Arabidopsis thaliana]
          Length = 480

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 117/429 (27%), Positives = 202/429 (47%), Gaps = 16/429 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT +RT +
Sbjct: 47  RVTTLPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDRRTVR 106

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            + EEIE +GG +NAYTS E T+Y+A VL  +V  AL+++ D+L NS F    I RER+V
Sbjct: 107 ALEEEIEDIGGHLNAYTSREQTTYYAKVLDSNVNQALDVLADILQNSKFEEQRINRERDV 166

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + + S T E + +++  +YTA 
Sbjct: 167 ILREMQEVEGQTDEVVLDHLHATAFQYTPLGRTILGPAQNVKSITREDLQNYIKTHYTAS 226

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGEYIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      S        +       +   DL    
Sbjct: 227 RMVIAAAGAVKHEEVVEQVKKLFTKLSSDPTTTSQLVANEPASFTGSEVRMIDDDLPLAQ 286

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + F G ++   D     ++ ++LG    +    +              +  SI A + 
Sbjct: 287 FAVAFEGASWTDPDSVALMVMQTMLGSWNKNVGGGKHVGSDLTQRVAINEIAESIMAFNT 346

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L+ +I+  V  L   +   ++ +   ++ + L+   + +
Sbjct: 347 NYKDTGLFGVYAVAKADCLDDLSYAIMYEVTKLAYRVSDADVTRARNQLKSSLLLHMDGT 406

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
              A +I +Q++  G  + + ++   I A+    +  VA K        ++ +GP  D +
Sbjct: 407 SPIAEDIGRQLLTYGRRIPTAELFARIDAVDASTVKRVANKYIYDKDIAISAIGPIQD-L 465

Query: 409 PTTSELIHA 417
           P  ++    
Sbjct: 466 PDYNKFRRR 474


>gi|15232845|ref|NP_186858.1| mitochondrial processing peptidase beta subunit, putative
           [Arabidopsis thaliana]
 gi|85700445|sp|Q42290|MPPB_ARATH RecName: Full=Probable mitochondrial-processing peptidase subunit
           beta; AltName: Full=Beta-MPP; Flags: Precursor
 gi|6513923|gb|AAF14827.1|AC011664_9 putative mitochondrial processing peptidase [Arabidopsis thaliana]
 gi|22022518|gb|AAM83217.1| AT3g02090/F1C9_12 [Arabidopsis thaliana]
 gi|23397047|gb|AAN31809.1| putative mitochondrial processing peptidase [Arabidopsis thaliana]
 gi|23463071|gb|AAN33205.1| At3g02090/F1C9_12 [Arabidopsis thaliana]
 gi|25054848|gb|AAN71914.1| putative mitochondrial processing peptidase [Arabidopsis thaliana]
 gi|332640240|gb|AEE73761.1| mitochondrial processing peptidase [Arabidopsis thaliana]
          Length = 531

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 117/429 (27%), Positives = 202/429 (47%), Gaps = 16/429 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT +RT +
Sbjct: 98  RVTTLPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTDRRTVR 157

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            + EEIE +GG +NAYTS E T+Y+A VL  +V  AL+++ D+L NS F    I RER+V
Sbjct: 158 ALEEEIEDIGGHLNAYTSREQTTYYAKVLDSNVNQALDVLADILQNSKFEEQRINRERDV 217

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + + S T E + +++  +YTA 
Sbjct: 218 ILREMQEVEGQTDEVVLDHLHATAFQYTPLGRTILGPAQNVKSITREDLQNYIKTHYTAS 277

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGEYIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      S        +       +   DL    
Sbjct: 278 RMVIAAAGAVKHEEVVEQVKKLFTKLSSDPTTTSQLVANEPASFTGSEVRMIDDDLPLAQ 337

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + F G ++   D     ++ ++LG    +    +              +  SI A + 
Sbjct: 338 FAVAFEGASWTDPDSVALMVMQTMLGSWNKNVGGGKHVGSDLTQRVAINEIAESIMAFNT 397

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L+ +I+  V  L   +   ++ +   ++ + L+   + +
Sbjct: 398 NYKDTGLFGVYAVAKADCLDDLSYAIMYEVTKLAYRVSDADVTRARNQLKSSLLLHMDGT 457

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
              A +I +Q++  G  + + ++   I A+    +  VA K        ++ +GP  D +
Sbjct: 458 SPIAEDIGRQLLTYGRRIPTAELFARIDAVDASTVKRVANKYIYDKDIAISAIGPIQD-L 516

Query: 409 PTTSELIHA 417
           P  ++    
Sbjct: 517 PDYNKFRRR 525


>gi|319649512|ref|ZP_08003668.1| zinc protease [Bacillus sp. 2_A_57_CT2]
 gi|317398674|gb|EFV79356.1| zinc protease [Bacillus sp. 2_A_57_CT2]
          Length = 411

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 132/409 (32%), Positives = 226/409 (55%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E +P + S  + V I  GSRNE  E +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCQNGVRVVLENIPTVRSVAIGVWIGTGSRNEIPENNGISHFLEHMFFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL  H   ALE++ DM  NS+F   ++ +E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDTHSDFALEVLSDMFFNSTFVDEELNKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+ ++++  +G PILG   T+++F  E +  ++   YT 
Sbjct: 122 VVYEEIKMYEDTPDDIVHDLLSKAIYENHSLGYPILGTEGTLATFNGETLKQYMHETYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G ++    + +VE YF        + S +   +      +K+D  + H+ LG
Sbjct: 182 ENVVISIAGNINES-FIKEVEKYFGSYEGGNRERSEQKPEFHSNHLARKKDTEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L +ILG  MSSRLFQ+VRE++GL YS+ ++H  F D+G++ +  
Sbjct: 241 FEGLQVGHEDIYNLIVLNNILGGSMSSRLFQDVREQKGLAYSVFSYHSAFQDSGIVTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  +I E + +   E I  +E++    ++   L+ S E +  R     K  
Sbjct: 301 GTGAKQLDVLFDTIQETLATLKKEGITDKELNNSKEQLKGSLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +  G     ++I++ I A++ + +  +AK IF+   ++A++ P  + +P
Sbjct: 361 LLLGRHRSMDEIVEEIDAVSMQGVNDMAKSIFTEHYSVALISPEGE-LP 408


>gi|301122201|ref|XP_002908827.1| mitochondrial-processing peptidase subunit beta [Phytophthora
           infestans T30-4]
 gi|262099589|gb|EEY57641.1| mitochondrial-processing peptidase subunit beta [Phytophthora
           infestans T30-4]
          Length = 466

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 111/425 (26%), Positives = 191/425 (44%), Gaps = 12/425 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   SG+ V +E    ++A V V I AGSR E  + +G AHFLEHM FKGT+KRT ++
Sbjct: 37  EVTTLPSGLRVASEGSHGETATVGVWIGAGSRYETAQNNGAAHFLEHMAFKGTSKRTQQQ 96

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +GG +NAYTS E T Y+A V K+ VP A++I+ D+L NS  + + IERER+V+
Sbjct: 97  LELEIENMGGHLNAYTSREQTVYYAKVFKKDVPRAMDILSDILQNSKLDEAAIERERDVI 156

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+        + +  R  E  +    +GR ILG  E I +     +  +++ +YTA R
Sbjct: 157 LREMEEVNKQQEEVIFDRLHETAFMGNGLGRTILGPIENIRNLKKSDLQDYIATHYTAPR 216

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
           M +   GAVDH   V   +  F               V   G  ++ +D +     +   
Sbjct: 217 MVIAGAGAVDHSQLVELAQKSFGDLPTTPAVAPTLEPVRFLGSDVRIKDDSMPLAHVAIA 276

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREK----------RGLCYSISAHHENFSD 293
              +     +   +L      G   R                  + L +S  + +  + D
Sbjct: 277 FEGFSWTSEHSFPLLIMQTLLGSWDRTSGAGMNMSSKLGQVVAEKELAHSYMSFNTCYQD 336

Query: 294 NGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
            G+  + +   K  +  LT   +E +  L+      E+++   ++ A ++   + S    
Sbjct: 337 TGLFGVYAVADKYKLNDLTWYTMEALVRLVHKTTDDEVERAKTQLKANMLMQLDGSSPIC 396

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGPPMDHVPTTS 412
            +I +Q++  G  +   +I   I A+    +   A ++ +     LA  GP +  +P  +
Sbjct: 397 EDIGRQMLTYGRRMTPAEIFARIDAVDAAAVRKTADEVVNDKEHALAATGP-IHELPDYN 455

Query: 413 ELIHA 417
            +   
Sbjct: 456 FIRRR 460


>gi|229490834|ref|ZP_04384669.1| peptidase, M16 family [Rhodococcus erythropolis SK121]
 gi|229322224|gb|EEN88010.1| peptidase, M16 family [Rhodococcus erythropolis SK121]
          Length = 452

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 130/408 (31%), Positives = 217/408 (53%), Gaps = 7/408 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +    G+ V+TE +P   SA V V +  GSR+E+    G AHFLEH+LFK T  RTA
Sbjct: 28  VQRTVLPGGLRVVTEFIPGVRSASVGVWVGVGSRDEQPSVAGAAHFLEHLLFKSTPSRTA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT ++A V+ + +P+A++++ D++       +D++ ER 
Sbjct: 88  LDIAQVMDGVGGELNAFTSKEHTCFYAHVIDDDLPMAVDLVADVVLRGRCRTADVDVERQ 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRPI+G  E+I S +  ++ SF  R YT 
Sbjct: 148 VVLEEIAMRDDDPEDLLGDAFLTALFGDHPVGRPIIGSVESIESMSRNQLHSFHVRRYTP 207

Query: 182 DRMYVVCVGAVDHEF-----CVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
            RM +   G VDH+        +           A  +E       +    +  RD  + 
Sbjct: 208 QRMVLAVAGNVDHKQVVTLARRAFAGHLERGVKPAPRREGTLRLRTMPELSLTHRDSEQV 267

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + +G G+SSRLFQE+REKRGL YS+ +  + F+D G 
Sbjct: 268 HLALGVRAFGRHEGHRWALSVLNAAVGGGLSSRLFQEIREKRGLAYSVYSGVDTFADTGA 327

Query: 297 LYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +    EN+  + + I EV+ ++  + I   EI +    +   L+ + E S  R   
Sbjct: 328 FSVYAGCQPENLGEVATVIREVLANVATDGITDAEIARAKGSLRGGLVLALEDSGSRMNR 387

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           I +  +  G+     + + TI A+T E+++ VA+ + +     A++GP
Sbjct: 388 IGRSELNYGNHRSVAQTLATIDAVTSEEVLEVAQVLLTRPFAAAVVGP 435


>gi|226306132|ref|YP_002766092.1| M16 family peptidase [Rhodococcus erythropolis PR4]
 gi|226185249|dbj|BAH33353.1| putative M16 family peptidase [Rhodococcus erythropolis PR4]
          Length = 438

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 131/408 (32%), Positives = 217/408 (53%), Gaps = 7/408 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +    G+ V+TE +P   SA V V +  GSR+E+    G AHFLEH+LFK T  RTA
Sbjct: 14  VQRTVLPGGLRVVTEFIPGVRSASVGVWVGVGSRDEQPSVAGAAHFLEHLLFKSTPSRTA 73

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT ++A V+ E +P+A++++ D++       +D++ ER 
Sbjct: 74  LDIAQVMDGVGGELNAFTSKEHTCFYAHVIDEDLPMAVDLVADVVLRGRCRTADVDVERQ 133

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRPI+G  E+I S +  ++ SF  R YT 
Sbjct: 134 VVLEEIAMRDDDPEDLLGDAFLTALFGDHPVGRPIIGSVESIESMSRNQLHSFHVRRYTP 193

Query: 182 DRMYVVCVGAVDHEF-----CVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
            RM +   G VDH+        +           A  +E       +    +  RD  + 
Sbjct: 194 QRMVLAVAGNVDHKQVVTLARRAFAGHLERGVKPAPRREGTLRLRTMPELSLTHRDSEQV 253

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + +G G+SSRLFQE+REKRGL YS+ +  + F+D G 
Sbjct: 254 HLALGVRAFGRHEGHRWALSVLNAAVGGGLSSRLFQEIREKRGLAYSVYSGVDTFADTGA 313

Query: 297 LYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +    EN+  + + I EV+ ++  + I   EI +    +   L+ + E S  R   
Sbjct: 314 FSVYAGCQPENLGEVATVIREVLANVATDGITDAEIARAKGSLRGGLVLALEDSGSRMNR 373

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           I +  +  G+     + + TI A+T E+++ VA+ + +     A++GP
Sbjct: 374 IGRSELNYGNHRSVAQTLATIDAVTSEEVLEVAQVLLTRPFAAAVVGP 421


>gi|229586465|ref|YP_002844966.1| protease [Rickettsia africae ESF-5]
 gi|228021515|gb|ACP53223.1| protease [Rickettsia africae ESF-5]
          Length = 411

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 146/405 (36%), Positives = 240/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 3   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 62

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 63  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 122

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 123 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 183 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNDFINKELEQTSLVL 241

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 242 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 302 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP 
Sbjct: 362 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGPN 406


>gi|157826939|ref|YP_001496003.1| protease [Rickettsia bellii OSU 85-389]
 gi|157802243|gb|ABV78966.1| protease [Rickettsia bellii OSU 85-389]
          Length = 412

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 152/405 (37%), Positives = 242/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G+AHFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGNRYENPEEEGIAHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E T Y++ VL E+   AL II D++ NS+F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHEKTVYYSRVLSENCNKALAIIADIVQNSAFAEEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  ++D+  D +  +F   V+KDQ +G+PILG  +T+ +F  +  + F  ++Y 
Sbjct: 124 QVILQEIAHAQDNPDDLVYEKFYNSVFKDQPLGKPILGTSKTLETFNRDHFLKFTGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+  Y+   G VDHE  V + E  F+  +  + K +  PA Y+GG     +DL +  ++L
Sbjct: 184 AENFYLSIAGNVDHEEIVKEAERLFSSLTQGE-KSNFSPAKYIGGHSFINKDLEQTTLIL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T +LA I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEMLYQTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSPYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L + +   ++ + E ++Q EI++   +I + L  +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLAAELKNEIKRMAEQVKQEEIERARTQIRSNLQMAQEKVAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I  I   DI+  A +IFSS+ T A++GP 
Sbjct: 363 YAVFGKYISPEEIMEIIMNIKAADIIQTANRIFSSSATSAVIGPN 407


>gi|158260751|dbj|BAF82553.1| unnamed protein product [Homo sapiens]
          Length = 489

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 96/431 (22%), Positives = 195/431 (45%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F          I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGGIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGD-------GMSSRLFQEVREKRGL-CYSISAHHENFS 292
                 +   D     +  +++G+       GM+           G  C+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNRDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + ++ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESDVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP +  +P  
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IKQLPDF 477

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 478 KQIRSNMCWLR 488


>gi|157825424|ref|YP_001493144.1| mitochondrial protease [Rickettsia akari str. Hartford]
 gi|157799382|gb|ABV74636.1| mitochondrial protease [Rickettsia akari str. Hartford]
          Length = 412

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 147/405 (36%), Positives = 240/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E+T Y+  VL E+   A+ I+ D++ NS F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHENTVYYVRVLSENCDKAVNILADIIQNSIFADEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V++DQ +G+ ILG  +TI++FT E  ++F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYRDQPLGKLILGTTKTIAAFTQEHFLTFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFIHKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQTIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTETVSAEEIIRAKTQLRSNLQMAQEKNAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I+ I  +DI+  A KIFS T T AI+GP 
Sbjct: 363 YSVFGKYISPEEIMEIITNIKTDDIINTANKIFSGTTTSAIIGPN 407


>gi|239947859|ref|ZP_04699612.1| peptidase, M16 family [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|241116862|ref|XP_002401644.1| metalloprotease, putative [Ixodes scapularis]
 gi|215493188|gb|EEC02829.1| metalloprotease, putative [Ixodes scapularis]
 gi|239922135|gb|EER22159.1| peptidase, M16 family [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 412

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 145/404 (35%), Positives = 238/404 (58%), Gaps = 3/404 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AKQIAEEFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILTDIIQNSIFADEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGSGFINKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQTIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYKEIKNEIIKMTEKVNTEEIIRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
               G  +  E+I++ I +I  +DI+  A KIF    T AI+GP
Sbjct: 363 YSVFGKYISPEEIMEIIMSIKADDIINTANKIFRGATTSAIIGP 406


>gi|238650423|ref|YP_002916275.1| protease [Rickettsia peacockii str. Rustic]
 gi|238624521|gb|ACR47227.1| protease [Rickettsia peacockii str. Rustic]
          Length = 412

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 146/405 (36%), Positives = 240/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP 
Sbjct: 363 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGPN 407


>gi|221633484|ref|YP_002522709.1| processing protease [Thermomicrobium roseum DSM 5159]
 gi|221156418|gb|ACM05545.1| processing protease [Thermomicrobium roseum DSM 5159]
          Length = 421

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 132/415 (31%), Positives = 219/415 (52%), Gaps = 6/415 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+ + +   +GI ++T  MP + SA V V +  GSR E     G++HFLEHMLFKGT +R
Sbjct: 1   MDYQKTCLPNGIRIVTSRMPHVRSATVIVYVGVGSRYESDRLAGISHFLEHMLFKGTERR 60

Query: 60  TAKE-IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
                I E IE VGG +NA T  EHT Y   V   H+ LA +++ DML +S F+P ++E+
Sbjct: 61  PDPVLISEAIEGVGGMMNASTGREHTDYWVKVPSRHLELAFDVLADMLRHSLFDPGELEK 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           ER+V++EEI    D   D++       +W    +GRPI+G  ET+ + T +++I+++ ++
Sbjct: 121 ERHVIVEEIHGIRDTPDDYVHDLVDRALWNGHPLGRPIIGSEETVEAITRDELIAYLEQH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI--KESMKPAVYVGGEYIQKRDLAEE 236
           Y ADR+ V   G + HE  +  V+ YF              + +       + +R   + 
Sbjct: 181 YRADRLVVAAAGDLTHEQVIELVQRYFGDLEPGTPADPHPARLSDARPTIELLERPTEQA 240

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ L      Y+    ++  +L S+L  GMSSRLF+E+RE++GL Y +  +   ++D G 
Sbjct: 241 HLCLALPALPYRDERRFVQGMLDSVLSSGMSSRLFKEIRERQGLAYEVYGYLREYADVGQ 300

Query: 297 LYIASATA-KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             I + T  +    AL +   E+ + + E +   E+++       +++   E S   A  
Sbjct: 301 AVIYTGTDVERAERALRAVRGELEKLVREPVPDDELERTKELRVGRIVMGLEDSRAVASW 360

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVP 409
           I  Q +  G +L  E++I  I A+T E+I  +A+++F      LA++GP  D  P
Sbjct: 361 IGGQELVFGEVLTPEEVIARIRAVTSEEIQALAQELFQPERFALAVIGPFADVEP 415


>gi|221483355|gb|EEE21674.1| mitochondrial processing peptidase beta subunit, putative
           [Toxoplasma gondii GT1]
 gi|221507839|gb|EEE33426.1| mitochondrial processing peptidase beta subunit, putative
           [Toxoplasma gondii VEG]
          Length = 524

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 111/426 (26%), Positives = 199/426 (46%), Gaps = 22/426 (5%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +   +GI V T+ +P   +A V V I +GSR + +E +G AHFLEHM FKGT +R+  +
Sbjct: 71  TTTLPNGIRVATQRLPFHQTATVGVWIDSGSRYDTKETNGAAHFLEHMTFKGTKRRSRIQ 130

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +EIE +G  +NAYTS E T Y+A   K+ +P  ++I+ D+L NS+ +   ++ E++V+
Sbjct: 131 LEQEIENMGAHLNAYTSREQTVYYAKAFKKDIPQCVDILSDILLNSTIDEEAVQMEKHVI 190

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E  + + +  R     ++D  +G  ILG  E I + T E I+ +++RNYT+DR
Sbjct: 191 LREMEEVERQTEEVIFDRLHTTAFRDSPLGYTILGPEENIRNMTREHILEYINRNYTSDR 250

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEHM 238
           M V   G VDH+   + VE +F      K  + + P            +         H+
Sbjct: 251 MVVAAAGDVDHKELTALVEKHFAGLPQPKRSKIILPTEKPFFCGSELLHRNDDMGPTAHV 310

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSR--------------LFQEVREKRGLCYSI 284
            +GF G  ++S D     ++ +I+G                         +   G     
Sbjct: 311 AVGFEGVPWKSPDAVTFMLMQAIVGSYRKHDEGIVPGKVSANATVRNVCNKMTVGCADMF 370

Query: 285 SAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIK 344
           SA +  +SD G+    +   +  +      I+  + SL   +   E+++  A++  +L+ 
Sbjct: 371 SAFNTCYSDTGLFGFYAQCDEVALEHCVMEIMFGITSLSYAVTDEEVERAKAQLKTQLLG 430

Query: 345 SQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILG 402
             + +   A +I +Q++  G  +   + +  +  I  E++  VA K       P    LG
Sbjct: 431 HLDSTTAVAEDIGRQMLAYGRRMPLAEFLKRLEVIDAEEVKRVAWKYLHDAVRPKFGALG 490

Query: 403 PPMDHV 408
              + +
Sbjct: 491 SRKEEL 496


>gi|51892670|ref|YP_075361.1| processing protease [Symbiobacterium thermophilum IAM 14863]
 gi|51856359|dbj|BAD40517.1| processing protease [Symbiobacterium thermophilum IAM 14863]
          Length = 426

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 123/410 (30%), Positives = 220/410 (53%), Gaps = 7/410 (1%)

Query: 1   MN-LRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK 58
           M   R +   +G+ V+TE +  + SA V V +  GS  E   E G++H +EHMLFKGT +
Sbjct: 1   MTFYRKTTLPNGLRVVTEAIGHVRSAAVGVYVGTGSLYEAPAEMGVSHLIEHMLFKGTER 60

Query: 59  RTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIER 118
           R+A EI   I+  GG +NAYT+ E+T Y+A VL EH+PLAL+++ DM+ NS F+P D+ R
Sbjct: 61  RSALEIARAIDGRGGALNAYTAKEYTCYYARVLDEHLPLALDVLADMILNSRFDPDDLAR 120

Query: 119 ERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRN 178
           E++V+ EEI M +D   D +   F+  +W+   +GRPI+G  E + + +   I+++ +R+
Sbjct: 121 EKDVICEEIRMYDDVPDDLVHDLFAGALWRGHALGRPIVGTVERVQAMSRADILAYKNRH 180

Query: 179 YTADRMYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAE 235
           Y    M V   G ++HE  V  V   F   +     +      P        ++++++ +
Sbjct: 181 YVPANMVVAAAGHLEHERVVEWVAELFGAAAAEADGRPAPDAPPVPRTPAIAVRQKEIEQ 240

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H++LG    +    + Y  ++L +I+G   SSRLFQEVREKRGL YS+ ++H ++   G
Sbjct: 241 AHLVLGTTALSLDDPNIYALHVLNAIVGGSSSSRLFQEVREKRGLAYSVYSYHSSYRSAG 300

Query: 296 VLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
              + +  +   + A    +  V+ +     + + E+ +   ++  +L+   E +  R  
Sbjct: 301 AFGVYAGVSPRMVGATLDVVTGVLSELGRRGVTEEELAEAREQLKGQLMLGLESTSSRMS 360

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTL-AILGP 403
            + +  +  G +   +++I  + A+T E +  +A ++F     + A + P
Sbjct: 361 RLGRGELIRGFVHSPDEVIARVEAVTLEQVNELAHRLFVEEARVMAAVVP 410


>gi|91085025|ref|XP_973732.1| PREDICTED: similar to mitochondrial processing peptidase beta
           subunit [Tribolium castaneum]
 gi|270008520|gb|EFA04968.1| hypothetical protein TcasGA2_TC015046 [Tribolium castaneum]
          Length = 477

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 107/431 (24%), Positives = 199/431 (46%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++  +SGI V TE     +A V + I AGSR E  + +G+AHF+EHM FKGT KR+  +
Sbjct: 47  NVTTLNSGIRVATEDWGSHTATVGIWIDAGSRYENSKNNGVAHFMEHMAFKGTGKRSQTQ 106

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y++  L + VP A+EI+GD++ N+    ++IERER V+
Sbjct: 107 LEVEIEDMGAHLNAYTSREQTVYYSKCLAKDVPKAIEILGDIVQNAKLGEAEIERERGVI 166

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +      + ++   +   ILG    I +     +  ++  +Y A R
Sbjct: 167 LREMQEIESNLQEVVFDHLHAIAYQGTPLANTILGPTANIRAINANDLRCYLDNHYKASR 226

Query: 184 MYVVCVGAVDHEFCVSQVESY---FNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + V   G V+H+  V   E +    N     +I              ++   L   H+ +
Sbjct: 227 IVVAGAGGVNHDELVKLCEQHLTKLNNNYPDEIPILSPCRFTGSEIRVRDDSLPLAHIAI 286

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              G  +   D     + +++LG    S+   +              LC+S  + +  + 
Sbjct: 287 AVEGTGWTDPDTLTLMVASTLLGAWDRSQASAKQNATTLARASGEGELCHSYQSFNTCYK 346

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  I   +    I  +  +I +    L  ++ + E+++  A + A  +   + S   
Sbjct: 347 DTGLWGIYFVSDPLKIEDMVFNIQQEFMRLATSVTEGEVERAKALLTANTLLQLDTSTAV 406

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++  G  L   ++   I++IT +++  V  K      P +A +GP ++ +P  
Sbjct: 407 CEDIGRQLLCYGRRLPPHELTHRINSITAQNVRDVCYKYLYDRCPAIAAVGP-VEQLPDY 465

Query: 412 SELIHALEGFR 422
           + +  ++   R
Sbjct: 466 NRIRSSMYWLR 476


>gi|307207091|gb|EFN84900.1| Mitochondrial-processing peptidase subunit beta [Harpegnathos
           saltator]
          Length = 477

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 107/432 (24%), Positives = 197/432 (45%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           RI+   SG+ V +E     +A V + I +GSR E  E +G+AHF+EHM FKGTTKR+  +
Sbjct: 46  RITTLDSGMRVASEDSGAATATVGLWIDSGSRYETDENNGVAHFMEHMAFKGTTKRSQTD 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L + VP A+EI+ D++ NS    ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVFYAKCLSQDVPKAVEILSDIIQNSKLGETEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG    I S T   ++ +V  +Y   R
Sbjct: 166 LREMQEVETNLQEVVFDHLHAAAYQGTSLGRTILGPTNNIKSITRNDLLEYVRTHYGPTR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAK---IKESMKPAVYVGGEYIQKRD-LAEEHMM 239
             +   G VDH+  +   + +F          I + +K   Y G E   + D +   H+ 
Sbjct: 226 FVLAGAGGVDHKQLIELAQKHFGQMKEPNYNDIPDYIKSCRYTGSEIRVRDDTIPLAHIA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENF 291
           +   G  +   D     +  +++G     +               + GLC+S  + +  +
Sbjct: 286 IAVEGVGWPDADNIPLMVANTLMGAWDRGQGGGVNNASTLAKACAEEGLCHSYQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  +           + S I      L  ++ ++++ +    +   +    + +  
Sbjct: 346 KDTGLWGVYFVCDPMKCDDMASQIQHEWMKLCTSVTEKDVARAKNILKTNMFLQLDGTTA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I ++T E +  V  K IF   P +A +GP ++++  
Sbjct: 406 ICEDIGRQMLCYNRRIPLHELEMRIDSVTAETVRDVGMKYIFDHCPVIAAVGP-VENLLD 464

Query: 411 TSELIHALEGFR 422
            + +   +   R
Sbjct: 465 YNNIRSGMYWLR 476


>gi|291302561|ref|YP_003513839.1| peptidase M16 domain-containing protein [Stackebrandtia nassauensis
           DSM 44728]
 gi|290571781|gb|ADD44746.1| peptidase M16 domain protein [Stackebrandtia nassauensis DSM 44728]
          Length = 438

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 130/411 (31%), Positives = 213/411 (51%), Gaps = 9/411 (2%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ V+TE +P   SA V V +  GSR+E Q+  G +HFLEH+LFKGT +R+
Sbjct: 17  TVRRTVLPGGLRVLTESIPAMRSASVGVWVGIGSRDESQQLSGASHFLEHLLFKGTNRRS 76

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I  +IE VGG+ NAYT+ E T Y+A VL E VPLA++++ D++++S  +  D+E ER
Sbjct: 77  ALDISAQIEAVGGETNAYTAKEFTCYYARVLDEDVPLAIDVLADVITDSKLDADDVETER 136

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M  D+  D +   F+ +++ D  +   I G P +I +   ++I  F  R YT
Sbjct: 137 GVILEEIAMQRDEPGDEVHDIFAALMFGDHPLAHDISGTPASIEAMDRDQIHRFYKRRYT 196

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNV-------CSVAKIKESMKPAVYVGGEYIQKRDL 233
           A  M V   G VDHE  V+ V+  F                E+           +  RD 
Sbjct: 197 APHMVVAAAGNVDHEQVVTLVQKGFAPLLSDVDAEPAPLRDETATVPPAPTRLRVATRDS 256

Query: 234 AEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSD 293
            + H++LG +G A +    +   +L  ILG GMSSRLF  +RE  GL YS+ +    +++
Sbjct: 257 EQAHLVLGCHGLARRDERRFAFEVLGGILGGGMSSRLFHRIREDEGLAYSVFSSTSEYAE 316

Query: 294 NGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
            G+  + +    +N   +     EV+ +   + +   E+ +    +   L+   E +  R
Sbjct: 317 TGLFSVYAGCTPDNAHRVLELTNEVLAEIAADGVTASELKRGKGMVKGGLVLGMEDTGSR 376

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
              + +  +  G  L  ++I+  + A+T  D+  +A  + S   +LA+ GP
Sbjct: 377 MARLGRGELLFGDKLTVDEILAKVDAVTLADVAELAAVVLSRPRSLAVAGP 427


>gi|30021894|ref|NP_833525.1| Zinc protease [Bacillus cereus ATCC 14579]
 gi|29897450|gb|AAP10726.1| Zinc protease [Bacillus cereus ATCC 14579]
          Length = 432

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 128/409 (31%), Positives = 234/409 (57%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 21  IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 81  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   + +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 141 VVCEEIKMYEDAPDEIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 200

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 201 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 259

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 260 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 319

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 320 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 379

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++ G+ + +F+   + A++ P    +P
Sbjct: 380 LLLRKHRSLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISPD-GKLP 427


>gi|302528524|ref|ZP_07280866.1| metalloendopeptidase [Streptomyces sp. AA4]
 gi|302437419|gb|EFL09235.1| metalloendopeptidase [Streptomyces sp. AA4]
          Length = 461

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 133/420 (31%), Positives = 213/420 (50%), Gaps = 12/420 (2%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ S    G+ VITE +P   SA V + +  GSR+E     G AH+LEH+LFKGT  R A
Sbjct: 34  VKRSVLPGGLRVITEHVPASRSATVGLWVGVGSRDEPSPVAGAAHYLEHLLFKGTAHRDA 93

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EEI+ VGG+ NA+T+ EHT Y+A VL   +PLAL+++ D++  +     D++ ER+
Sbjct: 94  TQIAEEIDAVGGEFNAFTAKEHTCYYAQVLDADLPLALDLVTDVVFEAQCTDRDMDMERS 153

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   +  D  +GRP+LG  ++I+  +P  +  F  R YT 
Sbjct: 154 VVLEEIAMRDDDPEDLLHEEFVSAILGDHPLGRPVLGTEKSITEMSPVALRGFYRRRYTL 213

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
            RM +   G V+H   +  V+           +    +        V    +   D  + 
Sbjct: 214 PRMVLAVAGNVEHGQVLRLVKRALKDRLGGTATPVAPRSGRARLKTVPKLALHPDDTEQA 273

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+MLGF          +  ++L + LG GMSSRLFQE+RE+RGL Y + +   +++D G 
Sbjct: 274 HVMLGFRALPRHDERRFTLSVLNAALGGGMSSRLFQEIRERRGLAYQVYSSVASYADLGH 333

Query: 297 LYIASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           + + +    E +  +   I EV+ S+  + +   E+ +   ++   L+   E +  R   
Sbjct: 334 MSVYAGCQPERLGQVAGVIREVLDSVAADGLSDAEVARAKGQLRGGLVLGLEDTSSRMSR 393

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST---PTLAILGP--PMDHVPT 410
           I K  +     L  +  I  I A+T ED+  +A+ +        + A++GP    D +P 
Sbjct: 394 IGKNELNYARYLGVDDTIARIDAVTTEDVCALARTLLRRPGGVSSAAVVGPYAHADDLPD 453


>gi|34580763|ref|ZP_00142243.1| protease [Rickettsia sibirica 246]
 gi|28262148|gb|EAA25652.1| protease [Rickettsia sibirica 246]
          Length = 412

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 147/405 (36%), Positives = 240/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   +I + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQIRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP 
Sbjct: 363 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGPN 407


>gi|300788162|ref|YP_003768453.1| zinc protease [Amycolatopsis mediterranei U32]
 gi|299797676|gb|ADJ48051.1| putative zinc protease [Amycolatopsis mediterranei U32]
          Length = 454

 Score =  198 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 132/420 (31%), Positives = 216/420 (51%), Gaps = 12/420 (2%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ S    G+ VITE +P   SA V + +  GSR+E     G AH+LEH+LFKGT  R A
Sbjct: 27  VKRSVLPGGLRVITERVPASRSATVGLWVGIGSRDEPATVAGAAHYLEHLLFKGTKHRDA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I EEI+ VGG+ NA+T+ EHT Y+A VL   +PLA++++ D++ ++     D++ ER+
Sbjct: 87  TQIAEEIDAVGGEFNAFTAKEHTCYYAQVLDADLPLAVDLVTDVVFDALCTDRDMDMERS 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   +  D  +GRP+LG  ++I   +P  + +F  R YT 
Sbjct: 147 VVLEEISMRDDDPEDLLHETFVTAILGDHALGRPVLGTEKSIVEMSPAALRNFYKRRYTL 206

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAK-----IKESMKPAVYVGGEYIQKRDLAEE 236
            RM +   G +DH   +  V                 +E       V    +   D  + 
Sbjct: 207 PRMVLSVAGNIDHNQVLRLVRKALGERLTGTATPIAPREGRARIKTVPKLALHTDDTEQA 266

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+MLG    +      +  ++L + LG GMSSRLFQE+RE+RGL Y + +   +++D G 
Sbjct: 267 HVMLGLRSLSRHDDRRFALSVLNAALGGGMSSRLFQEIREQRGLAYQVYSSVASYADTGH 326

Query: 297 LYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           + + +    E +  +   I EV+ +  ++ + + E+ +   ++   ++   E +  R   
Sbjct: 327 MAVYAGCQPEKLGDVAGVIREVLDKVGVDGLTEAEVARAKGQLRGGIVLGLEDTSSRMSR 386

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST---PTLAILGP--PMDHVPT 410
           I K  +  G  L  +  I  I A+T ED+  +A+ +F+        A++GP    D +P 
Sbjct: 387 IGKNELNYGHYLGVDDTIARIDAVTTEDVCALARTLFARPGGVSAAAVVGPYAHADDLPD 446


>gi|60279683|ref|NP_001012514.1| mitochondrial-processing peptidase subunit beta [Danio rerio]
 gi|58833510|gb|AAH90167.1| Peptidase (mitochondrial processing) beta [Danio rerio]
          Length = 470

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 97/425 (22%), Positives = 196/425 (46%), Gaps = 11/425 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E +  +G AHFLEHM FKGT KR+  +
Sbjct: 45  KLTTLDNGLRVASEDSGLSTCTVGLWIDAGSRYENEHNNGTAHFLEHMAFKGTRKRSQLD 104

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 105 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 164

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I +     ++ +++ +Y   R
Sbjct: 165 LREMQEVETNLQEVVFDYLHATAYQETPLGRTILGPTENIKTINRGDLVEYITTHYKGPR 224

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H   +   + +F         E++ P  + G E   + D +   H+ +  
Sbjct: 225 IVLAAAGGVSHNQLIDLAKYHFGKLPARYSGEALLPCHFTGSEIRVRDDKMPLAHIAVAV 284

Query: 243 NGCAYQSRDFYLTNILASILGD-------GMSSRLFQEVREKRGL-CYSISAHHENFSDN 294
               +   D     +  +++G+       GM+          +G  C+S  + +  ++D 
Sbjct: 285 EAVGWSHPDTIPLMVANTLIGNWDRSLGGGMNLSSKLAQMSCQGNLCHSFQSFNTCYTDT 344

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +        +SL  ++ + E+++    +   ++   + S     
Sbjct: 345 GLWGLYMVCEPGTVHDMIRFTQLEWKSLCTSVTESEVNRAKNLLKTNMLLHLDGSTPICE 404

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I AI    I  V  K   +  P +A +GP ++ +   + 
Sbjct: 405 DIGRQMLCYSRRIPLHELEARIDAINATTIKDVCLKYIYNKAPAIAAVGP-IEQLLDYNS 463

Query: 414 LIHAL 418
           + + +
Sbjct: 464 IRNGM 468


>gi|326941571|gb|AEA17467.1| Zinc protease [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 413

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 129/409 (31%), Positives = 234/409 (57%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSVAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++ G+ + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISPD-GKLP 408


>gi|295706235|ref|YP_003599310.1| zinc protease [Bacillus megaterium DSM 319]
 gi|294803894|gb|ADF40960.1| zinc protease [Bacillus megaterium DSM 319]
          Length = 414

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 131/409 (32%), Positives = 225/409 (55%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +  + S  + V I  GSR+E  E +G++HFLEHM FKGT  R+A
Sbjct: 2   IKRYTCKNGVRIVLENISTVRSVAIGVWIGTGSRSEHSEINGVSHFLEHMFFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  NSSF+  ++ RE+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHADQALDVLADMFFNSSFDEEELAREKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +     + V+ +  +G PILG  +T+ +F  + +  ++ + Y  
Sbjct: 122 VVYEEIKMYEDTPDDIVHDLLGKAVYGNHPLGYPILGTEDTLKTFNGDSLRQYMEQMYIP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G +D    + QVE+YF   + +          +      +K++  + H+ LG
Sbjct: 182 ENIVISVAGNIDES-FIQQVENYFGTYTSSHSAHQYVQPGFHTNHIARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D+G++ I  
Sbjct: 241 FKGLPIGGEDVYSLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYRDSGLVTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L  ++ E +  L +  I  +E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSHQLDVLYDTVQETLYDLKDKGITDKELANSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +  G     ++I+D ++A+T + + G+A+ IF     L+++ P  D +P
Sbjct: 361 LMLGYHRSLDEILDLVNAVTKDSVNGLARDIFKDEFALSLISPSGD-LP 408


>gi|157828171|ref|YP_001494413.1| mitochondrial protease [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932869|ref|YP_001649658.1| peptidase, M16 family [Rickettsia rickettsii str. Iowa]
 gi|157800652|gb|ABV75905.1| mitochondrial protease [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907956|gb|ABY72252.1| peptidase, M16 family [Rickettsia rickettsii str. Iowa]
          Length = 412

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 147/405 (36%), Positives = 240/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENVEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AENLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGHGFINKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYREIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  L  E+I++ I +I  +DI+  A KIFS T T AI+GP 
Sbjct: 363 YSVFGQYLSPEEIMEIIMSIQADDIINTANKIFSGTITSAIIGPN 407


>gi|78222802|ref|YP_384549.1| peptidase M16-like [Geobacter metallireducens GS-15]
 gi|78194057|gb|ABB31824.1| Peptidase M16-like protein [Geobacter metallireducens GS-15]
          Length = 418

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 126/413 (30%), Positives = 222/413 (53%), Gaps = 3/413 (0%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           +   +G+ VI+E MP   S  + + +  GSR+ER+E +G+AHF+EH+LFKGT +R+A +I
Sbjct: 5   TILDNGVRVISEYMPHAHSVSIGIWVANGSRHERREHNGVAHFIEHLLFKGTVRRSALDI 64

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
             EI+ VGG +NA+TS E+  Y+A VL +++P A++++ D+  NS+F+P +IE+ER VVL
Sbjct: 65  AREIDSVGGVLNAFTSREYVCYYAKVLDKNLPQAVDLLTDIFLNSTFDPEEIEKERKVVL 124

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           +EI M ED   D++   F    W+   +G  ILG  E++S+ + + I++     Y ++ +
Sbjct: 125 QEISMLEDSPDDYVHDLFHRSFWRGHPLGMSILGSAESVSNLSRDAIVAHRDAMYRSEDI 184

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
            V   G V H+  +  +   F+       +      VY     I ++DL + H+ LG   
Sbjct: 185 IVAVAGNVRHDELLKLISGSFDSVPEGTGRNCCHLPVYDQKLEIVEKDLEQLHICLGTKS 244

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
             +     +   ++ +ILG  MSSRLFQE+RE  GL Y++ ++  + +D G L + + T+
Sbjct: 245 LPHNHPRRFEAYLMNTILGGSMSSRLFQEIREHLGLAYTVYSYVVSHTDAGSLVVYAGTS 304

Query: 305 KENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            E +  +       ++ L    +   E++    ++   ++ S E S  R  +++K  ++ 
Sbjct: 305 PEKLSDVLEITCSELRRLKFEPVPATELEAAREQLKGNILLSLESSDNRMTKLAKNEIYF 364

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGPPMDHVPTTSELI 415
           G  L   ++     + T + I  +A   FS    TLA+ G     +P  S L+
Sbjct: 365 GRYLSLAELTGGFDSATADGIAELANDFFSGDYVTLALTGKISGQIPDLSHLV 417


>gi|218235633|ref|YP_002368606.1| zinc protease, insulinase family [Bacillus cereus B4264]
 gi|296504301|ref|YP_003666001.1| zinc protease [Bacillus thuringiensis BMB171]
 gi|218163590|gb|ACK63582.1| zinc protease, insulinase family [Bacillus cereus B4264]
 gi|296325353|gb|ADH08281.1| Zinc protease [Bacillus thuringiensis BMB171]
          Length = 413

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 129/409 (31%), Positives = 234/409 (57%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+++FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLNTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELMNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++ G+ + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISPD-GKLP 408


>gi|206972735|ref|ZP_03233669.1| zinc protease, insulinase family [Bacillus cereus AH1134]
 gi|206732335|gb|EDZ49523.1| zinc protease, insulinase family [Bacillus cereus AH1134]
          Length = 413

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 129/409 (31%), Positives = 233/409 (56%), Gaps = 4/409 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGISHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLDTFTGDTLRQYIKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSVAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E +++L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSQQLDTLYETMQETLETLKNTGITEKELINSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVP 409
           +        ++II++++ +T E++ G+ + +F+   + A++ P    +P
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKENVDGLIRNMFTDEFSAALISPD-GKLP 408


>gi|297584088|ref|YP_003699868.1| processing peptidase [Bacillus selenitireducens MLS10]
 gi|297142545|gb|ADH99302.1| processing peptidase [Bacillus selenitireducens MLS10]
          Length = 409

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 120/401 (29%), Positives = 212/401 (52%), Gaps = 4/401 (0%)

Query: 3   LRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E    + S  + + I  GSR E ++E G++HF+EHMLFKGT  R+ 
Sbjct: 2   VKKVTAPNGLRIVYEQSEDVRSVSMGIWIGTGSRYEEEDEKGISHFIEHMLFKGTKTRSP 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I    + +GG +NA TS E+T Y+A VL  H   A++++ D+  +S     DI++E+ 
Sbjct: 62  QQIAASFDAIGGHVNAMTSKEYTCYYAKVLDSHADFAMDVLADIFFHSRLAAEDIKKEQA 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+ EEI M ED   D +  + SE+ +    +  PILG   TI SFT E++  ++ + YTA
Sbjct: 122 VIQEEINMYEDTPDDLVFEQLSEITYGGHPLAGPILGYKSTIDSFTTEQLNDYMKKTYTA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G V+  F    +         +     ++   +  GE  +K++  + H+ LG
Sbjct: 182 ENVVISICGHVNERFIEGII--NRFSDMPSHQPGLIEKPAFFPGEKGRKKETDQAHLALG 239

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G A  S   Y   +L + +G  MSSRLFQEVRE+RGL Y++ + HE + D G+L + +
Sbjct: 240 FEGVAADSSQMYPLVLLNNAIGGSMSSRLFQEVREERGLAYAVYSFHEAYRDTGLLSVYA 299

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             A + +  +   I+  +Q + E  +   E      ++   L+   E +  R     +  
Sbjct: 300 GCAIDRLDHVYEVIMSNLQKVKESGLTDTEWQNGKEQLKGSLMLGLEGTSSRMQRNGRNE 359

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
           +  G     + +++ I+AI+ EDI  VA  +F  TP+++++
Sbjct: 360 LILGRHRTLDDVLERINAISREDIQDVASNLFEQTPSISVV 400


>gi|15892216|ref|NP_359930.1| mitochondrial protease [Rickettsia conorii str. Malish 7]
 gi|29839594|sp|Q92IX7|Y293_RICCN RecName: Full=Uncharacterized zinc protease RC0293
 gi|15619351|gb|AAL02831.1| protease [Rickettsia conorii str. Malish 7]
          Length = 412

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 146/405 (36%), Positives = 238/405 (58%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVNSVAINLIAKVGARYENAEEDGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I E  + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F+  +I +E 
Sbjct: 64  AKQIAEAFDAIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFSDEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ + Y 
Sbjct: 124 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKYYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 184 AANLYLSIAGNIDHDKIVIIAEQLFSSLKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 243 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHDKLELLYKEIKNEIIKMTEQVSTEEILRAKTQLRSNLQMAQEKNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP 
Sbjct: 363 YSVFGQYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGPN 407


>gi|311030079|ref|ZP_07708169.1| Zn-dependent peptidase [Bacillus sp. m3-13]
          Length = 414

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 131/403 (32%), Positives = 218/403 (54%), Gaps = 3/403 (0%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
              S+G+ ++ E +P + S  + V I  GSRNE    +G++HFLEHM FKGT  + A+EI
Sbjct: 5   HTCSNGVRIVLENIPHVRSVAIGVWIGTGSRNEDNVNNGVSHFLEHMFFKGTETKNAREI 64

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            E  + +GG +NA+TS E+T Y+A V+ EH   AL ++ DM  +S F+  ++++E+NVV 
Sbjct: 65  AEAFDSIGGQVNAFTSKEYTCYYAKVMDEHSSYALGVLADMFFHSIFDEEELKKEKNVVY 124

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           EEI M ED   D +    +   + +  +G PILG  ET+S+F    +  ++   YT D +
Sbjct: 125 EEIKMYEDAPDDIVHDVLARASYGNHPLGYPILGTEETLSAFNGNTLRDYMKETYTPDNV 184

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
            +   G +D    V ++E+ F        K       +  G   +K+   + H+ +G++G
Sbjct: 185 VISVAGNIDES-FVKEIENLFGSYETGHSKREYVKPSFETGRIAKKKTTEQAHLCIGYDG 243

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
                +D Y   +L ++LG  MSSRLFQ+VRE+RGL YS+ ++H  F DNG+L I   T 
Sbjct: 244 LQIGDKDIYNLIVLNNVLGGSMSSRLFQDVREERGLAYSVYSYHSTFQDNGMLTIYGGTG 303

Query: 305 KENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
              +  L  +I + + +L    I ++E+     +I   L+ S E +  R     K  +  
Sbjct: 304 SNQLDLLFETIQQTLNTLKHDGITKKELVNSKEQIKGSLMLSLESTNSRMSRNGKNELLL 363

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           G     + I++ I++IT E +  +A KIF+   ++A++ P  +
Sbjct: 364 GRHRSLDDILERINSITEESVNNLATKIFTDEYSVALISPSGE 406


>gi|298715851|emb|CBJ28316.1| Mitochondrial Processing Peptidase beta subunit (C-terminal region)
           Mitochondrial Processing Peptida [Ectocarpus
           siliculosus]
          Length = 516

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 113/422 (26%), Positives = 204/422 (48%), Gaps = 14/422 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E     +A V V I AGSR E  E +G+AHFLEH+ FKGT KRT  +
Sbjct: 86  QVTTLPNGLRVASETSHGATASVGVWIDAGSRYETLENNGVAHFLEHVAFKGTRKRTQTQ 145

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A V KE +   LEI+ D+L NS  +   + RER+V+
Sbjct: 146 LETEIEDMGAHLNAYTSREQTVYYAKVFKEDLGRGLEILSDILMNSLIDEGAVHRERDVI 205

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+        + +     E+ ++   +GR ILG  E I S + +++  +++ +YTA R
Sbjct: 206 LREMEEVNKQQEEVILDNLHEVCFEKCGLGRTILGPAENIRSLSKQQLHDYITTHYTAPR 265

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGG----EYIQKRDLAEEHMM 239
           M VV  GA++HE  V   +  F        + S+            + +     +E ++ 
Sbjct: 266 MVVVGAGALEHEELVEMADRCFGNLPRDPPQGSIVTPDPAVFSGADKRVLNAKESEAYLA 325

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENF 291
           L F G ++     +   I+ +I+G    S     V           R +C+S +  +  +
Sbjct: 326 LAFQGSSWTDEHAFPLMIMQTIMGGWDRSSGANVVPPLGQALAMSPREICHSYTTFNTCY 385

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           +D G+  I +    E++  LT  ++E +  + +++   E+++   ++   ++   +    
Sbjct: 386 NDTGLFGIYAIAQPEHLEELTGLVLEHMVRMCQHVGDEEVERAKTQLKTNMLMQLDSFAA 445

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHVPT 410
              EI + ++  G  + + ++   I AI  ED+   A +  +     +A LGP +  +P 
Sbjct: 446 TIEEIGRHMLTYGRRMPAAEVFARIDAIEAEDVRVCANRFVNDEDHAMAALGP-VGGLPD 504

Query: 411 TS 412
             
Sbjct: 505 YD 506


>gi|149200830|ref|ZP_01877805.1| peptidase, M16 family protein [Roseovarius sp. TM1035]
 gi|149145163|gb|EDM33189.1| peptidase, M16 family protein [Roseovarius sp. TM1035]
          Length = 402

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 145/390 (37%), Positives = 215/390 (55%), Gaps = 1/390 (0%)

Query: 21  IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTS 80
           + SA + V + AG+R+E   ++G+AHFLEHM FKGT +R+A +I E IE VGG INAYTS
Sbjct: 4   LQSAAIGVWVLAGARHEEASQNGIAHFLEHMAFKGTKRRSALQIAEAIEDVGGYINAYTS 63

Query: 81  LEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDA 140
            E T+Y+  VLKE VPLAL+++ D+L N  F+P +IE ER V+L+EIG + D   D +  
Sbjct: 64  REVTAYYVRVLKEDVPLALDVVSDILRNPVFDPREIEVERGVILQEIGQAADTPDDIIFD 123

Query: 141 RFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQ 200
              E  + D  +GR ILG  E +  F    +  FV + Y   +M +   GAVDHE  V  
Sbjct: 124 WLQEKAYPDHPLGRTILGAEERVRGFDRPDLERFVDQYYRPGQMVLSAAGAVDHEALVRM 183

Query: 201 VESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILAS 260
            E  F    +         A + GGE    +DL + H  L F    Y   D Y   I AS
Sbjct: 184 AEGVFGDM-IPSHAIEPPVARFAGGETRHVKDLEQAHFALAFESPDYAHPDIYTAQIYAS 242

Query: 261 ILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQ 320
            LG  MSSRLFQE+RE+RGLCYSI A    +SD G++ I + T+ E +  L    ++ ++
Sbjct: 243 ALGGSMSSRLFQEIRERRGLCYSIYAQAGAYSDTGMMTIYAGTSGEQLGDLAGITIDEMK 302

Query: 321 SLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAIT 380
              E++   E+++  A++ A L+   E    RA  +++ +   G +    ++++ I A+T
Sbjct: 303 RAAEDMSAAEVERARAQMKAGLLMGLESPSNRAERLARMLQIWGRVPTLPEVVERIDAVT 362

Query: 381 CEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
             D+  +A+   +  P    L  P++  PT
Sbjct: 363 LADVRRLAESTVAQAPAALALYGPVEQAPT 392


>gi|332238058|ref|XP_003268220.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial-processing peptidase
           subunit beta-like [Nomascus leucogenys]
          Length = 491

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 92/429 (21%), Positives = 187/429 (43%), Gaps = 15/429 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y    
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGKG 238

Query: 184 MYVVC-----VGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             +V      V   +                  +I              ++   +   H+
Sbjct: 239 PRIVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHL 298

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHEN 290
            +      +   D     +  +++G+   S                   LC+S  + + +
Sbjct: 299 AIAVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGSLCHSFQSFNTS 358

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           ++D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S 
Sbjct: 359 YTDTGLWGLYMVCEPSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGST 418

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVP 409
               +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP ++ +P
Sbjct: 419 PICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IEQLP 477

Query: 410 TTSELIHAL 418
              ++   +
Sbjct: 478 DFKQICSNM 486


>gi|94734465|emb|CAK04413.1| novel protein (zgc:110738) [Danio rerio]
          Length = 470

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 97/425 (22%), Positives = 196/425 (46%), Gaps = 11/425 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E   + +  V + I AGSR E +  +G AHFLEHM FKGT KR+  +
Sbjct: 45  KLTTLDNGLRVASEDSGLSTCTVGLWIDAGSRYENEHNNGTAHFLEHMAFKGTRKRSQLD 104

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 105 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 164

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I +     ++ +++ +Y   R
Sbjct: 165 LREMQEVETNLQEVVFDYLHATAYQETPLGRTILGPTENIKTINRGDLVEYITTHYKGPR 224

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD-LAEEHMMLGF 242
           + +   G V H   +   + +F         E++ P  + G E   + D +   H+ +  
Sbjct: 225 IVLAAAGGVSHNQLIDLAKYHFGKLPARYSGEALLPCHFTGSEIRVRDDKMPLAHIAVAV 284

Query: 243 NGCAYQSRDFYLTNILASILGD-------GMSSRLFQEVREKRGL-CYSISAHHENFSDN 294
               +   D     +  +++G+       GM+          +G  C+S  + +  ++D 
Sbjct: 285 EAVGWSHPDTIPLMVANTLIGNWDRSLGGGMNLSSKLAQMSCQGNLCHSFQSFNTCYTDT 344

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+  +        +  +        +SL  ++ + E+++    +   ++   + S     
Sbjct: 345 GLWGLYMVCEPGTVHDMIRFTQLEWKSLCTSVTESEVNRAKNLLKTNMLLHLDGSTPICE 404

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++     +   ++   I AI    I  V  K   +  P +A +GP ++ +   + 
Sbjct: 405 DIGRQMLCYSRRIPLHELEARIDAINATTIKDVCLKYIYNKAPAIAAVGP-IEQLLDYNS 463

Query: 414 LIHAL 418
           + + +
Sbjct: 464 IRNGM 468


>gi|94968596|ref|YP_590644.1| peptidase M16-like [Candidatus Koribacter versatilis Ellin345]
 gi|94550646|gb|ABF40570.1| peptidase M16-like protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 425

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 125/405 (30%), Positives = 222/405 (54%), Gaps = 4/405 (0%)

Query: 2   NLRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N+R     +G+TV+TE M  I S  + + ++ GSR+E  + +G++HF+EHM+FKGTT R 
Sbjct: 7   NVRKEVLPNGLTVLTEEMDHIRSVSIGIWVKNGSRHEDPQVNGISHFIEHMVFKGTTTRN 66

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+ I  E++ +GG+++A+T  E   ++  +L EHVP+A++++ DM+ N  F+ ++I+RE+
Sbjct: 67  AEAIAREVDSIGGNMDAFTGKEMVCFNVKILDEHVPVAMDVLSDMVLNPVFDGAEIDREK 126

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+ EEI M ED+    +   F++  +KD  +G+PILG  ET+  F  + ++    R + 
Sbjct: 127 GVIQEEIKMDEDNPDYLVHEIFTQNFYKDHPLGKPILGTKETVKGFDRDIVLGNYGRKFA 186

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVA-KIKESMKPAVYVGGEYIQKRDLAEEHMM 239
              + V   G ++H+  V +V   F     +        P  +       K+ L +  + 
Sbjct: 187 PGNLIVAAAGNINHKSFVDEVRRRFEHLKPSLNGFHQEPPKTHARIIMRNKKSLEQVQIC 246

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG    +   +  Y+  IL ++LG GMSSRLFQ++REK+GL YSI +    F D+G L +
Sbjct: 247 LGVPAYSISDKRRYVCYILNTLLGGGMSSRLFQDIREKQGLVYSIFSELNPFQDSGSLAV 306

Query: 300 ASATAKENIMA-LTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T++E+    +T  + E      E +   E+ +  A++   L+   E S  R   +++
Sbjct: 307 YAGTSRESAPKVVTQVVKEFGNFKREMVSVEELQRAKAQLKGSLMLGLESSTARMSNLAR 366

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
           Q M+       ++II  I  +T E++  +A +IF +    + +LG
Sbjct: 367 QEMYYDHFHTMDEIIAKIEVVTREEVCEMANEIFRAEDIAVTVLG 411


>gi|326776209|ref|ZP_08235474.1| processing peptidase [Streptomyces cf. griseus XylebKG-1]
 gi|326656542|gb|EGE41388.1| processing peptidase [Streptomyces cf. griseus XylebKG-1]
          Length = 459

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 130/428 (30%), Positives = 220/428 (51%), Gaps = 12/428 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPTLNGATHYLEHLLFKGTAQRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         +++  A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKVGALSRTDAVPMAPREGSRTLRAAGKVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDERRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +     ++  EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDRVATHGLDDDEITRAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
               I K  +  G  +  + ++  I+ +T +D+  VA ++ +  P+L+++GP  D     
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLARIAEVTPDDVRQVAGELLTRRPSLSVIGPLKDK--QA 451

Query: 412 SELIHALE 419
             L  A+ 
Sbjct: 452 DRLHAAVS 459


>gi|299743845|ref|XP_002910711.1| mitochondrial-processing peptidase subunit beta [Coprinopsis
           cinerea okayama7#130]
 gi|298405844|gb|EFI27217.1| mitochondrial-processing peptidase subunit beta [Coprinopsis
           cinerea okayama7#130]
          Length = 754

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 118/435 (27%), Positives = 199/435 (45%), Gaps = 18/435 (4%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            I+  S+G+TV TE      +A V V I AGSR E  + +G AHFLEHM FKGT KRT  
Sbjct: 319 EITTLSNGLTVATEAQSQSQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTNKRTQH 378

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +  E+E +G  +NAYTS E T Y+A   ++ VP A++II D+L NS      IERER+V
Sbjct: 379 ALELEVENLGAHLNAYTSREQTVYYAKAFRKDVPQAVDIISDILQNSKLESGAIERERDV 438

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    +    + +      + ++ Q +GR ILG  + I S   E + +++  NYT D
Sbjct: 439 ILREQQEVDKQQEEVVFDHLHAVAFQGQPLGRTILGPKKNILSIQREDLSNYIKTNYTPD 498

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY------IQKRDLAEE 236
           RM +V  G VDH   V   E +F+    +     +    +    +      I+  +    
Sbjct: 499 RMVLVGTGGVDHGELVKLAEKHFSSLPASANPTPLGRLSHPKTAFVGSEVRIRDDESHTA 558

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMS--------SRLFQEVREKRGLCYSISAHH 288
           ++ +   G ++ S D++   ++ SI G            S     +     L  S  +  
Sbjct: 559 NIAIAVEGVSWSSPDYFPMMVMQSIFGSWDRGLGASPLTSSRLSHIVSSNNLANSFMSFS 618

Query: 289 ENFSDNGVLYIASATAKENIMAL-TSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
            ++SD G+  I   T     +       ++    +       E+++  +++ A L+ S +
Sbjct: 619 TSYSDTGLWGIYLVTENLMNIDDLVHFTLKEWTRMSIAPTPTEVERAKSQLKAALLLSLD 678

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMD 406
            +   A +I +Q++  G  L  ++    I A+T ++I  VA+K        LA  G  ++
Sbjct: 679 GTTAVAEDIGRQLVTTGRRLTPQETEAAIDAVTVDEIKRVAQKYLWDKDFALAATG-SIE 737

Query: 407 HVPTTSELIHALEGF 421
            +   + +   L   
Sbjct: 738 GLLDYNRIRADLSSM 752


>gi|182435575|ref|YP_001823294.1| putative protease [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|178464091|dbj|BAG18611.1| putative protease [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 459

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 130/428 (30%), Positives = 220/428 (51%), Gaps = 12/428 (2%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R +    G+ ++TE +P + SA   +    GSR+E    +G  H+LEH+LFKGT +RT
Sbjct: 34  TVRRTVLPGGLRIVTETLPSVRSATFGIWANVGSRDETPTLNGATHYLEHLLFKGTAQRT 93

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I   I+ VGG++NA+T+ E+T Y+A VL   +PLA++++ DML+ S   P D++ ER
Sbjct: 94  ALDISSAIDAVGGEMNAFTAKEYTCYYARVLDTDLPLAIDVVCDMLTGSLIAPEDVDAER 153

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M+EDD  D +   F+  +  D  +GRP+LG  +TI++    +I  F  ++Y 
Sbjct: 154 GVILEEIAMTEDDPGDCVHDLFAHTMLGDTPLGRPVLGTVDTINALNRGQIARFYKKHYD 213

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--------KRD 232
              + V   G VDH   V QV   F         +++  A   G   ++         R 
Sbjct: 214 PTHLVVAAAGNVDHATVVRQVRRAFEKAGALSRTDAVPMAPREGSRTLRAAGKVELLNRK 273

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + H++LG  G A      +   +L + LG GMSSRLFQEVREKRGL YS+ ++   F+
Sbjct: 274 TEQAHVVLGMPGLARTDDRRWALGVLNTALGGGMSSRLFQEVREKRGLAYSVYSYTSGFA 333

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G+  + +      +  +     + + +     ++  EI +   ++    +   E +  
Sbjct: 334 DCGLFGVYAGCRPSQVHDVLKICRDELDRVATHGLDDDEITRAIGQLSGSTVLGLEDTGA 393

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTT 411
               I K  +  G  +  + ++  I+ +T +D+  VA ++ +  P+L+++GP  D     
Sbjct: 394 LMNRIGKSELCWGEQMSVDDMLARIAEVTPDDVRQVAGELLTRRPSLSVIGPLKDK--QA 451

Query: 412 SELIHALE 419
             L  A+ 
Sbjct: 452 DRLHAAVS 459


>gi|145224602|ref|YP_001135280.1| peptidase M16 domain-containing protein [Mycobacterium gilvum
           PYR-GCK]
 gi|145217088|gb|ABP46492.1| peptidase M16 domain protein [Mycobacterium gilvum PYR-GCK]
          Length = 424

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 131/407 (32%), Positives = 208/407 (51%), Gaps = 7/407 (1%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R ++   G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RTA 
Sbjct: 2   RRTRLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTAV 61

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I + ++ VGG++NA+TS EHT Y+A VL   + LA++++ D++ N    P D+E ER+V
Sbjct: 62  QIAQAVDAVGGELNAFTSREHTCYYAHVLDSDLELAVDLVADVVLNGRCEPDDVEVERDV 121

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F   ++ D  +GRP++G   +I+  T  ++ SF  R YT D
Sbjct: 122 VLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVVGSVASIAGMTRSQLHSFHVRRYTPD 181

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM V   G ++H+  V  V  +F        S    ++            + KRD  + H
Sbjct: 182 RMVVAVAGNIEHDEVVRLVRRHFGRHLVRGRSPVAPRKGAGRVAGRPTLELVKRDAEQTH 241

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + LG           +  ++L + LG G+SSRLFQ++RE RGL YS+ +  + F+D G L
Sbjct: 242 LSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQQIRETRGLAYSVYSTVDTFADTGAL 301

Query: 298 YIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I +    E    +     +++  +    I   E       +   L+   E S  R   I
Sbjct: 302 SIYAGCQPERFDEVVRVTTDILADVARDGITADECRIAKGSLRGGLVLGLEDSGSRMNRI 361

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +  +  G        +  I  +T +++  VA+++ +     A+LGP
Sbjct: 362 GRSELNFGEHRTIADTLSKIDEVTIDEVNAVARQLLTRPFGAAVLGP 408


>gi|289643637|ref|ZP_06475750.1| peptidase M16 domain protein [Frankia symbiont of Datisca
           glomerata]
 gi|289506528|gb|EFD27514.1| peptidase M16 domain protein [Frankia symbiont of Datisca
           glomerata]
          Length = 437

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 131/412 (31%), Positives = 209/412 (50%), Gaps = 7/412 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R      G+ V+TE +P   S  + + +  GSR+E     G +H+LEH+LFKGT  R A
Sbjct: 18  VRRVVLPGGLRVLTEKVPGVRSVAIGIWVGVGSRDESPLTAGCSHYLEHLLFKGTPSRDA 77

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I   IE VGG++NA+T+ E+T Y+  VL   +  A+E++ DM+S+S     D+E ER 
Sbjct: 78  LTISAAIEAVGGELNAFTTKEYTCYYVRVLDNDLTDAVEVLSDMVSHSLIAADDVEAERG 137

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   FS  +  D  +GRP+LG  E+I +   + I  +    Y  
Sbjct: 138 VILEEIAMHDDDPSDVVHDVFSAALLGDTELGRPVLGTTESIENLERDTIAEYYRSRYAL 197

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-----MKPAVYVGGEYIQKRDLAEE 236
             M V   G +DHE  ++ V S F          +             G  + +R   + 
Sbjct: 198 SDMVVAIAGNIDHERTLALVASAFADRLGGPGAPAAARGGSYAYPDAAGVVVTRRPTEQA 257

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H++LG  G + Q    +   I++S LG GMSSRLFQEVREKRGL YS+ +   +F+D G+
Sbjct: 258 HVVLGTVGMSRQDDRRFALGIMSSALGGGMSSRLFQEVREKRGLAYSVYSFASHFADAGL 317

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +  A      + +   E ++ +    I   E+ +   +    L+   E +  R   
Sbjct: 318 FGVYAGCAPRRADDVLALCREQLELVATVGITDEELARAKGQSRGSLVLGLEDTGSRMSR 377

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           I K  +  G +L  ++I+  + A+T +D+  VA ++ +    L ++GP  DH
Sbjct: 378 IGKSELVHGELLSVDEILARVDAVTGDDVRAVAAELLTRPLALGVIGPFDDH 429


>gi|296171646|ref|ZP_06852860.1| hypothetical protein HMPREF0591_6301 [Mycobacterium
           parascrofulaceum ATCC BAA-614]
 gi|295894007|gb|EFG73770.1| hypothetical protein HMPREF0591_6301 [Mycobacterium
           parascrofulaceum ATCC BAA-614]
          Length = 451

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 140/424 (33%), Positives = 218/424 (51%), Gaps = 7/424 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A
Sbjct: 28  LRRSTLPGGLRVVTEYLPSVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 88  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDSDLALAVDLVADVVLNGRCAADDVELERD 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  +++SS T  ++ SF  R YT 
Sbjct: 148 VVLEEIAMRDDDPEDALGDMFLGAMFGDHPVGRPVIGTAQSVSSMTRAQLHSFHVRRYTP 207

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
           +RM V   G VDH+  V+ V ++F             ++         G  +  RD  + 
Sbjct: 208 ERMVVAVAGNVDHDEVVALVRAHFGPHLVRGRRPIAPRKGAGRVTGRPGLMLGNRDAEQT 267

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG        R  +  ++L S LG G+SSRLFQEVRE RGL YS+ +  + F+D+G 
Sbjct: 268 HVSLGVRTPGRSWRHRWALSVLHSALGGGLSSRLFQEVRELRGLAYSVYSTVDIFADSGA 327

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L + +A   E    +     EV++S+    I + E       +   L+   E S  R   
Sbjct: 328 LSVYAACQPERFAEVMKVTNEVLESVARDGITEAECRIAKGSLRGGLVLGLEDSSSRMSR 387

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELI 415
           + +  +  G     E  +  I  +T E++  VA+++       A+LGP         +L 
Sbjct: 388 LGRNELNYGEHRSIEHTLRKIDEVTVEEVNAVARRLLGQPYGAAVLGPYASKRSLPQQLR 447

Query: 416 HALE 419
             + 
Sbjct: 448 AMVN 451


>gi|23099061|ref|NP_692527.1| processing proteinase [Oceanobacillus iheyensis HTE831]
 gi|22777289|dbj|BAC13562.1| processing proteinase [Oceanobacillus iheyensis HTE831]
          Length = 406

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 128/405 (31%), Positives = 214/405 (52%), Gaps = 3/405 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +     ++G+ ++ E +P + S  + + +  GSRNE Q+ +G++HFLEHM FKGT KR+A
Sbjct: 2   IERHTCNNGLRIVHEQIPAVRSVTIGIWVLTGSRNESQQNNGISHFLEHMFFKGTDKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE + +GG INA+TS E+T ++A VL  H   ALEI+ DM  NS+F+P ++ERE+ 
Sbjct: 62  QDIAEEFDSIGGQINAFTSKEYTCFYAKVLDTHKEYALEILADMFFNSTFDPEEMEREKK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +    ++  +    +G  ILG  E + SF   ++  ++   Y+ 
Sbjct: 122 VVLEEIKMYEDTPDDIVHDLLAKASYGTHPLGYSILGTEEQLLSFDSAQLNDYIEHAYSP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G VD    +  +ES F           +    ++     + +D  + H+ LG
Sbjct: 182 DRVVISVAGNVD-SSFMKTIESSFGSYKGKSNSVEIIKPTFLAESIDRHKDTEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G        Y   I+ ++LG  MSSRLFQ+VREK+GL Y++ ++H  F D+G+L I  
Sbjct: 241 YQGLEQGHPLLYSLTIMNNVLGGSMSSRLFQDVREKQGLAYAVFSYHSTFIDSGLLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T KE +  L  +I   V + +   +  +E+     ++   L+ S E +  R     +  
Sbjct: 301 GTGKEQLSVLEDTIQLTVDTLIQNGLTDKELRNSKEQLKGGLMLSLESTNSRMSRNGRNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPM 405
           +        +++I  I A++ E I  V  ++F      A++ P  
Sbjct: 361 LLLKRHRTLDEMIQEIDAVSHETIQQVINEVFKEKAARALIAPKA 405


>gi|224093029|ref|XP_002188307.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 524

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 98/432 (22%), Positives = 186/432 (43%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R+S   +G+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 93  RVSALGNGLQVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 152

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 153 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 212

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S     ++ +++ +Y   R
Sbjct: 213 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSINRNDLVEYITTHYKGPR 272

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML--- 240
           M +   G V H+  +   + +F     A                  +    +  +     
Sbjct: 273 MVLAAAGGVSHDELLDLAKCHFGNLPSAPEGGLPPLPPCSFTGSEIRIRDDKMPLAHLAI 332

Query: 241 -----GFNGCAYQSRDFYLTNILASILGDGMSSRLFQ----EVREKRGLCYSISAHHENF 291
                G+            T I       G   +       ++     LC+S  + +  +
Sbjct: 333 AVEAAGWADPDTIPLMVANTLIGNWDRSFGGGVQNLSSKLAQIACHGNLCHSFQSFNTCY 392

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           +D G+  +        I  +   +      L  ++ + E+ +    +   ++   + S  
Sbjct: 393 TDTGLWGLYMVCEPSTIQDMVHFVQREWIRLCTSVTENEVARAKNLLKTNMLLQLDGSTP 452

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I AI  + I  +  K   +  P +A +GP ++ +P 
Sbjct: 453 ICEDIGRQMLCYKRRIPIPELEARIEAIDAQTIREICTKYIYNKHPAVAAVGP-IEQLPE 511

Query: 411 TSELIHALEGFR 422
            S++   +   R
Sbjct: 512 YSKICSGMYWLR 523


>gi|163941542|ref|YP_001646426.1| peptidase M16 domain-containing protein [Bacillus
           weihenstephanensis KBAB4]
 gi|163863739|gb|ABY44798.1| peptidase M16 domain protein [Bacillus weihenstephanensis KBAB4]
          Length = 413

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 128/414 (30%), Positives = 233/414 (56%), Gaps = 4/414 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E +P + S  + + I AGSRNE ++ +G++HFLEHM FKGT  R+A
Sbjct: 2   IKKYTCKNGVRIVMENIPTVRSVAIGIWIHAGSRNENEKNNGVSHFLEHMFFKGTETRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL EH   AL+++ DM  NS+F+  ++++E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDEHAKYALDVLADMFFNSTFDEEELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    ++  ++   +G PILG  ET+ +FT + +  ++  +YT 
Sbjct: 122 VVCEEIKMYEDAPDDIVHDMLTKATYETHPLGYPILGTEETLETFTGDTLRQYMKDHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + V   G +D E  +  VE YF        +E +   ++   +  +K++  + H+ LG
Sbjct: 182 ENVVVSIAGNID-EAFLQTVEQYFGSYEGTTNREQVHSPIFHFNKVARKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G      D Y   +L ++LG  MSSRLFQEVRE+RGL YS+ ++H ++ D G+L +  
Sbjct: 241 YKGLQMGHEDIYNLIVLNNVLGGSMSSRLFQEVREQRGLAYSVFSYHSSYEDTGMLTLYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  ++ E + +L    I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGSKQLDTLYETMQETLNTLKNTGITEKELVNSKEQLKGNLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
           +        ++II++++ +T +++  + + +F+   + A++ P    +P   +L
Sbjct: 361 LLLRKHRSLDEIIESVNTVTKQNVDELIRNMFTDEFSAALISPD-GKLPKGMKL 413


>gi|326513540|dbj|BAJ87789.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 530

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/424 (26%), Positives = 199/424 (46%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +++   +G+ V TE      +A V V I AGSR E +E  G+AHF+EHMLFKGT  R+A 
Sbjct: 97  KVTTLDNGLRVATESSLSSRTATVGVWIDAGSRYETEEAAGVAHFVEHMLFKGTGTRSAA 156

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ +EIE +GG +NAYTS E T+Y+A VL +  P A+ ++ D+L +S      IERER V
Sbjct: 157 QLEQEIEDMGGHLNAYTSREQTTYYAKVLDKDAPRAMNVLADILQHSKLQDDRIERERGV 216

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   +  S + +        ++   +GRPILG  + + S T + ++ ++  +YTA 
Sbjct: 217 ILREMEEVQGQSEEVIFDHLHATAFQYTSLGRPILGSADNVKSITKKDLVDYIQNHYTAS 276

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEH 237
           RM +   GAV H+  V Q +  F          +M  A            I   D+    
Sbjct: 277 RMVITAAGAVKHDDIVQQAKELFKTLPTDPTTTNMLVAKQPAIFTGSEVRIIDDDMPLAQ 336

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHE 289
             + FNG ++   D     ++ ++LG                 +      +  SI A + 
Sbjct: 337 FAVAFNGASWTDPDSIALMVMQTMLGSWNKSAGGGKHMGSELVQRVAINDIAESIMAFNT 396

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I++ +  L   + + ++ +   ++ + +    + S
Sbjct: 397 NYKDTGLFGVYAVAKPDCLDDLAFAIMQEMSKLSYRVTEEDVIRARNQLKSSIQLHLDGS 456

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q +  G  +   ++   I A+    I  VA + IF     +A +GP +  +
Sbjct: 457 TAVVEDIGRQQLIYGRRIPIPELFARIDAVDPSTIRRVANRFIFDQDIAIAAMGP-IKTL 515

Query: 409 PTTS 412
           P  +
Sbjct: 516 PDYN 519


>gi|84999684|ref|XP_954563.1| mitochondrial processing peptidase [Theileria annulata]
 gi|65305561|emb|CAI73886.1| mitochondrial processing peptidase, putative [Theileria annulata]
          Length = 517

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 116/445 (26%), Positives = 203/445 (45%), Gaps = 27/445 (6%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +S   +G+ V T  MP  S+ V V I +GSR E  E +G AHFLEHM+FKGT  R+ ++
Sbjct: 73  HVSTLKNGLRVATVWMPGSSSTVGVWIDSGSRFETPETNGSAHFLEHMIFKGTKSRSRQQ 132

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + E+IE  G  +NAYTS E T+Y+A      +P   E++ D+L NS  +P  +E E++V+
Sbjct: 133 LEEQIEHKGAHLNAYTSREQTAYYARCFNNDIPWCTELLSDILQNSQIDPDHMENEKHVI 192

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E    + +  R     ++D  +G  ILG  E I +   E ++ +++ NYTADR
Sbjct: 193 LREMEEVEKSHDEVIFDRLHMTAFRDCSLGFTILGPVENIKNMQREYLLDYINHNYTADR 252

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD--LAEEHMMLG 241
           M +  VG  DH+  V+  E +F+       K  ++   +VG E + + D      HM + 
Sbjct: 253 MVLCAVGNFDHDKFVTLAEKHFSTIPKPVTKVELEKPYFVGSELLNRNDEMGPYAHMAVA 312

Query: 242 FNGCAYQSRDFYLTNILASI--------------LGDGMSSRLFQEVREKRGLCYSISAH 287
           F G  + S D     ++ SI                 G  +      R   G     SA 
Sbjct: 313 FEGVPWNSPDSVAFMLMQSIIGTYNKSNEGVVPGKVSGNKTIHAVANRMTVGCAEFFSAF 372

Query: 288 HENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
           +  + D G+    +   +  +      ++  + SL  ++   E+++   ++  + +   E
Sbjct: 373 NTFYKDTGLFGFYAKCDEVAVDHCVGELLFGITSLSYSVTDEEVERAKRQLMLQFLSMTE 432

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP----------T 397
            +   A E+++QV+  G  +   + +  +  I  E++  VA K    +            
Sbjct: 433 STSSVAEEVARQVLVYGRRMPVAEFLLRLEKIDAEEVKRVAWKYLHDSHYNLYKFTIEIA 492

Query: 398 LAILGPPMDHVPTTSELIHALEGFR 422
           +  +GP +  +P+  +L       R
Sbjct: 493 VTAMGP-LHGMPSLIDLRQKTYWLR 516


>gi|323489597|ref|ZP_08094824.1| zinc protease [Planococcus donghaensis MPA1U2]
 gi|323396728|gb|EGA89547.1| zinc protease [Planococcus donghaensis MPA1U2]
          Length = 408

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 133/408 (32%), Positives = 228/408 (55%), Gaps = 4/408 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +      +G+ +++E +P   S  + V +  GSR+E  EE+G+ HF+EHMLFKGT  RTA
Sbjct: 2   VTTQTCKNGLRIVSEHIPHFHSVAMGVFVNNGSRDELPEENGITHFIEHMLFKGTESRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KEI  E +++GGDINAYTS E+T Y+A VL  H   A+ ++ DM  +S  +P + ++ER 
Sbjct: 62  KEIAREFDRIGGDINAYTSKEYTCYYAKVLDHHAEHAVTVLADMFFHSQMDPEEFDKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M+ED   D +  +   +++ +  IG PILG  ET+++FTPEKI  +++R+YT 
Sbjct: 122 VILEEISMTEDMPDDDVHEQLWRVMYPENSIGAPILGTAETLAAFTPEKIRDYINRHYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
               V   G +     + ++E+ F      +  +  +   +  G  ++ ++  + H+ LG
Sbjct: 182 ANTVVSVAGNITP-ALLEKIEALFGNFEKEENPKKYELPNFTSGYSLKNKETEQGHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G +    D Y   +L +I+G  MSSRLFQE+RE+RGL YSI ++H  +SD+G L I  
Sbjct: 241 YPGLSLNDPDIYNITVLNNIIGGSMSSRLFQEIREQRGLAYSIFSYHSAYSDHGTLAIYG 300

Query: 302 ATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T+ E +  +   I+ +++ L    I ++EI     ++   L+   E +  R     +  
Sbjct: 301 GTSDEQMAEMQQVILSLLKELKNGGITEQEITDSKEQLKGSLMLGLESTSARMSRNGRHE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHV 408
           +  G     E+++  I  ++ E ++ +  +I   TP ++I+ P    +
Sbjct: 361 LLLGKHQSYEEVLTQIDQVSLEKVMELL-EILVETPAISIIRPKEASL 407


>gi|269127529|ref|YP_003300899.1| processing peptidase [Thermomonospora curvata DSM 43183]
 gi|268312487|gb|ACY98861.1| processing peptidase [Thermomonospora curvata DSM 43183]
          Length = 441

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 131/411 (31%), Positives = 219/411 (53%), Gaps = 7/411 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ +ITE MP + SA   +    GSR+E   + G +H+LEH LFKGT +R+A
Sbjct: 26  VRRTVLPGGLRIITETMPTVRSAAFGIWAGVGSRDEEARDAGASHYLEHTLFKGTRRRSA 85

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI   ++ VGGD+NA+T+ E+T Y+A VL   +PLA++++ DM+ +S   P D+E ER 
Sbjct: 86  LEISAALDAVGGDLNAFTAKEYTCYYARVLDSDLPLAVDVVSDMVIDSLNRPEDVEAERG 145

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M +DD  D +   F+  ++ D  +GRPILG  ETI++ + + I  +   +Y  
Sbjct: 146 VILEEIAMRDDDPGDLVHDEFATALYGDLPLGRPILGTVETINALSRDVIDRYYREHYLV 205

Query: 182 DRMYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
             + V   G +DH+  V QV   F          A  +    P     G  +  +D  + 
Sbjct: 206 PNLVVAAAGNLDHDQLVRQVAEAFAGRLGGDEQPAPPRIGGPPVAGRPGVRVIDKDTEQA 265

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           +++LG  G        Y   +L ++LG GMSSRLFQEVREKRGL YS+ ++   ++D G+
Sbjct: 266 NVVLGGIGVCRTDERRYALGVLNAVLGGGMSSRLFQEVREKRGLAYSVYSYTSQYADTGM 325

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +      +  + +   + V  L +   +  E+++   ++   ++   E +  R   
Sbjct: 326 FCVYAGCQPGKVDEVLAICRDEVAKLADGGLDTEELERGKGQLRGAMVLGLEDTGSRMSR 385

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           + K  +    +   E+ +  I A+T +D+  VA+++     TLA++GP  D
Sbjct: 386 LGKSELVYERLQPVEESLACIEAVTVDDVREVARQVLGRLDTLAVVGPFGD 436


>gi|29839508|sp|Q00302|MPPB_BLAEM RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=BeMPP1; AltName: Full=Beta-MPP; Flags:
           Precursor
 gi|1145777|gb|AAC63093.1| mitochondrial processing peptidase beta subunit 1 [Blastocladiella
           emersonii]
          Length = 465

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 111/427 (25%), Positives = 194/427 (45%), Gaps = 12/427 (2%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           ++++  +G+TV TE  P + +A V V I +GSR E +  +G+AHFLEH+ FKGT +RT  
Sbjct: 36  QVTRLPNGLTVATESNPALATATVGVWIDSGSRAETKANNGVAHFLEHISFKGTKQRTQS 95

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +  EIE +GG +NAYTS E T Y+A +  + V   + I+GD+L NS+ +P  I+RER V
Sbjct: 96  GLEIEIENMGGHLNAYTSREQTVYYAKLFSQDVAKGVNILGDILQNSTLDPGAIDRERAV 155

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    +    + +        + +  +G  ILG  E I + +   + +++  NYTAD
Sbjct: 156 ILREAEEVDKQVEEVVFDHLHAAAFPENALGYTILGPKENIQTLSQADLQAYIKNNYTAD 215

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM VV  G VDH       E+ F        K       + G +   + D      +   
Sbjct: 216 RMVVVGAGNVDHAELCKLAETNFGKLPQGSGKAKFVRPAFTGSDVRIRVDDMPTAHIALA 275

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVRE--------KRGLCYSISAHHENFSDN 294
              A  +   +   ++AS +                      K  L  S ++ +  +SD 
Sbjct: 276 VEGASWTSADHWPLLVASAMIGSYDRAAGNAHPSSKLAQIVAKHNLANSFTSFNTTYSDT 335

Query: 295 GVLYIASATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRA 353
           G+  I   +   + +   +         L     + E+     ++   L+ + + +   A
Sbjct: 336 GLWGIYIQSNNRDNLDDLAHFTVREWMRLATAPSEGEVAIAKQQLKTSLLLALDGTTPVA 395

Query: 354 LEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHVPTTS 412
            EI +Q++  G  L   +I   + A+T ED+  VA + I+     +  +GP ++ +P  +
Sbjct: 396 EEIGRQMLAYGRRLSPFEIDRLVDAVTVEDVKRVANEFIYDRDLAIVAVGP-VECLPDYN 454

Query: 413 ELIHALE 419
            +  A+ 
Sbjct: 455 RIRSAMN 461


>gi|154497058|ref|ZP_02035754.1| hypothetical protein BACCAP_01351 [Bacteroides capillosus ATCC
           29799]
 gi|150273457|gb|EDN00585.1| hypothetical protein BACCAP_01351 [Bacteroides capillosus ATCC
           29799]
          Length = 416

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 143/422 (33%), Positives = 235/422 (55%), Gaps = 9/422 (2%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M+       +G+ ++TE +P + SA + + +  GSR E+  E+G AHF+EHMLFKGT +R
Sbjct: 1   MSYEKITLPNGVRILTEHVPAVRSAALGIYVGTGSRQEKAAENGAAHFIEHMLFKGTARR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA ++  E++ VGG INAYT+ E T ++A VL  H+P A +I+ DM  +S F+ +D+E E
Sbjct: 61  TAADLAGEMDAVGGQINAYTTKESTCFYARVLDTHLPQATDILCDMFFSSKFDENDVETE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R VVLEEIGM ED+  D    R +  V+    + RPILG+  T+   T   +  +++ +Y
Sbjct: 121 RGVVLEEIGMYEDNPEDLCAERLAAGVYHGSALARPILGRKATLEKMTGAWLKEYMTSHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  + V   G+   +  V  +++ F+      + +  K AVY     ++K+ + + H+ 
Sbjct: 181 LASDIVVSLAGSFG-QKDVDDLKARFSAMPAGGLGKP-KAAVYTPCITVKKKAIEQNHLT 238

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L F G  Y     +   +L+SILG GMSSRL+Q+VRE+RGLCYSI ++    +D G+  +
Sbjct: 239 LAFPGLPYHDSRRFALQLLSSILGSGMSSRLWQQVREQRGLCYSIYSYGSGHADTGLYAV 298

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +A  +E   A   +IV+ V+   +  + Q E+D+   +  A ++   E +  R   + +
Sbjct: 299 YTALGRETEEAAIRTIVDAVKEFRDGGVTQEELDRAREQSKANVLMGLESTQARMSHLGR 358

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHA 417
             +  G +L  ++II    A+T ED+  +A++IF  S  +L+ +G     V T  E    
Sbjct: 359 SELMMGEVLVPDRIIAAYDAVTAEDVRALAEEIFDFSRASLSAVG----RVRTADEYREL 414

Query: 418 LE 419
           L 
Sbjct: 415 LN 416


>gi|296330886|ref|ZP_06873361.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674404|ref|YP_003866076.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296151891|gb|EFG92765.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412648|gb|ADM37767.1| specific processing protease [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 409

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 128/410 (31%), Positives = 231/410 (56%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ R+A
Sbjct: 2   IKRYTCQNGVRVVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+ +++++E+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  ET++SF  + +  ++   YT 
Sbjct: 122 VVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G +  +  +  VE +F           ++   +   +  +K++  + H+ LG
Sbjct: 182 DRVVISVAGNIS-DSFIKDVEKWFGSYEAKGKATGLEKPEFYTEKLTRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G        Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I  
Sbjct: 241 FKGLQVGHERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L+ +I E + +   + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGANQLQQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +  G     ++II+ ++A+  E + G+A+++F+    LA++  P  ++P+
Sbjct: 361 LLLGKHKTLDEIINELNAVNLERVNGLARQLFTDDYALALI-SPSGNMPS 409


>gi|157964285|ref|YP_001499109.1| protease [Rickettsia massiliae MTU5]
 gi|157844061|gb|ABV84562.1| Mitochondrial protease-like protein [Rickettsia massiliae MTU5]
          Length = 437

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 145/405 (35%), Positives = 239/405 (59%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  M  ++S  + +  + G+R E  EE G++HFLEHM FKGT  RT
Sbjct: 29  NFNVSKLKNGLTILTYNMSYVNSVAINLIAKVGARYENAEEEGISHFLEHMAFKGTKTRT 88

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 89  AKQIAEEFDSIGGHFNAYTGHENTVYYARVLSENCDKALNILADIIQNSIFADEEIAKEY 148

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+++EI   +D+  D +  +F   V+++Q +G+ ILG  +T+++FT E   +F+ ++Y 
Sbjct: 149 QVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSILGTAKTLATFTKEHFFNFIDKHYN 208

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G +DH+  V   E  F+      +K S  PA Y+GG     ++L +  ++L
Sbjct: 209 AENLYLSIAGNIDHDKIVIIAEQLFSALKQG-VKSSFIPAKYIGGNGFINKELEQTSLVL 267

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G +Y      Y T++L+ I G GMSSRLFQ +REK GL Y++ +++  + D+GV  I
Sbjct: 268 GFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFII 327

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   I   +  + E +   EI +   ++ + +  +QE++  ++ EI K 
Sbjct: 328 YASTAHDKLELLYREIKNAIIKMTEQVSTEEILRAKTQLRSNVQMAQEKNTYKSEEIGKN 387

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I +I  +DI+  A KIFS T T AI+GP 
Sbjct: 388 YSVFGKYISPEEIMEIIMSIKADDIINTANKIFSGTTTSAIIGPN 432


>gi|312139342|ref|YP_004006678.1| metallopeptidase [Rhodococcus equi 103S]
 gi|325672778|ref|ZP_08152474.1| M16 family peptidase [Rhodococcus equi ATCC 33707]
 gi|311888681|emb|CBH47993.1| putative metallopeptidase [Rhodococcus equi 103S]
 gi|325556655|gb|EGD26321.1| M16 family peptidase [Rhodococcus equi ATCC 33707]
          Length = 446

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 129/408 (31%), Positives = 211/408 (51%), Gaps = 7/408 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +    G+ V+TE +P   SA V V +  GSR+E+    G AHFLEH+LFK T  RTA
Sbjct: 23  VQRTVLPGGLRVVTEHVPGVRSASVGVWVGVGSRDEQPSVAGAAHFLEHLLFKSTPTRTA 82

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT ++A VL + +PLA++++ D++        D++ ER 
Sbjct: 83  LDIAQVMDGVGGELNAFTSKEHTCFYAHVLDDDLPLAVDLVSDVVLRGRCRAVDVDVERQ 142

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  ++I S T  ++ SF  R YT 
Sbjct: 143 VVLEEISMRDDDPEDLLGDAFLTALFGDHPVGRPVIGSVDSIESMTRSQLHSFHVRRYTP 202

Query: 182 DRMYVVCVGAVDHEFCVSQVE-----SYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
           +RM V   G V+HE  V  V              A  +             + KRD  + 
Sbjct: 203 ERMVVAVAGNVEHEHTVELVRAAFSGHLDRDVDPAPRRGGAIRLRTAPTLSLTKRDSEQA 262

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + +G G+SSRLFQE+RE+RGL YS+ +  + F+D G 
Sbjct: 263 HLALGVRAFGRHEGHRWPLSVLNAAVGGGLSSRLFQEIREERGLAYSVYSGVDTFADTGA 322

Query: 297 LYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +    EN+  + + I EV+ ++  + I   E  +    +   L+   E S  R   
Sbjct: 323 FSVYAGCQPENLGEVATLIREVLANVASDGITDAECARAKGSLRGSLVLGLEDSGSRMTR 382

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           I +  +  G+     + +  I  +T +++  VA+ +       A++GP
Sbjct: 383 IGRSELNYGNHQSVSETLARIDEVTTDEVREVARVLLRRPFAAAVVGP 430


>gi|209883844|ref|YP_002287701.1| peptidase M16 domain protein [Oligotropha carboxidovorans OM5]
 gi|209872040|gb|ACI91836.1| peptidase M16 domain protein [Oligotropha carboxidovorans OM5]
          Length = 429

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 148/383 (38%), Positives = 229/383 (59%), Gaps = 1/383 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + I+K  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGT  R
Sbjct: 1   MAVEITKLPSGLTVVTDAMPHLETAALGVWTGVGGRDEKLDEHGISHLLEHMAFKGTASR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           TA+EIVE+IE VGGD+NA TS E T+Y+A VLK  VPLA++++ D+L + SF+  ++ERE
Sbjct: 61  TAREIVEQIEAVGGDLNAATSSESTAYYARVLKADVPLAIDVLSDILVSPSFDTEELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG + D   D +     E+ + DQ +GR +LG P T+++FT +K+  +++ +Y
Sbjct: 121 KSVIVQEIGAAMDTPDDAVFEYVGELAYPDQPMGRSLLGTPATLATFTRDKLRGYLTTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GAVDH   V+ VE  F   S     + +      GG  + +RDL + H+ 
Sbjct: 181 RGPDMVVAASGAVDHARIVADVEQRFAGFSADAGPKPVPAQFGKGGSRVVRRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  S+LG GMSSRLFQEVREKRGLCYSI   H+ +SD G   +
Sbjct: 241 LALEGVPQSDPSLFSLQVFTSVLGGGMSSRLFQEVREKRGLCYSIYTFHQPYSDTGFFSL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+ +   +E +   EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPSDAPEMMEVIVDEMNEAVETLTPEEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCE 382
           V+  G  L  E++I  I  +T E
Sbjct: 361 VLSYGRPLSIEEMIARIDNVTVE 383


>gi|257452881|ref|ZP_05618180.1| Zinc protease [Fusobacterium sp. 3_1_5R]
 gi|317059423|ref|ZP_07923908.1| zinc protease [Fusobacterium sp. 3_1_5R]
 gi|313685099|gb|EFS21934.1| zinc protease [Fusobacterium sp. 3_1_5R]
          Length = 416

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 121/409 (29%), Positives = 208/409 (50%), Gaps = 4/409 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +++   S+GITV+ E +P + S  +   +R G+RNER+EE G++HF+EHM+FKGT  RT
Sbjct: 4   QVQVKTLSNGITVLIEKVPELQSFSLGFFVRTGARNEREEESGISHFIEHMMFKGTETRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK++ E I+  GG INAYTS E T Y+  +L   + +A++++ DM+ +S+F   +IE+ER
Sbjct: 64  AKDLSEVIDNEGGIINAYTSRETTVYYVQLLSNKLEIAIDVLSDMMLHSTFTEENIEKER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   D      +       I    I G PE +   T +  ++++   Y 
Sbjct: 124 NVIIEEIKMYEDSPED-TVHDENISFALRGIQSNSISGTPEGLKKITRDHFMNYLKDQYV 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI-QKRDLAEEHMM 239
           A  + +   G  D    ++Q+E   +    +  K        +        RD  + H+ 
Sbjct: 183 ASNLLIAISGNFDETVLMTQLEEKMSSFPKSDKKREYDNRYEIYAGTQVITRDTQQVHIC 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G        Y  +ILA+ LG GMS+RLFQ +RE++GL YS+ ++   + D G+   
Sbjct: 243 FNTRGIDVHHPKKYAASILANALGGGMSARLFQRIREEKGLAYSVYSYQSVYEDCGIFTT 302

Query: 300 ASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T KE    + + I E  + +  E I ++E+ +   +  + L+   E S  R   ++ 
Sbjct: 303 YAGTTKEAYQEVVNMIQEEYKKVREEGITEQELQRCKNQFTSALMFHLESSKGRMSSMAS 362

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
             +  G +   E+I+  I+ ++ EDI  +A+ +F        +   +  
Sbjct: 363 SYINNGKVEAREEIMKRINEVSLEDIKEMAQYLFDEKYYSCTVLGNIKK 411


>gi|168027135|ref|XP_001766086.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682729|gb|EDQ69145.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 496

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 115/415 (27%), Positives = 207/415 (49%), Gaps = 15/415 (3%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++  ++G+ V +E  M  ++A V V I AGSR E  E +G AHFLEHM FKGT  R+ +
Sbjct: 63  RVTTLANGMRVASETNMAAETATVGVWIDAGSRFESAETNGTAHFLEHMFFKGTENRSIR 122

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ EEIE +GG +NAYTS E T+Y+A VLK++V  A+EI+ D+L NS+F+   I RER+V
Sbjct: 123 QLEEEIENMGGHLNAYTSREQTTYYAKVLKKNVNNAVEILSDILQNSTFDEGRINRERDV 182

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E    + +        ++   +GR ILG  + I S +   +  +++++YT  
Sbjct: 183 ILREMEEVEGQVQEVIFDHLHATAFQYTPLGRTILGSEKNIRSISKANLKEYINKHYTGP 242

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCS-----VAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM     GAV+H+  V +V   F   S      A++ E            I+  D+   H
Sbjct: 243 RMVFAAAGAVNHDELVKEVGKRFQKLSTDPTTAAELVEKEPAIFTGSEVRIRDDDMPLAH 302

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             +   G A+   D     ++ ++LG    +    +             GL  ++ A + 
Sbjct: 303 FAVALKGAAWTDPDSIALMVMQAMLGGWDKNAGAGKHMGSELAQKVGANGLAENVQAFNT 362

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N++D G+  + +    + +  L   I+  +  L+  ++  ++ +   ++ + L+   + +
Sbjct: 363 NYNDAGLFGVYATAKPDTLDDLCYVIMHEIGRLIYRVDSDDVARARNQLKSSLLLHLDGT 422

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGP 403
              A +I +Q++  G  L   ++   I A+  + +  VA + I+     +A +GP
Sbjct: 423 SPIAEDIGRQMLTYGRRLPLAELFARIDAVDADTVKRVASRFIYDKELAIAAMGP 477


>gi|332982254|ref|YP_004463695.1| peptidase M16 domain-containing protein [Mahella australiensis 50-1
           BON]
 gi|332699932|gb|AEE96873.1| peptidase M16 domain protein [Mahella australiensis 50-1 BON]
          Length = 413

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 109/401 (27%), Positives = 205/401 (51%), Gaps = 3/401 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G+ V++E +P   S  + + I +GS NE  E +G++HF+EHM+FKGT + +A
Sbjct: 2   YQRKLLPNGLRVVSERLPFFKSVSIGLWIGSGSINETLENNGVSHFIEHMIFKGTNRHSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K I + I+ VGG IN +T+ E T ++  V+ EH+ +AL+++ DM+ N   +  DI++E+ 
Sbjct: 62  KNIADIIDGVGGQINGFTAKECTCFYVKVMDEHIDVALDLLSDMVLNPKLSEDDIQKEKA 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+ EEI M+ED   D +    ++  +++  +G PILG    + +     I+ + S  Y  
Sbjct: 122 VIAEEIHMAEDSPEDLVQELMAKAFFREHPLGMPILGNQYNVMNMDKRSIMEYYSEWYNP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
               +   G+ D +  V  +  YF+   + +K K      V       +++ + + H  +
Sbjct: 182 SNAVLAVAGSYDEDELVRCINKYFSKWNNNSKSKPIFPSHVVKPTVLKKEKPIEQIHCCI 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
              G      D Y    L +I+G GMSSRLFQ++RE+RG+ YS+ ++   + + G+  + 
Sbjct: 242 SVEGLKQDDPDMYALLALNNIIGGGMSSRLFQKIREERGMAYSVFSYPSFYPNIGMFSVY 301

Query: 301 SATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +A     I  +   I E ++++  + I   E  +   ++    +   E +  R   + + 
Sbjct: 302 AAINPSQINEVIYLIKEEIRNISKDGISHEEYKRAKEQLKGNYVLGLESTSNRMSALGRA 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAI 400
            +  G I   ++I+  I  +T E +  VA ++F++  T A 
Sbjct: 362 ELVMGRIFTPDEILQKIEDVTEEQMNVVASRLFNTDITCAA 402


>gi|315444933|ref|YP_004077812.1| Zn-dependent peptidase [Mycobacterium sp. Spyr1]
 gi|315263236|gb|ADT99977.1| predicted Zn-dependent peptidase [Mycobacterium sp. Spyr1]
          Length = 449

 Score =  197 bits (501), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 130/407 (31%), Positives = 208/407 (51%), Gaps = 7/407 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++   G+ V+TE +P + SA V V +  GSR+E +   G AHFLEH+LFK T  RTA
Sbjct: 26  VRRTRLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHLLFKATPTRTA 85

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT Y+A VL   + LA++++ D++ N    P D+E ER+
Sbjct: 86  VQIAQAVDAVGGELNAFTSREHTCYYAHVLDSDLELAVDLVADVVLNGRCEPDDVEVERD 145

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +I+  T  ++ SF  R YT 
Sbjct: 146 VVLEEIAMRDDDPEDTLGDVFLSAMFGDHPVGRPVVGSVASIAGMTRSQLHSFHVRRYTP 205

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
           DRM V   G ++H+  V  V  +F        S    ++            + KRD  + 
Sbjct: 206 DRMVVAVAGNIEHDEVVRLVRRHFGRHLVRGRSPVAPRKGAGRVAGRPTLELVKRDAEQT 265

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + LG G+SSRLFQ++RE RGL YS+ +  + F+D G 
Sbjct: 266 HLSLGVRTPGRHWEHRWALSVLNTALGGGLSSRLFQQIRETRGLAYSVYSTVDTFADTGA 325

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L I +    E    +     +++  +    I   E       +   L+   E S  R   
Sbjct: 326 LSIYAGCQPERFDEVVRVTTDILADVARDGITADECRIAKGSLRGGLVLGLEDSGSRMNR 385

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG 402
           I +  +  G        +  I  +T +++  VA+++ +     A+LG
Sbjct: 386 IGRSELNFGEHRTIADTLSKIDEVTIDEVNAVARQLLTRPFGAAVLG 432


>gi|67458730|ref|YP_246354.1| Zn-dependent peptidase [Rickettsia felis URRWXCal2]
 gi|75536810|sp|Q4UML9|Y338_RICFE RecName: Full=Uncharacterized zinc protease RF_0338
 gi|67004263|gb|AAY61189.1| Mpp [Rickettsia felis URRWXCal2]
          Length = 412

 Score =  197 bits (501), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 162/405 (40%), Positives = 244/405 (60%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  ISK  +G+TV+T  MP +DS  + +  + GSR E  EE G++HFLEHM FKGTT RT
Sbjct: 4   NFNISKLKNGLTVLTYNMPYVDSVAINLITKVGSRYENSEEEGISHFLEHMAFKGTTTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK+I EE +++GG  NAYT  E T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AKQIAEEFDEIGGHFNAYTGHEKTIYYARVLSENCDKALNILADIIQNSIFAEEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EI  S+D+  D +  +F   V+KDQ +G+PILG  +T+SSFT E  +SF+ ++Y 
Sbjct: 124 QVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGKPILGASKTLSSFTKEHFLSFIDKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A  +Y+   G VDH+  VS  E  F+     + K +  PA Y+GG     +DL +  ++L
Sbjct: 184 AGNLYLSVAGNVDHDKIVSSAERLFSSLKQGE-KSNFLPAKYIGGNSFINKDLEQTTLIL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF G  Y      Y T +LA I G GMSSRLFQ +REK GL Y++ +++  +SD+GV  I
Sbjct: 243 GFEGTPYINLERLYRTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSTYSDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA + +  L   +   +  + E + + E+ +   ++ + L+ +QE+   ++ EI K 
Sbjct: 303 YASTAHDKLELLYKELKTEITKMTEKVNEEEMIRAKTQLRSNLLMAQEKVAYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+I++ I+ I  +DI+  A KIFSS  T AI+GP 
Sbjct: 363 YAAFGKYIPPEEIMEIITNIKADDIINTANKIFSSITTSAIIGPN 407


>gi|257466754|ref|ZP_05631065.1| Zinc protease [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917903|ref|ZP_07914143.1| zinc protease [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691778|gb|EFS28613.1| zinc protease [Fusobacterium gonidiaformans ATCC 25563]
          Length = 416

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 122/409 (29%), Positives = 208/409 (50%), Gaps = 4/409 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +++   S+GITV+ E +P + S  +   +R G+RNER+EE G++HF+EHM+FKGT  RT
Sbjct: 4   QVQVKTLSNGITVLIEKVPELQSFSLGFFVRTGARNEREEESGISHFIEHMMFKGTETRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           AK++ E I+  GG INAYTS E T Y+  +L   + +A++++ DM+ +S+F   +IE+ER
Sbjct: 64  AKDLSEVIDNEGGIINAYTSRETTVYYVQLLSNKLEIAIDVLSDMMLHSTFTEENIEKER 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           NV++EEI M ED   D      +       I    I G PE +   T E  ++++   Y 
Sbjct: 124 NVIIEEIKMYEDSPED-TVHDENISFALRGIQSNSISGTPEGLKKITREHFMNYLKDQYV 182

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYI-QKRDLAEEHMM 239
           A  + +   G  D    ++Q+E   +    +  K        +        RD  + H+ 
Sbjct: 183 ASNLLIAISGNFDETVLMTQLEEKMSAFPQSDKKREYDNRYEIYAGTQVITRDTQQVHIC 242

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
               G        Y  +ILA+ LG GMS+RLFQ +RE++GL YS+ ++   + D G+   
Sbjct: 243 FNTRGIDVHHPKKYAASILANALGGGMSARLFQRIREEKGLAYSVYSYQSVYEDCGIFTT 302

Query: 300 ASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T KE    + + I E  + +  E I ++E+ +   +  + L+   E S  R   ++ 
Sbjct: 303 YAGTTKEAYQEVVNMIQEEYKKVREEGITEQELQRCKNQFTSALMFHLESSKGRMSSMAS 362

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
             +  G +   E+I+  I+ ++ EDI  +A+ +F        +   +  
Sbjct: 363 SYINNGKVEAREEIMKRINEVSLEDIKEMAQYLFDEKYYSCTVLGNIKK 411


>gi|67970696|dbj|BAE01690.1| unnamed protein product [Macaca fascicularis]
          Length = 493

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 94/413 (22%), Positives = 187/413 (45%), Gaps = 12/413 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVC---SVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCAHKGEIPALPPCTFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEPATVADMLHVVQKEWMRLCTSVTESEVARAKNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPP 404
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +G P
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGKP 471


>gi|881434|gb|AAA73485.1| ORFP [Bacillus subtilis]
          Length = 409

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 126/410 (30%), Positives = 231/410 (56%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ ++A
Sbjct: 2   IKRYTCPNGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTKSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+ +++++E+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  ET++SF  + +  ++   YT 
Sbjct: 122 VVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G +  +  +  VE +F           ++   +   +  +K++  + H+ LG
Sbjct: 182 DRVVISVAGNIS-DSFIKDVEKWFGSYEAKGKATGLEKPEFHTEKLTRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G        Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I  
Sbjct: 241 FKGLEVGHERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L+ +I E + +   + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGANQLQQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +  G     ++II+ ++A+  E + G+A+++F+    LA++  P  ++P+
Sbjct: 361 LLLGKHKTLDEIINELNAVNLERVNGLARQLFTEDYALALI-SPSGNMPS 409


>gi|294084681|ref|YP_003551439.1| peptidase M16 domain-containing protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664254|gb|ADE39355.1| peptidase M16 domain protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 421

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 137/419 (32%), Positives = 231/419 (55%), Gaps = 4/419 (0%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +++  ++G+ V T  MP   +  + + ++ G+R+ER  E G+AH LEHM FKGT+ R A 
Sbjct: 5   KLTTLANGLGVATRTMPHAQTISIGIWVQVGARDERDNEQGIAHMLEHMAFKGTSSRDAL 64

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I  E+E VGG +NA+TS E T+Y+  +L EH+ L ++I+ D+L+ S+    +IERER V
Sbjct: 65  AIATEVEDVGGFMNAHTSREETAYYVRILPEHLDLGIDILADILTCSTLPEDEIERERGV 124

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +++EIG S D   D +   F+E       +GRPILG  +++S+FT   +  F+ R+Y A 
Sbjct: 125 IIQEIGQSADTPDDMVFDLFAESTHGGHTLGRPILGTVDSVSAFTQGDLAGFMKRHYGAG 184

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           +M V   G +DH+  V ++         A+     +PA   G      R+L + H++ G 
Sbjct: 185 QMLVCAAGKIDHDDLVGRITDAIGTIKTAEHATRNRPAWQAGRSI-LTRELEQAHVIFGL 243

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              +  + D +    L+++ G GMSSRLFQ+VREKRGLCYSI +    +SD GV  + + 
Sbjct: 244 PAPSATASDRFSLMALSTLYGGGMSSRLFQQVREKRGLCYSIFSFPTLYSDCGVFGVYAG 303

Query: 303 TAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
           T+ + +  +       + ++   +   E+ +  A+I A L+ S+E        +++Q+  
Sbjct: 304 TSADKVDEMLRVSAGELAAIAAKVTDEEVARAKAQIRANLLMSRESVAACGDALARQITL 363

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSELIHALEG 420
            G       ++D I AIT + +  VA  +  +  P +A++GP  D++ + S+L  AL  
Sbjct: 364 FGEPQDDGDLLDAIDAITSDAVSKVAADLIAAGDPAVALVGP-TDNIMSNSQLSAALSA 421


>gi|299134062|ref|ZP_07027255.1| processing peptidase [Afipia sp. 1NLS2]
 gi|298590809|gb|EFI51011.1| processing peptidase [Afipia sp. 1NLS2]
          Length = 429

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 146/383 (38%), Positives = 232/383 (60%), Gaps = 1/383 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M + I+K  SG+TV+T+ MP +++A + V    G R+E+ +EHG++H LEHM FKGT  R
Sbjct: 1   MAVEITKLPSGLTVVTDAMPHLETAALGVWTGVGGRDEKLDEHGISHLLEHMAFKGTASR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           T++EIVE+IE VGGD+NA TS E T+Y+A V+K  VPLA++++ D+L+N SF+  ++ERE
Sbjct: 61  TSREIVEQIEAVGGDLNAATSSESTAYYARVMKADVPLAIDVLSDILANPSFDTDELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           ++V+++EIG + D   D +     E+ + DQ +GR +LG PET+++FT +K+  +++ +Y
Sbjct: 121 KSVIVQEIGAAMDTPDDAVFEYLGELAYPDQPMGRSLLGTPETLATFTRDKLRGYLTTHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
               M V   GA+DH   V+ VE  F      +  +S       GG  + +RDL + H+ 
Sbjct: 181 RGPDMVVAASGAIDHRRIVADVEQRFAGFGADEGPKSKPAVFGKGGSRVVRRDLEQAHLT 240

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           L   G        +   +  +ILG GMSSRLFQEVREKRGLCYSI   H+ +SD G   +
Sbjct: 241 LALEGIPQSDPALFSLQVFTNILGGGMSSRLFQEVREKRGLCYSIYTFHQPYSDTGFFSL 300

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            + T   +   +   IV+ +   +E + + EI +  A++ A L+ + E    RA ++++ 
Sbjct: 301 YTGTDPTDAPEMMEVIVDEMNEAVETLTEAEIARAKAQMKAGLLMALESCSARAEQLARH 360

Query: 360 VMFCGSILCSEKIIDTISAITCE 382
           V+  G  L  E++I  I  ++ E
Sbjct: 361 VLAYGRPLSIEEMIARIDNVSVE 383


>gi|56963985|ref|YP_175716.1| Zn-dependent protease [Bacillus clausii KSM-K16]
 gi|56910228|dbj|BAD64755.1| Zn-dependent protease [Bacillus clausii KSM-K16]
          Length = 414

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 123/401 (30%), Positives = 222/401 (55%), Gaps = 3/401 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ +I E      S  + + ++ GSRNE  EE+G++HF+EHMLFKGT  R+A
Sbjct: 2   IKKETLDNGVRIIAEANEAIRSVAIGIWVKTGSRNESNEENGISHFIEHMLFKGTKTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I E  +++GG +NA+T+ E+T Y+A VL EH  LAL+++ DM  +S F+ ++IERE+ 
Sbjct: 62  KQIAEAFDRIGGQVNAFTAKEYTCYYAKVLDEHAALALDVLQDMFFDSIFDKTEIEREKK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +    S+ V+    +  PILG  +T+ +F+ ++I  ++ R Y  
Sbjct: 122 VVLEEIKMVEDTPDDLVHDLLSQAVFGRSSLANPILGTEDTLQTFSRQQISDYMKRFYAG 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           +R+ V   G  D +  + Q+   F+    A    ++  A +      +++D  + H+ L 
Sbjct: 182 ERVVVSVCGHFD-DALLEQIRQTFSRVKRAPEPFAVPTATFSPTVKYRQKDSEQAHLCLA 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G    S   +   +L + LG  MSSRLFQ +RE++GLCYS+ ++H ++   G L I +
Sbjct: 241 YPGLEIGSNRSFGLILLNNALGGSMSSRLFQTIREEQGLCYSVFSYHSSYEQIGTLTIYA 300

Query: 302 ATAKENIMALTSSIVEVVQ-SLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  LT ++ EV +    E + ++E++    ++   ++   E +  R     K  
Sbjct: 301 GTQMAQLPKLTEALAEVTKAVRAEGLSKKELENGKEQLKGSIMLGLESTSSRMTRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
           +        +++I  I+A++ E +  +A ++   TP ++++
Sbjct: 361 LLLQEHKTLDELIADINAVSLEMVNDLASQLLRDTPAVSLV 401


>gi|82621176|gb|ABB86276.1| mitochondrial processing peptidase-like [Solanum tuberosum]
          Length = 522

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 124/424 (29%), Positives = 204/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   SG+ V TE    + +A V V I AGSR E  E +G AHFLEHM+FKGT KRT+ 
Sbjct: 96  RVTTLPSGLRVATETNLAVKTATVGVFIDAGSRFETDETNGTAHFLEHMIFKGTEKRTSW 155

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ EEIE +GG +NAYTS E T+Y+A VL   VP+AL+I+ D+L NS F    IERER+V
Sbjct: 156 EMEEEIENMGGHLNAYTSREQTAYYAKVLDNDVPVALDILADILQNSKFEERKIERERDV 215

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + I + T   +  ++S +YTA 
Sbjct: 216 ILREMEEVEGQTEEVIFDHLHSTAFQYSPLGRTILGPAQNIKTITRSHLKDYISTHYTAP 275

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEH 237
           RM +V  G V HE  V QV+  F   S      S   A            +   D+    
Sbjct: 276 RMVIVASGPVKHEEFVEQVKKQFTKLSTNPTTASELVAREPAIFTGSEVRVIDDDIPLAQ 335

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + F G  +   D     ++ S+LG    +    +              L  S+ + + 
Sbjct: 336 FAVAFQGAPWTDPDAIPLMVMQSMLGTWNKNAGGGKHMGSDLAQSVAINELAESMMSFNT 395

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L+  I+  +  L   +   ++ + C ++ + L+   + +
Sbjct: 396 NYKDTGLFGVYAVAKPDCLSDLSYCIMREISKLCYRVSDADVTRACNQLKSSLMLHIDGT 455

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   + A+    I  VA + IF     ++ LGP +  +
Sbjct: 456 SPVAEDIGRQLLTYGRRIPVTELFARVDAVDASTIKRVANRFIFDQDVAISALGP-IQTL 514

Query: 409 PTTS 412
           P  +
Sbjct: 515 PDYN 518


>gi|119964387|ref|YP_947338.1| Zn-dependent peptidase [Arthrobacter aurescens TC1]
 gi|119951246|gb|ABM10157.1| putative Zn-dependent peptidases, family M16 [Arthrobacter
           aurescens TC1]
          Length = 448

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 119/412 (28%), Positives = 211/412 (51%), Gaps = 11/412 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA +   +  GSR+E   +HG  HFLEH+LFKGT +RTA
Sbjct: 28  VRRSVLPGGVRVLTEAMPGQRSATIGFWVAVGSRDEADGQHGSTHFLEHLLFKGTKRRTA 87

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    ++VGG+ NA T+ E T Y A VL   +P+A+++I DM++ +  +P+++E+ER+
Sbjct: 88  LEIASAFDEVGGESNAATAKESTCYFARVLDTDLPMAIDVIADMITGAVLDPAELEQERD 147

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M  DD  D    +F   V     + RPI G P+ I +   + + +   R Y  
Sbjct: 148 VILEEIAMDSDDPTDVAHEKFVAAVLGHHPLARPIGGTPDAIKAVARDSVWAHYQRYYRP 207

Query: 182 DRMYVVCVGAVDHEFCVSQVES------YFNVCSVAKIKESMKPAVYVGGE---YIQKRD 232
           + + +   G +DH+     V        +      A +         + G    ++ KR 
Sbjct: 208 EELVITAAGGLDHDVVCELVLDALKAAGWQLNADAAPVNRRGTDRAVITGTSGLHVVKRP 267

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           + + ++++G           ++ ++L ++LG GMSSRLFQE+REKRGL YS  +    ++
Sbjct: 268 VEQANIIMGCPTIVATDDRRFVMSVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFTAAYA 327

Query: 293 DNGVLYIASATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +      +  +     +E+ +   E I   E+ K   ++   ++ + E +  
Sbjct: 328 DAGYFGMYAGCTPSKVRQVLELLGLELDKLAKEGITDEELRKAVGQLSGGIVLALEDTGS 387

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   + +  +  G     ++ +  I A+T ED+  +A+++ ++  T+ ++GP
Sbjct: 388 RMSRLGRAELVSGEFQDIDETLARIKAVTVEDVQELARELAAAPRTITVVGP 439


>gi|40226469|gb|AAH14079.2| PMPCB protein [Homo sapiens]
          Length = 480

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 95/431 (22%), Positives = 193/431 (44%), Gaps = 13/431 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHF EHM FKGT KR+  +
Sbjct: 50  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFPEHMAFKGTKKRSQLD 109

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 110 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 169

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 170 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 229

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 230 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 289

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 290 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 349

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 350 DTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 409

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTT 411
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +GP +  +P  
Sbjct: 410 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGP-IKQLPDF 468

Query: 412 SELIHALEGFR 422
            ++   +   R
Sbjct: 469 KQIRSNMCWLR 479


>gi|226508302|ref|NP_001149620.1| LOC100283246 [Zea mays]
 gi|195628546|gb|ACG36103.1| mitochondrial-processing peptidase beta subunit [Zea mays]
          Length = 530

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 113/424 (26%), Positives = 207/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E +E  G+AHF+EHMLFKGT KR+A 
Sbjct: 97  RVTTLPNGLRVATESSLAARTATVGVWIDAGSRYENEEAAGVAHFVEHMLFKGTGKRSAA 156

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ +EIE +GG +NAYTS E T+Y+A VL + VP A+E++ D+L NS+ + + IERER V
Sbjct: 157 QLEQEIEDMGGHLNAYTSREQTTYYAKVLDKDVPRAMEVLADILQNSNLDQARIEREREV 216

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  S +F+        ++   +GRPILG  + + S T E + ++++ +YTA 
Sbjct: 217 ILREMEEVEGQSEEFIFDHLHATAFQYTSLGRPILGSADNVKSITKEDLENYIATHYTAS 276

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   G V HE  V Q +  F+  S      +M  +         +  + ++ M L  
Sbjct: 277 RMVITAAGNVKHEDIVEQAKKLFSKLSTDPTTTNMLVSKQPASFTGSEVRIIDDDMPLAQ 336

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYS-------------ISAHHE 289
              A+    +   + +A ++   M     +     + +                +   + 
Sbjct: 337 FAVAFNGASWVDPDSVALMVMQTMLGSWNKSAGGGKHMGSELVQRAAINDIAESVMGFNT 396

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + +    + S
Sbjct: 397 NYKDTGLFGVYAVAKADCLDDLAFAIMHEMSKLSYRVTEEDVIRARNQLKSSIQLHLDGS 456

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q++  G  + + ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 457 TAVVEDIGRQLLTYGRRIPTPELFARIDAVDASTVKRVANRFIFDQDVAIAAMGP-IQGL 515

Query: 409 PTTS 412
           P  +
Sbjct: 516 PDYN 519


>gi|327266028|ref|XP_003217809.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome b-c1 complex subunit 1,
           mitochondrial-like [Anolis carolinensis]
          Length = 482

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 89/432 (20%), Positives = 179/432 (41%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   +G+ + +E     +  V V I +GSR E +  +G+ +F++HM FKGT KR   E
Sbjct: 51  EVTTLDNGLRIASEHSDQPTCTVGVWIGSGSRYENENNNGVCNFVDHMAFKGTKKRPGAE 110

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
             +E+E +G  +N+YTS E T++    L + +P A+EI+ D++ N S   S IE+ERNV+
Sbjct: 111 FEKEVESMGAHLNSYTSREQTAFFMKALAKDLPKAIEILADVVQNCSLEESQIEKERNVI 170

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E+   +    D +        ++   + R I G        T   ++ ++  ++ A R
Sbjct: 171 LQEMKEMDACLSDVVFDYLHATAYQGTALSRTIEGTSANAKRLTRTNLVEYIETHFKAPR 230

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G V H+  V   + +F           I    K         ++   L   H+ 
Sbjct: 231 MVLAAAGGVSHKEVVDIAKQHFGNVPYEYKEDTIPLLPKCRFTGSEIRVRDDALPLAHVA 290

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   G  +   D     +  +++G+   +    + +  +         +C S  A +  +
Sbjct: 291 IAVEGPGWADPDNIPLLVANAVIGNYDLTFGGGKNQSSKLASIVAQTNMCQSFRAFNTCY 350

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+      +   +I            SL  ++   ++ +    +    +   + +  
Sbjct: 351 SDTGLFGFYFVSDGLHIEDTLHFAQGEWMSLCTSVTDSDVKRAKNTLRNSFVAQLDGTTP 410

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
               I  Q++  G  +   +    IS +  + +  V  K      P +A +GP ++ +P 
Sbjct: 411 ICENIGSQLLNYGRRISLAEWESRISEVDAKTVREVCSKYLYDKCPAVAAVGP-IEQLPD 469

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 470 YNRVRSAMYWLR 481


>gi|326504636|dbj|BAK06609.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 468

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 117/433 (27%), Positives = 199/433 (45%), Gaps = 19/433 (4%)

Query: 4   RISKTSSGITVITE-VMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +IS   +G+TV TE      +A V V I AGSR E  +  G AHFLEHM FKGT KR+  
Sbjct: 32  QISTLPNGLTVATEASSASSTATVGVWIDAGSRAETDKTSGTAHFLEHMAFKGTGKRSQH 91

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  E+E +G  +NAYTS E T Y+A      VP ++EII D+L+ S      IERER+V
Sbjct: 92  QLELEVENLGAHLNAYTSREQTVYYAKSFASDVPKSVEIISDILTGSKLEAGAIERERDV 151

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    +    + +      + ++ Q +GR ILG  + I S   + +++++  NYTAD
Sbjct: 152 ILREQQEVDKQVEEVVFDHLHAVAFQHQPLGRTILGPKDNILSIQRDDLVNYIKTNYTAD 211

Query: 183 RMYVVCVGAVDHE-------FCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAE 235
           RM +V  G V+H+           Q+ +      +   +   KP        ++   +  
Sbjct: 212 RMVLVGTGGVEHQALVDLATKHFGQLPTSAQPIKLGDAQHKTKPDFVGAEVRVRDDTMQT 271

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQ--------EVREKRGLCYSISAH 287
            ++ +   G  + S D+Y   ++ SI+G+   S   Q         +     L  S  + 
Sbjct: 272 CNIAIAVEGVGWNSPDYYPMLVMQSIMGNWDRSLGAQSLLSSRLSHIISSNNLANSFMSF 331

Query: 288 HENFSDNGVLYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQ 346
             ++SD G+  I   +        LT    +    L  +  + E+ +  A++ A L+   
Sbjct: 332 STSYSDTGLWGIYLVSENVMNLDDLTHFTFKEWARLSTHPTEGEVSRAKAQLKASLLLGL 391

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPM 405
           + S   A +I +Q++  G  L  ++I   + A++  D+   AKK        +A +G   
Sbjct: 392 DGSTAVAEDIGRQIVTGGRRLAPKEIEAAVDAVSVGDVQRCAKKYLWDKDIAVAAVGR-T 450

Query: 406 DHVPTTSELIHAL 418
           + +   S +   +
Sbjct: 451 EGLQDYSRMRSGM 463


>gi|170088947|ref|XP_001875696.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648956|gb|EDR13198.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 465

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 120/435 (27%), Positives = 207/435 (47%), Gaps = 18/435 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            +S  S+G+TV TE  P   +A V V I AGSR E  + +G AHFLEHM FKGT++RT  
Sbjct: 30  EVSTLSNGLTVATEAHPHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTSRRTQH 89

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +  E+E +G  +NAYTS E T Y+A   ++ VP+A++II D+L NS    S IERER+V
Sbjct: 90  SLELEVENIGAHLNAYTSREQTVYYAKSFRKDVPVAVDIISDILQNSKLENSAIERERDV 149

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    +    + +      + ++ Q +GR ILG  E I S   + + S++  NYTAD
Sbjct: 150 ILREQQEVDKQLEEVVFDHLHAVAFQGQPLGRTILGPKENILSIKRDDLASYIKTNYTAD 209

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY------IQKRDLAEE 236
           RM +V  G V+H   V   E +F+   V+     +    +    +      I+  ++   
Sbjct: 210 RMVLVGTGGVEHAALVKLAEKHFSSLPVSPKPIPLGRLSHAKPAFVGSEVRIRDDEIPTA 269

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLC--------YSISAHH 288
           ++ +   G  + S D++   ++ +I G+   S     +   R            S  +  
Sbjct: 270 NIAVAVEGVGWSSPDYFPMMVMQTIFGNWDRSLGSSSLNSSRLSHIVSENDLANSFMSFS 329

Query: 289 ENFSDNGVLYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
            ++SD G+  I   +        L    ++    +       E+++  +++ A L+ S +
Sbjct: 330 TSYSDTGLWGIYLVSENLMNLDDLIHFTLKEWTRMSIAPTSVEVERSKSQLKAGLLLSLD 389

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMD 406
            +   A +I +Q++  G     ++I   + A+T ++I  VA+K        LA +G  +D
Sbjct: 390 GTTAVAEDIGRQLVTSGRRFTPQQIESAVDAVTVDEIKRVAQKYLWDKDFALAAVG-SID 448

Query: 407 HVPTTSELIHALEGF 421
            +   + L   +   
Sbjct: 449 GLLDYNRLRADMSSM 463


>gi|8708914|gb|AAF78805.1| mitochondrial processing peptidase-like protein Mpp [Bradyrhizobium
           japonicum]
          Length = 404

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 141/397 (35%), Positives = 231/397 (58%), Gaps = 3/397 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNE-RQEEHGMAHFLEHMLFKGTTK 58
           M++ ISK +SG+TV+T+ MP +++A + V    G  +E +  EHG++H LEHM FKGTTK
Sbjct: 1   MSVEISKLASGLTVVTDKMPHLETAALGVWAGVGGPHEGKPNEHGISHLLEHMAFKGTTK 60

Query: 59  RTAKE-IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
           R+++  IVEEIE VGGD+NA TS E TSY+A VLK  VPLAL+++ D+L+N +F P ++E
Sbjct: 61  RSSRRRIVEEIEAVGGDLNAGTSTETTSYYARVLKADVPLALDVLADILANPAFEPDELE 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
           RE+NV+++EI  ++D   D +    +E+ + DQ +GR +LG  +++ +F  + +  ++S 
Sbjct: 121 REKNVIVQEIRAAQDTPDDVVFEHLNELCYPDQPMGRSLLGTAKSLRAFNRDMLRGYLST 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           +Y    M V   GAVDH   V++ E  F         +        GG  +  R+L + H
Sbjct: 181 HYRGPDMVVAAAGAVDHSQVVAEAEKRFASFEGTPGPKPQAAQFGKGGAKVVHRELEQAH 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + L   G        +   +  +ILG GMS +LFQEVREKRGLCYSI + H  ++D G  
Sbjct: 241 LALALEGVPQNDLSLFSLQVFTNILGGGMSYQLFQEVREKRGLCYSIYSFHAPYTDTGFF 300

Query: 298 YIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
            + + T   +   +   +V+V+   +E + + EI +  A++ A L+ + E    RA +++
Sbjct: 301 GLYTGTDPADAPEMMEVVVDVMNDSVETLTEAEIARAKAQMKAGLLMALESCSSRAEQLA 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS 394
           + V+  G     ++++  I A++ E     A+ + S 
Sbjct: 361 RHVLAYGRPQTVQELVARIDAVSVESTRDAARALLSR 397


>gi|86742235|ref|YP_482635.1| processing peptidase [Frankia sp. CcI3]
 gi|86569097|gb|ABD12906.1| processing peptidase [Frankia sp. CcI3]
          Length = 467

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 130/413 (31%), Positives = 207/413 (50%), Gaps = 7/413 (1%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             R +    G+ VITE +P   S  + V +  GSR+E     G +H+LEH+LFKGT  R 
Sbjct: 47  TARRTVLPGGLRVITERVPGVRSVAIGVWVAVGSRDETPVTAGCSHYLEHLLFKGTPSRD 106

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A  I   +E VGGDINA+T  E+T Y+  VL   + +A+ +I DM++NS     D+E ER
Sbjct: 107 ALTISASVEAVGGDINAFTGKEYTCYYVRVLDSDLAMAVNVIADMVTNSLVTADDVEAER 166

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M EDD  D +   F+  +    ++GRP+LG  E+I     E I  +    Y 
Sbjct: 167 GVILEEIAMYEDDPGDLVHDVFAAAMLGSSVLGRPVLGTTESIEGLGRETIADYYRSRYV 226

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAE 235
              M V   G + H+  ++ V   F           +++          G  +  R   +
Sbjct: 227 PPAMVVSIAGNLAHDRALALVAEAFADRLTVSAEPFEVRGGSYDYPPPPGIVVTDRPTEQ 286

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
            H++LG  G +      Y   +L++ LG GMSSRLFQE+REKRGL YS+ +   +F+D G
Sbjct: 287 AHLVLGTRGLSRHDPRRYTLGVLSTALGGGMSSRLFQEIREKRGLAYSVGSFASHFADAG 346

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           +  + +  A +    +     E V+ +    I   E+D+   +    +I   E +  R  
Sbjct: 347 LFGVYAGCAPKRADVVLELAREQVRQIAEHGISAEELDRARGQNRGSMILGLEDTGSRMS 406

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
            + K  +  G +L  ++II  + A+T +D+  +A+++   +  L ++GP  DH
Sbjct: 407 RLGKSELVHGEVLSVDEIIARVDAVTLDDVTAIARELLDQSWALGVIGPFDDH 459


>gi|114615266|ref|XP_519287.2| PREDICTED: similar to PMPCB protein isoform 3 [Pan troglodytes]
          Length = 490

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 94/413 (22%), Positives = 187/413 (45%), Gaps = 12/413 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCEPSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPP 404
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +G P
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGKP 471


>gi|242041787|ref|XP_002468288.1| hypothetical protein SORBIDRAFT_01g043060 [Sorghum bicolor]
 gi|241922142|gb|EER95286.1| hypothetical protein SORBIDRAFT_01g043060 [Sorghum bicolor]
          Length = 530

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 114/424 (26%), Positives = 207/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR E ++  G+AHF+EHMLFKGT KR+A 
Sbjct: 97  RVTTLPNGLRVATESSLAARTATVGVWIDAGSRYENEKAAGVAHFVEHMLFKGTGKRSAA 156

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++ +EIE +GG +NAYTS E T+Y+A VL + VP A+E++ D+L NS+ + + IERER V
Sbjct: 157 QLEQEIEDMGGHLNAYTSREQTTYYAKVLDKDVPRAMEVLADILQNSNLDQARIEREREV 216

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  S + +        ++   +GRPILG  + + S T E + ++++ +YTA 
Sbjct: 217 ILREMQEVEGQSEEVIFDHLHATAFQYTSLGRPILGSADNVKSITKEDLENYIATHYTAP 276

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   G V HE  V Q +  FN  S      +M  A         +  + ++ M L  
Sbjct: 277 RMVITAAGNVKHEDIVEQAKKLFNKLSTDPTTTNMLVAKEPASFTGSEVRIIDDDMPLAQ 336

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYS-------------ISAHHE 289
              A+    +   + +A ++   M     +     + +                + A + 
Sbjct: 337 FAVAFNGASWVDPDSVALMVMQSMLGSWNKSAGGGKHMGSELVQRAAINDIAESVMAFNT 396

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + +    + S
Sbjct: 397 NYKDTGLFGVYAVAKADCLDDLAFAIMHEMSKLSYRVMEEDVIRARNQLKSSIQLHLDGS 456

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q++  G  + + ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 457 TAVVEDIGRQLLTYGRRIPTAELFARIDAVDASTVKRVANRFIFDQDVAIAAMGP-IQGL 515

Query: 409 PTTS 412
           P  +
Sbjct: 516 PDYN 519


>gi|218782572|ref|YP_002433890.1| peptidase M16 domain protein [Desulfatibacillum alkenivorans AK-01]
 gi|218763956|gb|ACL06422.1| peptidase M16 domain protein [Desulfatibacillum alkenivorans AK-01]
          Length = 418

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 129/406 (31%), Positives = 212/406 (52%), Gaps = 2/406 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R ++  +GI ++T  MP + S  + V +  G+R+E  E +GM HF+EHM+FKGT KR A
Sbjct: 5   VRKTELHNGIRIVTNSMPHVRSVSMGVWVNVGARDEPLENNGMCHFIEHMVFKGTEKRDA 64

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  E++ +GG+ NA+T +E T YH  VL  H+P   +I+ D+  NS F P +  RER 
Sbjct: 65  FQIAAEMDAIGGNANAFTGMEDTCYHGKVLDTHLPRLTDILSDIFLNSVFQPEEFVRERA 124

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EIGM +D   D +    SE ++ +  +GR +LG P+ + SF    ++ ++   Y  
Sbjct: 125 VILQEIGMQDDSPDDRVHLMTSEALFGEHPLGRSVLGSPDNLLSFEAHSLLDYLKEWYQP 184

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
            R+ +   G +DH+  VS     F   S         P        ++ RDL + H+ L 
Sbjct: 185 SRIVITAAGHLDHDDFVSLTGPAFEQVSPGPELPQRVPPKNKPELRVEHRDLEQVHLCLA 244

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
            +G        Y  +++  ILG  MSSRLFQEVREKRGL YS+ +   +FSD G + + +
Sbjct: 245 ASGLGAVDPRRYAYSLMNIILGGNMSSRLFQEVREKRGLAYSVYSFAPSFSDTGAIGVYA 304

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
                N+      I + + +   + + ++E+      +   LI S E +  + L  ++  
Sbjct: 305 GVDPSNLDLTLDLIYKELSRLKGDKVSEQELRGAKEYVLGSLIMSAESTDNQMLRAAQNE 364

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           +  G      +    I A+T E+I+ +A ++  +   LA+LGP  D
Sbjct: 365 INFGRHKPISESAKNIEAVTREEILELANELLEAPMALAVLGPVQD 410


>gi|190348004|gb|EDK40383.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 463

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 119/439 (27%), Positives = 210/439 (47%), Gaps = 22/439 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + S   +G+TV +EVMP   +A V V I AGSR +  +  G AHFLEH+ FKGT KRT
Sbjct: 26  TFKTSTLPNGLTVASEVMPGTKTATVGVWINAGSRADNPKNSGTAHFLEHLAFKGTNKRT 85

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L+  +   ++I+ D+L+ S   P  IE ER
Sbjct: 86  QLNLELEIENLGAQINAYTSRENTVYYTRCLESDINQNIDILSDLLTRSKLEPRAIENER 145

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+E    +    + +     ++ +K+Q +GR ILG  E I++ + E ++++++ NY 
Sbjct: 146 HVILQESDEVDKMYDEVVFDHLHDVAYKNQDLGRTILGPREIINTISREDLVNYITANYK 205

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM ++ VG VDH+  V+Q E  F     ++I  +      P  Y     IQ   L   
Sbjct: 206 GDRMALIGVGCVDHDALVAQAEKQFGHIKKSEIPFTQGGGDLPVFYGNEIRIQDDSLPNT 265

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV---------------REKRGLC 281
           H+     G ++ + DF+  ++   I+G    S                     +      
Sbjct: 266 HVAFAVEGVSWSAPDFFTASVANGIVGTWDRSVGIGSNSPSPLALTAATGGKGQTPIANS 325

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  +    +  +   + + E  +     I + E+++  A++ A 
Sbjct: 326 YMAYTTSYADTGLMGVYFTADKDVDLKLFTDAVLKEWARLRTGAITEEEVERSKAQLKAS 385

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +Q++  G  L  E++ + + AIT +D+V  A       P  ++ 
Sbjct: 386 LVLALDDSTAIAEDIGRQLVNTGYRLSPEEVFERVEAITVKDVVDWANYRLKDKPIAISA 445

Query: 401 LGPPMDHVPTTSELIHALE 419
           +G  +  +P+ S +I  ++
Sbjct: 446 MG-NVKTLPSHSYIIEGMK 463


>gi|146415564|ref|XP_001483752.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 463

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 119/439 (27%), Positives = 210/439 (47%), Gaps = 22/439 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + S   +G+TV +EVMP   +A V V I AGSR +  +  G AHFLEH+ FKGT KRT
Sbjct: 26  TFKTSTLPNGLTVASEVMPGTKTATVGVWINAGSRADNPKNSGTAHFLEHLAFKGTNKRT 85

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L+  +   ++I+ D+L+ S   P  IE ER
Sbjct: 86  QLNLELEIENLGAQINAYTSRENTVYYTRCLESDINQNIDILSDLLTRSKLEPRAIENER 145

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+E    +    + +     ++ +K+Q +GR ILG  E I++ + E ++++++ NY 
Sbjct: 146 HVILQESDEVDKMYDEVVFDHLHDVAYKNQDLGRTILGPREIINTISREDLVNYITANYK 205

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM ++ VG VDH+  V+Q E  F     ++I  +      P  Y     IQ   L   
Sbjct: 206 GDRMALIGVGCVDHDALVAQAEKQFGHIKKSEIPFTQGGGDLPVFYGNEIRIQDDSLPNT 265

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV---------------REKRGLC 281
           H+     G ++ + DF+  ++   I+G    S                     +      
Sbjct: 266 HVAFAVEGVSWSAPDFFTASVANGIVGTWDRSVGIGSNSPSPLALTAATGGKGQTPIANS 325

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  +    +  +   + + E  +     I + E+++  A++ A 
Sbjct: 326 YMAYTTSYADTGLMGVYFTADKDVDLKLFTDAVLKEWARLRTGAITEEEVERSKAQLKAS 385

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +Q++  G  L  E++ + + AIT +D+V  A       P  ++ 
Sbjct: 386 LVLALDDSTAIAEDIGRQLVNTGYRLSPEEVFERVEAITVKDVVDWANYRLKDKPIAISA 445

Query: 401 LGPPMDHVPTTSELIHALE 419
           +G  +  +P+ S +I  ++
Sbjct: 446 MG-NVKTLPSHSYIIEGMK 463


>gi|224077762|ref|XP_002305398.1| predicted protein [Populus trichocarpa]
 gi|222848362|gb|EEE85909.1| predicted protein [Populus trichocarpa]
          Length = 526

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 116/424 (27%), Positives = 203/424 (47%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT KR  +
Sbjct: 93  RITTLPNGLRVATESNLASKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEKRGVR 152

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ EEIE +GG +NAYTS E T+Y+A V+ + V  AL+I+ D+L NS+F+   + RER+V
Sbjct: 153 ELEEEIENMGGHLNAYTSREQTTYYAKVMDKDVNKALDILADILQNSTFDEERMSRERDV 212

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +  E+   E  + + +        ++   + R ILG  + I + + + I +++  +YTA 
Sbjct: 213 ITMEMKEVEGQTEEVIFDHLHATAFQYSPLARTILGPAKNIETISRDDIRNYIQTHYTAP 272

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCS-----VAKIKESMKPAVYVGGEYIQKRDLAEEH 237
           RM +V  GAV HE  V +V+  F   S      A++              I   D+    
Sbjct: 273 RMVIVASGAVKHEEFVGEVKKLFTKLSSDQTTAAQLVAKDPAFFTGSEVRIIDDDIPLAQ 332

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHE 289
             + F G ++   D     ++ ++LG    S    +              +  S+ A + 
Sbjct: 333 FAVAFQGASWTDPDSIALMVMQAMLGSWNKSAGGGKHMGSELVQRVAIDEIAESMMAFNT 392

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    +++  L  +I+     L   + + E+ + C ++ + L+   + +
Sbjct: 393 NYKDTGLFGVYAVAKPDSLDDLAWAIMHETTKLCYRVSEAEVTRACNQLKSSLLLHIDGT 452

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I A+    I  VA +        +A +GP +  +
Sbjct: 453 SPVAEDIGRQLLTYGRRIPFAELFARIDAVGPSTIKRVASRFIHDQDIAIAAMGP-IQGL 511

Query: 409 PTTS 412
           P  +
Sbjct: 512 PDYN 515


>gi|31789481|gb|AAP58594.1| putative protease [uncultured Acidobacteria bacterium]
          Length = 432

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 124/403 (30%), Positives = 216/403 (53%), Gaps = 2/403 (0%)

Query: 8   TSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVE 66
             SG+ +ITE MP + S  + V +  G+R+E  E  G+AHF+EHMLFKGT  R+A++I +
Sbjct: 20  LPSGLRLITEQMPHVRSVSIGVWLARGARHEPPEHGGIAHFVEHMLFKGTESRSAEDIAQ 79

Query: 67  EIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEE 126
            I+ +GG ++A+T+ E+  Y+  VL EH+P A+E++ D++ N +F+  DIE+E+ V+LEE
Sbjct: 80  AIDSIGGQMDAFTAKEYAGYYLKVLDEHLPFAVEVLSDIVMNPAFSDDDIEKEKKVILEE 139

Query: 127 IGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYV 186
           I M ED   D +   F+E  W D  +GRPILG  ET+ S   E +  +    Y+A  + V
Sbjct: 140 IKMVEDTPDDLVHELFTENFWADHPLGRPILGTRETVESLAQENLRRYFGGAYSAPHLIV 199

Query: 187 VCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
             VG ++H   +  + + F       I    +P        ++ ++L + H+ LG +G  
Sbjct: 200 SAVGNIEHARVLQLIANAFERLPTTAIAIDGQPPRKTTSVLVRNKELEQSHVCLGTHGYQ 259

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
               D + + +L ++LG  MSSRLFQ VREKRGL Y++ +    + D G L I +  A E
Sbjct: 260 QDHEDRFASYVLNTVLGGSMSSRLFQNVREKRGLAYAVFSGLVAYRDTGSLTIYAGCANE 319

Query: 307 NIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
            +  L   +V  ++ +    +   E+ +    +   L+   E +  R   +++Q ++   
Sbjct: 320 AVGELIDVVVAELRRMRIEPLSDAELTRARDHLKGSLMLGLESTSSRMSNLARQEIYFER 379

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHV 408
               ++ +  I  +T +D+  VA  + ++    A +   ++ +
Sbjct: 380 QFGLDETLAGIGRVTRDDVQRVAADLLANDALSATVLGAVNGL 422


>gi|288556934|ref|YP_003428869.1| processing protease [Bacillus pseudofirmus OF4]
 gi|288548094|gb|ADC51977.1| processing protease [Bacillus pseudofirmus OF4]
          Length = 413

 Score =  195 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 122/401 (30%), Positives = 222/401 (55%), Gaps = 3/401 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++  +  +G+ ++ E +P + S  + V I  GSR E   E+G++HFLEHM FKGT KR+A
Sbjct: 2   IQKIELDNGVRIMAEAIPTVRSVSIGVWIGTGSRYEEVHENGISHFLEHMFFKGTKKRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E  +K+GG +NA+TS E+T Y+A VL EH P+A++++ DM  NS F   ++++ERN
Sbjct: 62  ADIAEAFDKIGGQVNAFTSKEYTCYYAKVLDEHAPIAVDVLSDMFFNSEFEAKELQKERN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +D   D +    S+  + +  +G PILG  +T+ +F  + + S++ R YT 
Sbjct: 122 VVLEEIKMVDDTPDDIVHDLLSKAAYGEHSLGYPILGTQDTLKTFDEKALRSYMDRYYTG 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G +  +  +  ++  F        +       +      +K++  + H+ L 
Sbjct: 182 DHVVISIAGNIT-DEVIQSIKDIFKEVKPTTYQYEASAPRFQSELITRKKETEQAHLCLA 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G    ++D Y   +L ++LG  MSSRLFQE+REKRGLCYS+ ++H ++ D+G+L + +
Sbjct: 241 YPGLEIGNKDVYSLILLNNLLGGSMSSRLFQEIREKRGLCYSVFSYHSSYQDSGMLTVYA 300

Query: 302 ATAKENIMA-LTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            TA E +   + +      +     + ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTALEQLDELVVALNQTTSRLCEAGMNEKELQNGKEQLKGSLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAIL 401
           +        + I+  I+ +T E++  +A+ + S+ P ++++
Sbjct: 361 LMLKRHRTLDDILAEINNVTLENVNRLAQTLLSTEPAISLI 401


>gi|156083615|ref|XP_001609291.1| mitochondrial processing peptidase beta subunit [Babesia bovis
           T2Bo]
 gi|154796542|gb|EDO05723.1| mitochondrial processing peptidase beta subunit [Babesia bovis]
          Length = 514

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 107/447 (23%), Positives = 189/447 (42%), Gaps = 28/447 (6%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            I+   +G+ V +  MP +S  V V I +GSR E +E +G AHFLEHM+FKGT  R+  E
Sbjct: 67  EITTLKNGLRVASVWMPGNSTTVGVWIDSGSRFETKETNGAAHFLEHMIFKGTKNRSRLE 126

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + EEIE+ G  +NAYT+ E T Y+A    + VP   E++ D+L NS   PS +E E++V+
Sbjct: 127 LEEEIEQKGAHLNAYTAREQTGYYARCFNKDVPWCTELLSDILQNSLIEPSQMEAEKHVI 186

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E  + + +  R     ++D  +G  ILG  E I +   E ++ ++ +NYTADR
Sbjct: 187 LREMEEVEKSTEEVIFDRLHMTAFRDSSLGFTILGPVENIQNMKREYLVDYIQKNYTADR 246

Query: 184 MYVVCVGAVDHEFC------------VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKR 231
           M   CVG V+H+                              K  ++   +VG E + + 
Sbjct: 247 MVFCCVGNVEHDKVVELAEKHLCTVSQCCATPMTQQIPQGTGKVQLEKPYFVGSELLNRN 306

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSR----------------LFQEVR 275
           D    H  L          +      +      G   +                     R
Sbjct: 307 DDMGPHAYLAVAFEGVSWTNPDSVCFMLMQSIIGSYKKNQEGIVPGKVSGNKTVHAIANR 366

Query: 276 EKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKEC 335
              G   + SA +  + D G+    +   +  +      ++  V S+  +I   E+++  
Sbjct: 367 MTVGCAEAFSAFNTCYKDTGLFGFYAQCDEVAVDHCVGELMFGVTSMSYSITDEEVERAK 426

Query: 336 AKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST 395
            ++  + +   + +   A E+++Q++  G  +   + +  +  I  E++  VA K     
Sbjct: 427 RQLMLQFLSMNDSTSTVAEEVARQIIVYGRRMPVTEFLLRLEQIDAEEVKRVAWKYLHDH 486

Query: 396 PTLAILGPPMDHVPTTSELIHALEGFR 422
                   P+  +P+  ++       R
Sbjct: 487 EVAVTAMGPLHGMPSLIDIRQKTYWLR 513


>gi|42523059|ref|NP_968439.1| zinc proteinase [Bdellovibrio bacteriovorus HD100]
 gi|39575264|emb|CAE79432.1| probable zinc proteinase [Bdellovibrio bacteriovorus HD100]
          Length = 422

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 113/413 (27%), Positives = 220/413 (53%), Gaps = 5/413 (1%)

Query: 1   MN--LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTT 57
           MN   + S+ S+GI V++E+ P   +  + + +  G+R+E  +  G++H LEH++FKGT 
Sbjct: 1   MNTKFKKSELSNGIRVVSELHPGSRAVSMGIWVLTGTRDETPDVAGISHLLEHLVFKGTK 60

Query: 58  KRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIE 117
            R+A +I + +E +GG++NAYT+ E+T YHA VLK+H   AL+++ D++SN      + +
Sbjct: 61  TRSAYQIAKSLEALGGELNAYTTREYTCYHALVLKDHWEKALDVLADLVSNMKLTQKEFD 120

Query: 118 RERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSR 177
            E+ V+L+EI MSED   D +   F E V+    +GRPILG P +++     +++++  +
Sbjct: 121 LEKGVILQEIAMSEDSHEDMVYDVFYEQVYGAHPLGRPILGTPVSVARMKQTQVMNYYKK 180

Query: 178 NYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
            YT   + V   G +DH+  ++ ++        +++K + +   ++   ++ ++   + H
Sbjct: 181 TYTGKNIIVSASGCIDHDDLMAGIQKRLGAKKKSELKNTRRVPRWLNRRHVVEKQAEQVH 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           M+LG    ++Q +  +   +  ++LG GM+S+L+Q VREKRGL YSI +      D+G+L
Sbjct: 241 MLLGLPTASFQDKHRFEAVVTNTLLGGGMTSKLYQSVREKRGLVYSIHSSLNTNIDSGML 300

Query: 298 YIASATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I + T  +N   +      E  +     + + +++    ++   ++   +    R   +
Sbjct: 301 TIYAGTEAKNARKVGDLISKEFAKIRKAGVTKADVEMCKTQVIGSILLGSDDIENRMTSL 360

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHV 408
           +   M  G     E +ID I A+T + +    + +         +LGP +  +
Sbjct: 361 AVNEMVFGRYRAVESVIDEIKAVTVDSVNEYIRNVLDLDKAAGVLLGPEVTKL 413


>gi|308173634|ref|YP_003920339.1| specific processing protease [Bacillus amyloliquefaciens DSM 7]
 gi|307606498|emb|CBI42869.1| specific processing protease [Bacillus amyloliquefaciens DSM 7]
 gi|328553434|gb|AEB23926.1| specific processing protease [Bacillus amyloliquefaciens TA208]
 gi|328911774|gb|AEB63370.1| specific processing protease [Bacillus amyloliquefaciens LL3]
          Length = 411

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 128/403 (31%), Positives = 223/403 (55%), Gaps = 3/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E  P + S  + V I  GSR+E  + +G++HFLEHM FKGT  R+A
Sbjct: 2   IKRYTCQNGVRVVLENNPTVRSVAIGVWIGTGSRHETPDTNGISHFLEHMFFKGTNTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+  ++++E+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSAFDEDELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  ET+S+F  + +   +   YT 
Sbjct: 122 VVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLSAFNGDSLRQHMDNFYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G V  E  +  VE +F           +    +   +  +K+D  + H+ LG
Sbjct: 182 DRVVISVAGNVT-EQFIKDVEKWFGTYEAKGKASGISQPEFHYEKLTRKKDTEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I  
Sbjct: 241 FKGLKVGDPDIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L+ +I E +     + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGANQLGLLSETIQETLSVLKRDGITPKELENSKEQMKGSLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  G     ++II  ++A++ E + G+++++F+    L+++ P
Sbjct: 361 LLLGKHKTMDEIIAELNAVSLESVNGLSRRLFTDDYALSLISP 403


>gi|302688141|ref|XP_003033750.1| mitochondrial processing peptidase beta subunit [Schizophyllum
           commune H4-8]
 gi|300107445|gb|EFI98847.1| mitochondrial processing peptidase beta subunit [Schizophyllum
           commune H4-8]
          Length = 471

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 109/435 (25%), Positives = 200/435 (45%), Gaps = 18/435 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            ++  S+G+TV TE  P   +A V + I AGSR E ++ +G AHFLEH+ FKGT  RT +
Sbjct: 36  EVTTLSNGLTVATEAQPHAQTATVGMWIDAGSRAETEKNNGTAHFLEHLAFKGTNSRTQQ 95

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +  E+E +G  +NAYTS E T Y+A   ++ VP A++II D+L NS    S IERER+V
Sbjct: 96  ALELEVENLGAHLNAYTSREQTVYYAKSFRKDVPTAVDIISDILQNSKLEASAIERERDV 155

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           ++ E    +    + +      + ++ Q +GR ILG    I S   + + S++ +NYTAD
Sbjct: 156 IIREQQEVDKQLEEVVFDHLHAVAFQGQALGRTILGPKANILSLKRDDLSSYIQKNYTAD 215

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKR----------- 231
           RM +V  G VDH   V   E +F+   ++K    +    +   +++              
Sbjct: 216 RMVLVGAGGVDHSELVKLAEKHFSTLPISKNPIPLGRLAHPKADFVGSEVRLRDDTLGTA 275

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
           ++A     +G++   Y       + I       G +  L   +          ++     
Sbjct: 276 NIAIAVEGVGWSSPDYFPMMVMQSIIGNWDRSLGAAPLLSSRLSHIVSANNLANSFMSFS 335

Query: 292 SDNGVLYIASAT----AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
           +      +           N+  L    ++    +     + E+++  +++ A L+   +
Sbjct: 336 TSYSDTGLWGIYLVSENTTNLDDLVHFTLKEWTRMSMAPTEVEVERAKSQLKAGLLLGLD 395

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMD 406
            +   A +I +Q++  G  +  E+I + ++A+T ++I  VA+K        LA +G  ++
Sbjct: 396 GTTAVAEDIGRQLVTSGRRMTPEQIENAVNAVTVDEIKRVAQKYLWDQDFALAAIG-NIE 454

Query: 407 HVPTTSELIHALEGF 421
            +   S +   +   
Sbjct: 455 GLLDYSRIRADMSSM 469


>gi|111225111|ref|YP_715905.1| putative zinc protease [Frankia alni ACN14a]
 gi|111152643|emb|CAJ64384.1| putative zinc protease [Frankia alni ACN14a]
          Length = 470

 Score =  195 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 132/412 (32%), Positives = 212/412 (51%), Gaps = 7/412 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ VITE +P   SA + V +  GSR+E     G +H+LEH+LFKGT  R A
Sbjct: 51  VRRTVLPGGLRVITERVPGVRSAAIGVWVGVGSRDETPVTAGCSHYLEHLLFKGTPTRDA 110

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I   +E VGGD+NA+T  E+T Y+A VL   + +A+ ++ DM++NS     D+E ER 
Sbjct: 111 LTISASVEAVGGDLNAFTGKEYTCYYARVLDSDLAMAVGVVADMVTNSLVTADDVEAERG 170

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M EDD  D +   F+E +     +GRP+LG  E+I     E I  +    Y  
Sbjct: 171 VILEEIAMHEDDPGDVVHDVFAEAMLGASALGRPVLGTIESIEGLGRETIADYYRSRYVP 230

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
             M V   G ++H+  ++ V   F          + ++          G  + +R   + 
Sbjct: 231 PAMVVSVAGNLEHDRVLALVADAFGDHLTSAGDPSAVRAGRYDYPPAPGIVVSERPTEQA 290

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           +++LG  G +      +   +L++ LG GMSSRLFQEVREKRGL YS+ +   +F+D G+
Sbjct: 291 NLVLGTVGVSRHDPRRFALGVLSTALGGGMSSRLFQEVREKRGLAYSVYSFASHFADAGL 350

Query: 297 LYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             + +  A +    + +   + V+S+    I   E+D+   + H  L+   E +  R   
Sbjct: 351 FGVYAGCAPKRADEVLAIARDQVRSIAERGISAEELDRARGQSHGSLVLGLEDTGSRMSR 410

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDH 407
           + K  +  G +L  ++II  + A+T +D+  VA  +      L ++GP  DH
Sbjct: 411 LGKSELVHGELLSVDEIIARVDAVTLDDVRQVAASLVEQPWALGVIGPFDDH 462


>gi|183981939|ref|YP_001850230.1| zinc protease PepR [Mycobacterium marinum M]
 gi|183175265|gb|ACC40375.1| zinc protease PepR [Mycobacterium marinum M]
          Length = 438

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 134/424 (31%), Positives = 213/424 (50%), Gaps = 7/424 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 15  LRRTTLPGGLRVVTEYLPAVRSASVGVWVGVGSRDEGTTVAGAAHFLEHLLFKSTPTRTA 74

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA+E++ D++ N      D+E ER+
Sbjct: 75  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDNDLELAVELVADVVLNGRCAADDVELERD 134

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  +++S+ T  ++ SF  R YT 
Sbjct: 135 VVLEEIAMRDDDPEDALADMFLTAMYGDHPVGRPVIGSTQSVSAMTRAQLHSFHMRRYTP 194

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNV-----CSVAKIKESMKPAVYVGGEYIQKRDLAEE 236
           DRM V   G VDH   V  V  +F             ++            +  R+  + 
Sbjct: 195 DRMVVAVAGNVDHNQVVGLVREHFGPRLVRGRRPVAPRKGTGRVNGTPQLVLADREAEQT 254

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G 
Sbjct: 255 HVSLGVRTPGRGWEHRWALSVLHTALGGGLSSRLFQEIRESRGLAYSVYSALDIFADSGA 314

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L + +A   E    +     EV++++    I + E       +   L+   E S  R   
Sbjct: 315 LSVYAACLPERFAEVMRVTREVLEAVARDGITESECRIAKGSLRGGLVLGLEDSSSRMSR 374

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELI 415
           I +  +  G     E  +  I  +T +++  +A+++       A+LGP         +L 
Sbjct: 375 IGRSELNYGKHRTIEHTLQQIDRVTVDEVNALARRLLVKRYGAAVLGPYTSKRQLPQQLR 434

Query: 416 HALE 419
             + 
Sbjct: 435 AMVN 438


>gi|210622621|ref|ZP_03293281.1| hypothetical protein CLOHIR_01229 [Clostridium hiranonis DSM 13275]
 gi|210154122|gb|EEA85128.1| hypothetical protein CLOHIR_01229 [Clostridium hiranonis DSM 13275]
          Length = 414

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 124/411 (30%), Positives = 211/411 (51%), Gaps = 5/411 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +  K  +G+T+I E +P   S  + +  RAG + E     G++HF+EHM+FKGT  RT+
Sbjct: 2   YKTKKLKNGLTIIAEEIPYFKSISMGIWFRAGIKTEENYIDGVSHFIEHMMFKGTKNRTS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K++V EIE +GG INA+T  E T Y+  +L EH+ + ++I+ DM+ NS F+  DIERE++
Sbjct: 62  KQLVAEIENLGGVINAFTGRECTCYYVRLLDEHLNIGIDILSDMILNSKFDEKDIEREKS 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+ EE+ M ED   D       E V+ ++ IG+ ILG  E+I S   E I+ +  + Y  
Sbjct: 122 VITEELKMYEDSPEDLTYDILLEKVYDNKGIGKNILGSKESIKSMNREAILDYFEKFYVP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           +   +   G  D +  V  +E  F      K   +++  ++      + RD  + ++ + 
Sbjct: 182 ENAVLSICGNFDFDETVKLIEDKFANWHGEKPNYNLQDEIFNPCVVKKDRDYEQTNLAIC 241

Query: 242 FNGCAY--QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           F        S D Y  +I+ ++LG   +SRLFQ +RE  GL YSI +  E + D G L I
Sbjct: 242 FECENIGSSSNDVYTIDIINNVLGGSSTSRLFQRIREDEGLVYSIYSEQEFYRDKGELGI 301

Query: 300 ASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            ++ + EN+  +   I E +       I + E+     ++  + +   E +  R   I K
Sbjct: 302 YASMSTENLEDVYRLIKEEIVSLNENGITEEELKNSKEQLKGEFMLGMESTESRMSAIGK 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHV 408
            ++  G +   E +I+ +++IT EDI  V K +       + ++G  +  +
Sbjct: 362 YMLITGKVETLEDVIEGLNSITMEDINRVIKDVLDIDKMGVCVVGKGVSEI 412


>gi|327441004|dbj|BAK17369.1| predicted Zn-dependent peptidase [Solibacillus silvestris StLB046]
          Length = 408

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 134/407 (32%), Positives = 222/407 (54%), Gaps = 3/407 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++    +G+ ++TE MP + S  V + + AGSR E +EE+G+ HF+EHMLFKGT  R A
Sbjct: 2   VQVITAKNGVRIVTEQMPHVRSLSVGIWVNAGSRYETKEENGITHFIEHMLFKGTKNRIA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE +++GG+INA+TS EHT Y+A VL  H  LA++I+ DM  NS F   DIE+ER 
Sbjct: 62  RQIAEEFDRIGGEINAFTSKEHTCYYAKVLDHHGELAIDILADMFFNSLFAQEDIEKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY-T 180
           VVLEEI MSEDD  D +  +   +++ D  +GRPILG PET+++F  E I ++++++Y  
Sbjct: 122 VVLEEIYMSEDDPADDVHEKLWGVMFPDDALGRPILGTPETLATFDEEMIRTYMAKHYGP 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            + +  +     +      +        S   I        +  GE  + RD  + H+ +
Sbjct: 182 QNVVISIAGNIEESLLEKVEALFGNYEASAKSIVSKPSYPTFTPGEIEKLRDTEQAHIAI 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            F   A +    Y    L +I+G  MSSRLFQEVRE RGL YS+ ++  ++ D G   I 
Sbjct: 242 SFPAIAVKDPKMYSFIALNNIIGGNMSSRLFQEVREDRGLAYSVFSYQSSYEDVGTFTIY 301

Query: 301 SATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++ +K+N+ +L   I + +   +   + + E++    ++    +   E +          
Sbjct: 302 ASASKQNLDSLKQQIDQTLFDLVAGGVTETELENAKEQLKGGFVLGLEGTEDFMNRNGVN 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
            +   +    ++++  I AI+ E I  +  +I  S P +AI+GP  +
Sbjct: 362 ELIHQNHRSVDEVLAKIDAISMETIDELITQILLSEPAIAIIGPENE 408


>gi|110740617|dbj|BAE98412.1| putative mitochondrial processing peptidase [Arabidopsis thaliana]
          Length = 462

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 116/429 (27%), Positives = 201/429 (46%), Gaps = 16/429 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ V TE      +A V V I AGSR    E +G AHFLEHM+FKGT +RT +
Sbjct: 29  RVTTLPNGLRVATESNLSAKTATVGVWIDAGSRFGSDETNGTAHFLEHMIFKGTDRRTVR 88

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            + EEIE +GG +NAYTS E T+Y+A VL  +V  AL+++ D+L NS F    I RER+V
Sbjct: 89  ALEEEIEDIGGHLNAYTSREQTTYYAKVLDSNVNQALDVLADILQNSKFEEQRINRERDV 148

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E  + + +        ++   +GR ILG  + + S T E + +++  +YTA 
Sbjct: 149 ILREMQEVEGQTDEVVLDHLHATAFQYTPLGRTILGPAQNVKSITREDLQNYIKTHYTAS 208

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM-----KPAVYVGGEYIQKRDLAEEH 237
           RM +   GAV HE  V QV+  F   S      S        +       +   DL    
Sbjct: 209 RMVIAAAGAVKHEEVVEQVKKLFTKLSSDPTTTSQLVANEPASFTGSEVRMIDDDLPLAQ 268

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHE 289
             + F G ++   D     ++ ++LG    +    +              +  SI A + 
Sbjct: 269 FAVAFEGASWTDPDSVALMVMQTMLGSWNKNVGGGKHVGSDLTQRVAINEIAESIMAFNT 328

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L+ +I+  V  L   +   ++ +   ++ + L+   + +
Sbjct: 329 NYKDTGLFGVYAVAKADCLDDLSYAIMYEVTKLAYRVSDADVTRARNQLKSSLLLHMDGT 388

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
              A +I +Q++  G  + + ++   I A+    +  VA K        ++ +GP  D +
Sbjct: 389 SPIAEDIGRQLLTYGRRIPTAELFARIDAVDASTVKRVANKYIYDKDIAISAIGPIQD-L 447

Query: 409 PTTSELIHA 417
           P  ++    
Sbjct: 448 PDYNKFRRR 456


>gi|116669996|ref|YP_830929.1| peptidase M16 domain-containing protein [Arthrobacter sp. FB24]
 gi|116610105|gb|ABK02829.1| peptidase M16 domain protein [Arthrobacter sp. FB24]
          Length = 447

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 121/412 (29%), Positives = 204/412 (49%), Gaps = 11/412 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA +   +  GSR+E   +HG  HFLEH+LFKGT +RTA
Sbjct: 27  VRRSVLPGGVRVLTEAMPGQRSATIGFWVGVGSRDEAHGQHGSTHFLEHLLFKGTKRRTA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    ++VGG+ NA T+ E T Y A VL   +P+A+++I DM++ +  +P ++E+ER+
Sbjct: 87  LEIASAFDEVGGESNAATAKESTCYFARVLDTDLPMAIDVIADMITGAVLDPQEMEQERD 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEI M  DD  D     F   V     +GRPI G PE I +   + +     R Y  
Sbjct: 147 VILEEIAMDSDDPTDVAHEHFVAAVLGTHPLGRPIGGTPEAIRAVARDSVWDHYRRYYRP 206

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---------YIQKRD 232
           D + +   G +DH+     V    +    A    +                   ++ KR 
Sbjct: 207 DELVITAAGGLDHDVVCGLVVDALHQAGWALEPGAAPVERRSTERADITGTAGLHVVKRP 266

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           + + ++++G           Y+ ++L ++LG GMSSRLFQEVREKRGL YS  +   +++
Sbjct: 267 VEQANIIMGCPTIVATDGRRYVMSVLNAVLGGGMSSRLFQEVREKRGLVYSTYSFASSYA 326

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +      +  +   +   +  L    I   E+ K   ++   ++ + E +  
Sbjct: 327 DAGYFGMYAGCTPSKVRQVVELLGAELDKLAEHGISGDELRKAVGQLCGGIVLALEDTGS 386

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   + +  +  G     E+ +  I ++T E +  +A ++ ++  T+ ++GP
Sbjct: 387 RMSRLGRAELVSGEYQDIEETLRQIKSVTVEQVRELALELAAAPRTVTVVGP 438


>gi|299534732|ref|ZP_07048062.1| zinc protease [Lysinibacillus fusiformis ZC1]
 gi|298729820|gb|EFI70365.1| zinc protease [Lysinibacillus fusiformis ZC1]
          Length = 407

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 120/404 (29%), Positives = 218/404 (53%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++    +G+ +++E    + S  + + + AGSR E  EE+G+ HF+EHMLFKGTT R+A
Sbjct: 2   VQVHTCQNGVRIVSEQIDHVRSVALGIFVNAGSRYELPEENGITHFIEHMLFKGTTTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE +++GG++NA+TS E+T Y+A VL  H  LA+ I+ DM  NS+F   ++E+ER 
Sbjct: 62  RQIAEEFDRIGGELNAFTSKENTCYYAKVLDHHAELAVTILADMFFNSTFAEEELEKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI MSED   D +  +   +++ +  +GRPILG   T+ +FT   I  ++ ++Y  
Sbjct: 122 VVLEEILMSEDAPDDDVHEKLWGVMYPNDALGRPILGTAATLKTFTAAAIRQYMDKHYGP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-YVGGEYIQKRDLAEEHMML 240
           + + +   G +  +   +  + + +          +     +  GE  + RD  + H+ +
Sbjct: 182 ESVVISIAGNISSQLMQTIEDLFGHYQPSPHAMAPVLTNPSFYPGEITKIRDTEQAHVAI 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            +     +  D Y    L +I+G  MSSRLFQEVRE+RGL YSI ++   ++D G   I 
Sbjct: 242 SYPAIGVKDPDMYSFIALNNIIGGNMSSRLFQEVREERGLAYSIFSYQSCYADVGAFTIY 301

Query: 301 SATAKENIMALTSSIVEV-VQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +T+++ +  L  +I    +  +   + + E+D    ++    +   E +  R       
Sbjct: 302 GSTSRQQLAQLQHTIDATLLDIVAGGVTEEELDNAKEQLKGSFVLGLEGTGARMNRNGTS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +        ++++ +I A++ E +  +  KI  + P ++I+GP
Sbjct: 362 ELVHRKHRTVDEVLKSIDAVSMESVDRLIAKILKAEPAISIIGP 405


>gi|119603733|gb|EAW83327.1| peptidase (mitochondrial processing) beta, isoform CRA_c [Homo
           sapiens]
 gi|123988485|gb|ABM83839.1| peptidase (mitochondrial processing) beta [synthetic construct]
 gi|123999160|gb|ABM87161.1| peptidase (mitochondrial processing) beta [synthetic construct]
          Length = 490

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 94/413 (22%), Positives = 187/413 (45%), Gaps = 12/413 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   SG+ V +E   + +  V + I AGSR E ++ +G AHFLEHM FKGT KR+  +
Sbjct: 59  RVTCLESGLRVASEDSGLSTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLD 118

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 119 LELEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVI 178

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        +++  +GR ILG  E I S + + ++ +++ +Y   R
Sbjct: 179 LREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPR 238

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V H+  +   + +F         +I              ++   +   H+ +
Sbjct: 239 IVLAAAGGVSHDELLDLAKFHFGDSLCTHKGEIPALPPCKFTGSEIRVRDDKMPLAHLAI 298

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENFS 292
                 +   D     +  +++G+   S                   LC+S  + + +++
Sbjct: 299 AVEAVGWAHPDTICLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYT 358

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +        +  +   + +    L  ++ + E+ +    +   ++   + S   
Sbjct: 359 DTGLWGLYMVCESSTVADMLHVVQKEWMRLCTSVTESEVARARNLLKTNMLLQLDGSTPI 418

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPP 404
             +I +Q++     +   ++   I A+  E I  V  K   + +P +A +G P
Sbjct: 419 CEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGKP 471


>gi|126652560|ref|ZP_01724725.1| zinc protease [Bacillus sp. B14905]
 gi|126590688|gb|EAZ84804.1| zinc protease [Bacillus sp. B14905]
          Length = 407

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 120/404 (29%), Positives = 219/404 (54%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +++    +G+ +++E    + S  + + + AGSR E  EE+G+ HF+EHMLFKGT  R+A
Sbjct: 2   VQVHTCQNGVRIVSEQINHVRSVALGIFVNAGSRYELPEENGITHFIEHMLFKGTPSRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I EE +++GG++NA+TS E+T Y+A VL  H  LA+ I+ DM  NS+F   ++E+ER 
Sbjct: 62  RQIAEEFDRIGGELNAFTSKENTCYYAKVLDHHAELAVSILADMFFNSTFAEEELEKERQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI MSED   D +  +   +++ +  +GRPILG   T+ +FT E I  +++++Y  
Sbjct: 122 VVLEEILMSEDAPDDDVHEKLWSVMYPNDALGRPILGSAATLKTFTAEAIRHYMAKHYGP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVA-KIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + + +   G +  +   +  + +         I   +    +  GE  + RD  + H+ +
Sbjct: 182 ESVVISIAGNISPQLMATIEQLFGQYQPSTVAIAPVLTNPSFHPGEISKIRDTEQAHLAI 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
            +     +  D Y    L +I+G  MSSRLFQEVRE+RGL YSI ++   ++D G   I 
Sbjct: 242 SYPAIGVKDPDMYSFIALNNIIGGNMSSRLFQEVREERGLAYSIFSYQSCYADVGAFTIY 301

Query: 301 SATAKENIMALTSSIVEV-VQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            +T+++ +  L  +I    +  +   + + E+D    ++    +   E +  R       
Sbjct: 302 GSTSRQQLSQLQHTIDATLLDIVAGGVTEEELDNAKEQLKGSFVLGLEGTGARMNRNGTS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            +        ++++ +I A++ + +  +  KI  + P ++I+GP
Sbjct: 362 ELVHRKHRTVDEVLASIEAVSMDSVDRLIAKILKAEPAISIIGP 405


>gi|164688509|ref|ZP_02212537.1| hypothetical protein CLOBAR_02154 [Clostridium bartlettii DSM
           16795]
 gi|164602922|gb|EDQ96387.1| hypothetical protein CLOBAR_02154 [Clostridium bartlettii DSM
           16795]
          Length = 413

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 111/410 (27%), Positives = 220/410 (53%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G+T+I E +P + S  + + ++AGS  E +E  G++HF+EHMLFKGT  R++
Sbjct: 2   YKCQTLENGLTIIGEEIPYLKSISLGIWVKAGSIIETKENSGVSHFIEHMLFKGTKNRSS 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           KE+  EI+ +GG +NA+TS E T ++  +L EH+ + +E++ DM+ NS F+  DIE+E++
Sbjct: 62  KELAREIDNLGGILNAFTSKECTCFYVKLLDEHIDIGIEVLSDMILNSCFDKKDIEKEKS 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M ED   D       E ++KD  +G  ILG   T+ +F  E I+ + ++ Y  
Sbjct: 122 VILEELKMYEDSPDDLSYDLLLENIYKDHSLGMNILGDRNTLKNFKRENILDYYNKYYVP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH-MML 240
           +   +   G  + E  V +++  F      +   +     +      + +D+ + +  + 
Sbjct: 182 NNSVISICGNFNFEEIVEKIKDKFKTWEAKEASINTTEPKFNPCIIKKNKDIEQVNLAIN 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
                    R+ Y  +++ ++ G  +SSRLFQ++RE++GL YSI +    + + G L I 
Sbjct: 242 LKAIPMINDREVYALSVVNNVFGGSISSRLFQKIREEKGLVYSIYSSQTLYQECGELGIF 301

Query: 301 SATAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           ++T+ EN+  +   I++ +  +       +EI +   ++    +  +E +  R +   K 
Sbjct: 302 ASTSNENVEEVYKLILDEIDLIRNEYISLQEIHESKEQLKGSYMLDRESTSSRMMSNGKN 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGPPMDHV 408
           ++    +   + IID I+ +  +D+V + +K+F+     + I+G  ++++
Sbjct: 362 LLMRNKVDDEQDIIDYINNVEYQDVVEIIEKVFNKENIGVCIVGKDVENI 411


>gi|320167416|gb|EFW44315.1| peptidase beta [Capsaspora owczarzaki ATCC 30864]
          Length = 470

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 102/428 (23%), Positives = 187/428 (43%), Gaps = 10/428 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +I+   +G+ V +E     SA V + I  GSR E ++ +G+AHFLEHM FKGT +RT + 
Sbjct: 43  KITTLKNGLRVASENTGHLSATVGLWIDTGSRFETEQNNGVAHFLEHMFFKGTKRRTQQG 102

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T Y+A VL  +V  A++++ D+L NS F+   I  ER+V+
Sbjct: 103 LEAEVESIGASLNAYTSREQTVYYAKVLNNNVNDAVDLLADILQNSKFDADAINAERDVI 162

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+    +   + L      + ++   +GR ILG  E I   + + I  +V ++YTA R
Sbjct: 163 LREMQEVSNQREEVLYDHLHSVAYQGYPLGRTILGPTENILKLSRDDITDYVRKHYTAPR 222

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM---- 239
           + +   G +DH+  V Q E  F   S     +      + G +   + D  +   +    
Sbjct: 223 IVLAAAGGIDHDVLVKQAEKQFGDLSSTASNDRSFANRFTGADVRDRNDDIDVGHIALAI 282

Query: 240 ----LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
                             +      ++     +    +      L  S  A +  + D  
Sbjct: 283 EGVGWAHADFIPLLVASTMIGNWNRLIPGKNLASKLTQRVVAENLANSYQAFNTAYKDTA 342

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           +  +     ++ +  +T  +   +  L  +  + E+ +    +   L  + + + L A E
Sbjct: 343 LWGVQFVAPRDKVEDMTFEVQAELMRLCTSATEAEVARAKNLLRTSLFLNLDGTTLIAEE 402

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTTSEL 414
           I + V+  G  +   +I   I A+    I  V  K  +   P +A +G  ++ +P  + +
Sbjct: 403 IGRHVLNFGRRIPIAEINARIEAVNASVIREVLNKYVYDKCPAVAGIG-AIEGLPDYNRI 461

Query: 415 IHALEGFR 422
              +   R
Sbjct: 462 RGGMSWLR 469


>gi|58584481|ref|YP_198054.1| Zn-dependent peptidase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58418797|gb|AAW70812.1| Zn-dependent peptidase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 421

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 139/421 (33%), Positives = 235/421 (55%), Gaps = 6/421 (1%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            ++K  +G+ +ITE M  IDS  + + +  GSR E   ++G++HFLEHM FKGT  RTA 
Sbjct: 3   EVTKLDNGLRIITEQMRDIDSVALNIRVGVGSRAESANQNGISHFLEHMAFKGTKTRTAF 62

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI +  + +GG  NA T  E TSY+A VLK+ V + ++I+ D+L NS+F   ++ERE+ V
Sbjct: 63  EIAKTFDDIGGVFNASTGRERTSYYAKVLKKDVKIGIDILIDILMNSTFPKDELEREKGV 122

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           V++EI    D   D +  ++ E  +KDQ  GR ILG  +T+ SF    + ++++ +Y  +
Sbjct: 123 VIQEIFQINDSPSDIIFDKYFEAAYKDQPFGRSILGTQDTVKSFAQGDLNNYINEHYFGE 182

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
            +     G V+HE      + + +  S  K+KES       GGEY++ R L + H+++GF
Sbjct: 183 NIIFAVAGNVEHEEIAQLTKDFLSKVSSQKLKESQNANC-TGGEYLEHRKLDQVHLLIGF 241

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASA 302
              +     ++   +L SILG GMSSRLFQEVREK+GL YS+ + + +++D G+L I + 
Sbjct: 242 PSVSCHDDRYHTFQVLDSILGSGMSSRLFQEVREKQGLAYSVYSFNSSYTDTGMLSIFAG 301

Query: 303 TAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEISKQVM 361
           T   N+  L  SI   ++ L  N   + E+++   +I ++++ S+E     A  +     
Sbjct: 302 TDSSNLDKLLKSITTELKKLSTNDLREEEVNRVKERIKSQILMSRESVSSCAEALEHYYG 361

Query: 362 FCGSILCSEKIIDTISAITCEDIVGVAKKIFSS--TPTLAILGPPMDHVPTTSELIHALE 419
                +  +++I+  SA+T  D+    +++ S     TLA +G  +  +P   +++  L 
Sbjct: 362 NYNRYISKDELIEKTSAVTTADVKRAVEELLSKHEKTTLAAIG-EIKSLPGYDKVVSMLR 420

Query: 420 G 420
            
Sbjct: 421 A 421


>gi|89101183|ref|ZP_01174014.1| zinc protease [Bacillus sp. NRRL B-14911]
 gi|89084092|gb|EAR63262.1| zinc protease [Bacillus sp. NRRL B-14911]
          Length = 396

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 126/395 (31%), Positives = 214/395 (54%), Gaps = 3/395 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E +P + S  + V I  GSRNE    +G++HFLEHM FKGT  RTA
Sbjct: 2   IKKYTCQNGVRVVLENIPTVRSVAIGVWIGTGSRNEHPGNNGVSHFLEHMFFKGTKTRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  + +GG +NA+TS E+T Y+A VL  H   AL+++ DM  NS+F   ++ +E+N
Sbjct: 62  REIAESFDSIGGQVNAFTSKEYTCYYAKVLDTHSKFALDVLADMFFNSTFVDEELNKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M ED   D +     + +++   +G PILG  ET+ +F  + +  ++   YT 
Sbjct: 122 VVLEEIKMYEDTPDDIVHDLLGKAIYESHPLGYPILGTEETLETFKGDTLREYMHETYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           + + +   G +  +  + +VE  F      K + + +  V+      +K++  + H+ LG
Sbjct: 182 ENVVISIAGNIS-DSFIQEVEKLFGSYEAGKQERNQEKPVFHSNRVSRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           + G     +D Y   +L +ILG  MSSRLFQ+VRE+RGL YS+ ++H +F D G++ I  
Sbjct: 241 YEGLPVGHKDMYSLILLNNILGGSMSSRLFQDVREQRGLAYSVFSYHSSFQDTGMVTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T  + +  L  +I E + +   + I ++E+     ++   L+ S E +  R     K  
Sbjct: 301 GTGAKQLDVLFETIQETLATLKRDGITEKELKNSKEQMKGSLMLSLESTNSRMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST 395
           +  G     ++I++ I  ++   +  +A  IFS  
Sbjct: 361 LLLGRHRSLDEIVEQIDKVSEAGVNEMANSIFSDQ 395


>gi|159043696|ref|YP_001532490.1| processing peptidase [Dinoroseobacter shibae DFL 12]
 gi|157911456|gb|ABV92889.1| processing peptidase [Dinoroseobacter shibae DFL 12]
          Length = 426

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 140/385 (36%), Positives = 212/385 (55%), Gaps = 2/385 (0%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             ++++ ++G  ++TE MP   SA V + + AG R+ER E++G+AHFLEHM FKGT KR+
Sbjct: 8   QTQLTELANGFRIVTEHMPGLKSAAVGIWVLAGGRHERLEQNGIAHFLEHMAFKGTEKRS 67

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              I E IE VGG INAYTS E T+Y+A VL+  V LA++++ D+L N  F P +IE ER
Sbjct: 68  TLGIAEAIEDVGGYINAYTSREVTAYYARVLEADVGLAVDVLADILRNPVFAPEEIEVER 127

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+EIG + D   D +     E  + DQ +GR ILG  E +  F       FV  +YT
Sbjct: 128 GVILQEIGQALDTPDDVVFDWLQERAFADQPMGRTILGPAERVRGFARNDFFDFVGEHYT 187

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
            + M +   GAVDH+  V+  E  F   +     ++   A +  GE    + L + H  +
Sbjct: 188 PETMILSAAGAVDHDALVALAEKLFGDMARRDRADA-AQARFTCGEARVIKPLEQVHFAM 246

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
              G  Y+    Y   + A+ LG GMSSRLFQEVREKRGLCYSI A    +++ G++ I 
Sbjct: 247 ALPGPGYRDPAVYTAQVYATALGGGMSSRLFQEVREKRGLCYSIFAQSGAYAETGMMTIY 306

Query: 301 SATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
           + T+ + I  L    +  +Q    ++  +E+ +  A++ A L+   E    RA  +++ V
Sbjct: 307 AGTSGDQIAELCEITLREMQRAGNDMSTQEVARARAQMKAGLLMGLESPSSRAERLARLV 366

Query: 361 MFCGSILCSEKIIDTISAITCEDIV 385
                +   ++ I  I A+T  D+ 
Sbjct: 367 GVWNRVPSLDETIARIDAVTTGDVK 391


>gi|258511424|ref|YP_003184858.1| processing peptidase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478150|gb|ACV58469.1| processing peptidase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 421

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 130/409 (31%), Positives = 221/409 (54%), Gaps = 4/409 (0%)

Query: 1   MNLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  R +   +GI V+ E M    S  + + +  GSR E Q E+G++HFLEHM FKGT++ 
Sbjct: 1   MTYR-TTLRNGIRVVGEEMSSIRSVSLGIWVETGSRYEAQSENGISHFLEHMFFKGTSRH 59

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +AKE+    + +GG +NA+T+ E T ++A VL EH  +ALE + +ML++S F P ++E+E
Sbjct: 60  SAKELAHLFDDLGGQVNAFTAKEFTCFYARVLDEHFSIALETLAEMLTDSRFAPEEMEKE 119

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VV+EEI M ED   + +    +  V+ +  +G  ILG+ E +  F+ E ++ +V+R+Y
Sbjct: 120 KRVVIEEIRMYEDTPDELVMDLIARGVYGEHPLGYTILGRDENLLRFSREDLVRYVNRHY 179

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNV-CSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             +RM V   G V  +  + +VE  F      A    ++ P  +      +++D+ + H+
Sbjct: 180 RPERMVVSVAGHVPEDVVIREVERVFGGLTKGADGAPALVPPPFHKTVTTEEKDIEQVHI 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L   G    SR+ Y   +L ++LG   SSRLFQE+RE+RG+ YS+ + H  F D G+  
Sbjct: 240 CLAAPGYPAGSRELYPLLLLNNVLGGTQSSRLFQEIREERGMAYSVYSFHTGFRDAGMFG 299

Query: 299 IASATAKENIMALTSSIVE-VVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I   T+ E    + + + +   +   E I + +++K   ++   L+   E S  R   ++
Sbjct: 300 IYVGTSPETAEEVLALVQQVTARMWQEPISRDQLEKAKRQVKGALMLGLESSGSRMSRLA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           K  +  G  +  E+ +  I A+   DI  VA+ + S    LA +GP  +
Sbjct: 360 KNEILLGREVPLEETLAGIDAVAPADIQRVAEDVLSHGFALAAVGPLAE 408


>gi|224141065|ref|XP_002323895.1| predicted protein [Populus trichocarpa]
 gi|222866897|gb|EEF04028.1| predicted protein [Populus trichocarpa]
          Length = 527

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 114/424 (26%), Positives = 202/424 (47%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+   +G+ V TE      +A V V I AGSR E  E +G AHFLEHM+FKGT KR  +
Sbjct: 94  RITTLPNGLRVATESNLAAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTEKRGVR 153

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           E+ EEIE +GG +NAYTS E T+Y+A V+ + V  AL+I+ D+L NS+F+   I RER+V
Sbjct: 154 ELEEEIENMGGHLNAYTSREQTTYYAKVMDKDVNKALDILADILQNSTFDEGRISRERDV 213

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +  E+   E  + + +        ++   +GR ILG  + I + +   + +++  +YTA 
Sbjct: 214 ITLEMKEVEGQTEEVIFDHLHATAFQYTPLGRTILGPAKNIETISRNDLQNYIQTHYTAP 273

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEH 237
           RM +V  GAV HE  V +V+  F   S      +   +            I   D+    
Sbjct: 274 RMVIVASGAVKHEEFVGEVKKLFTKLSSDPTTAAQLVSKDPAYFTGSEVRIIDDDVPLAQ 333

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHE 289
             + F G ++   D     ++ ++LG    S    +              +  S+ A + 
Sbjct: 334 FAVAFQGASWTDPDSIALMVMQAMLGSWNKSAGGGKHMGSELAQRVGIDEIAESMMAFNT 393

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    +++  L  +I+     L   + + ++ + C ++ + L+   + +
Sbjct: 394 NYKDTGLFGVYAVAKPDSLDDLAWAIMHETSKLCYRVSEADVTRACNQLKSSLLLHIDGT 453

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
              A +I +Q++  G  +   ++   I ++    I  VA +        +A +GP +  +
Sbjct: 454 SPVAEDIGRQLLTYGRRIPYAELFARIDSVDSSTIKRVANRFIHDQDIAIAAMGP-IQGL 512

Query: 409 PTTS 412
           P  +
Sbjct: 513 PDYN 516


>gi|212275227|ref|NP_001130423.1| hypothetical protein LOC100191520 [Zea mays]
 gi|194689082|gb|ACF78625.1| unknown [Zea mays]
 gi|194701074|gb|ACF84621.1| unknown [Zea mays]
 gi|223943317|gb|ACN25742.1| unknown [Zea mays]
          Length = 530

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 115/424 (27%), Positives = 207/424 (48%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R++   +G+ + TE      +A V V I AGSR E +E  G+AHF+EHMLFKGT KR+A 
Sbjct: 97  RVTTLPNGLRIATESSLAARTATVGVWIDAGSRYENEEAVGVAHFVEHMLFKGTGKRSAA 156

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  EIE +GG +NAYTS E T+Y+A VL + VP A+E++ D+L NS+ + + IERER V
Sbjct: 157 QLELEIEDMGGHLNAYTSREQTTYYAKVLDKDVPRAMEVLSDILQNSNLDQARIEREREV 216

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+G  E  S + +        ++   +GRPILG  E + S T E + ++++ +YTA 
Sbjct: 217 ILREMGEVEGQSEEVIFDHLHATAFQYTSLGRPILGSAENVKSITKEDLENYIATHYTAP 276

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   G V HE  V Q +  FN  S      +M  A         +  + ++ M L  
Sbjct: 277 RMVITAAGNVKHEDIVEQAKKLFNKLSTDPTTTNMLVAKQPASFTGSEVRIIDDDMPLAQ 336

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYS-------------ISAHHE 289
              A+    +   + +A ++   M     +     + +                + + + 
Sbjct: 337 FAVAFNGASWVDPDSVALMVMQSMLGSWNKSAGGGKHMGSELVQKAAINDIAESVMSFNM 396

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
           N+ D G+  + +    + +  L  +I+  +  L   + + ++ +   ++ + +    + S
Sbjct: 397 NYKDTGLFGVYAVAKADCLDDLAFAIMHEMSKLSYRVTEEDVIRARNQLKSSIQLHLDGS 456

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMDHV 408
                +I +Q++  G  + + ++   I A+    +  VA + IF     +A +GP +  +
Sbjct: 457 TAVVEDIGRQLLTYGRRIPTPELFARIDAVDASTVKRVANRFIFDQDVAIAAMGP-IQGL 515

Query: 409 PTTS 412
           P  +
Sbjct: 516 PDYN 519


>gi|83954530|ref|ZP_00963241.1| peptidase, M16 family protein [Sulfitobacter sp. NAS-14.1]
 gi|83840814|gb|EAP79985.1| peptidase, M16 family protein [Sulfitobacter sp. NAS-14.1]
          Length = 402

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 149/395 (37%), Positives = 221/395 (55%), Gaps = 1/395 (0%)

Query: 23  SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLE 82
           SA + V + AG+R+E   ++G+AHFLEHM FKGT KRT+ +I E IE VGG INAYTS E
Sbjct: 6   SASIGVWVSAGARHETATQNGIAHFLEHMAFKGTAKRTSLQIAEAIEDVGGYINAYTSRE 65

Query: 83  HTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARF 142
            T+Y+  VL+  V L L++I D+L N   +  +IE ER V+L+EIG + D   D +    
Sbjct: 66  VTAYYVRVLENDVSLGLDVIADILRNPVLDNGEIEVERGVILQEIGQALDTPDDVIFDWL 125

Query: 143 SEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVE 202
            E  + +Q IGR ILG  E +S+F+ + +  F+S++Y  D+M +   GAVDH+  V   E
Sbjct: 126 QEKAYPNQPIGRTILGPSERVSNFSRDDLSGFISQHYGPDQMILAAAGAVDHDEIVRLAE 185

Query: 203 SYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASIL 262
             F       +   +  A + GGE  Q + L + H  LGF    Y++ D Y+  I AS L
Sbjct: 186 QLFGDMPPKPL-FDVDAAKFSGGEVRQLKPLEQAHFALGFEAPGYRADDIYVAQIYASAL 244

Query: 263 GDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSL 322
           G GMSSRLFQEVRE RGLCY+I A    ++D G++ I + T+ E +  L    ++ ++  
Sbjct: 245 GGGMSSRLFQEVRENRGLCYTIFAQAGAYADTGMMTIYAGTSGEQLPELAGITIDEMKRA 304

Query: 323 LENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCE 382
             ++   E+ +  A++ A L+   E    RA  +++ +     +   E+ I  I A+T  
Sbjct: 305 ASDMSPAEVARARAQMKAGLLMGLESPSNRAERLARLIQIWDRVPPLEETIAQIDAVTTG 364

Query: 383 DIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           D+   A+ I +S P    L  P+D  PT  EL   
Sbjct: 365 DVRDFAQNIAASAPAALALYGPVDGAPTLEELQER 399


>gi|299138879|ref|ZP_07032056.1| processing peptidase [Acidobacterium sp. MP5ACTX8]
 gi|298599033|gb|EFI55194.1| processing peptidase [Acidobacterium sp. MP5ACTX8]
          Length = 443

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 125/401 (31%), Positives = 214/401 (53%), Gaps = 6/401 (1%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           ++R +   +G+ V+TE MP   S  + V I +GSR+E  E +G+AHF+EHM+FKGTT R+
Sbjct: 22  DIRKTTLPNGLLVLTERMPHFRSVSMGVWIDSGSRDEAPEVNGIAHFIEHMVFKGTTTRS 81

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A+++  E++ +GG+++A+T  E   ++  VL E+VP AL+++ D++ + +F P D+ RE+
Sbjct: 82  AQQLAREVDSIGGNLDAFTGKETVCFNIKVLDENVPAALDLLTDLVLHPTFAPDDLAREQ 141

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEEI M ED+    +   F++  WK+  +GRPILG  +T+SSFT + + +  +R +T
Sbjct: 142 GVILEEIKMDEDNPDYLVHELFTQNFWKNDALGRPILGTAKTVSSFTQQIVFNEYARLFT 201

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRDLAEEH 237
              M     G +DH+  V+QV   F   S +   K+     P  +       K+ L +  
Sbjct: 202 PPNMVFSAAGNLDHDDFVAQVAQAFGSLSASSGSKLVRPAAPQAFPHITLKNKKSLEQVQ 261

Query: 238 MMLGFNGCAYQSRDFYLTNILASI-LGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
             L          D +  ++L SI  G GMSSRLFQ +RE+RGL YSI +    F D G 
Sbjct: 262 FCLAMPSLEVSHPDRFTVHLLNSILGGGGMSSRLFQSIREERGLAYSIYSETNPFRDTGS 321

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L + +  A +    +    +     +    + + E+ +   +    ++   E S  R   
Sbjct: 322 LAVYAGCAIDKTREVLDLTLAEFSRMKHELVSEEELKRVKDQSKGNMVLGLESSSSRMSN 381

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP 396
           +++Q M+ G     E +   +  ++ EDI  +A+++F    
Sbjct: 382 LARQQMYYGEFFSVEDLTAEVDRVSREDIQRLAQQLFQPEN 422


>gi|258591358|emb|CBE67657.1| putative enzyme [NC10 bacterium 'Dutch sediment']
          Length = 417

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 136/406 (33%), Positives = 226/406 (55%), Gaps = 3/406 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           ++       +G+ V++E MP + SA + V +R GSR+E  E  G++HF+EHMLFKGT +R
Sbjct: 4   LSFHREVLPNGVVVLSEQMPAVKSATIGVWVRVGSRDEAGEVAGVSHFIEHMLFKGTQRR 63

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+EI   ++ VGG ++A+TS E T ++A VL EH+PLA++I+ D   +S+ +  DIERE
Sbjct: 64  SAQEIARTVDAVGGTLDAFTSRETTCFYAKVLGEHLPLAVDILADTFLHSNLDTKDIERE 123

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           + VVL+EI M ED   D +   F+E +W D  + RPILG+ ET+ +FT + +   + R Y
Sbjct: 124 QEVVLQEIKMVEDTPDDLVHDLFAEAIWSDHPVARPILGRKETVRAFTQDDVRRHMDRFY 183

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             DR  V   G ++H   V  V   FN      +   + P        +++RD A+ H+ 
Sbjct: 184 RPDRTVVAAAGDLEHGRLVELVTQAFNGFEGRSVHADVPPPSCTAAVRVEERDTAQLHLC 243

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG +G  +  +D Y   +L ++LG  MSSRLFQEVREKRGL YSI ++  ++ D G+L I
Sbjct: 244 LGMDGLPHAHKDRYALYLLNAMLGGSMSSRLFQEVREKRGLVYSIYSYQASYRDCGLLVI 303

Query: 300 ASATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T  E+   +      E      + ++  ++ +   ++   L+   E +  R   ++K
Sbjct: 304 YAGTNPESSGQVVELIRAECASLRNQPVDPSDLQRAKDQLKGNLLLGLEGTSSRMTRMAK 363

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
             ++       ++II  I +++ +    +A++I    T  +  +GP
Sbjct: 364 TEIYFEGTYGLDEIIAGIDSVSVDQFESLARRILRDETFAITTIGP 409


>gi|71032073|ref|XP_765678.1| biquinol-cytochrome C reductase complex core protein I [Theileria
           parva strain Muguga]
 gi|68352635|gb|EAN33395.1| biquinol-cytochrome C reductase complex core protein I,
           mitochondrial precursor,  putative [Theileria parva]
          Length = 518

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 115/446 (25%), Positives = 204/446 (45%), Gaps = 28/446 (6%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   +G+ V T  MP  S+ V V I +GSR E  E +G AHFLEHM+FKGT  R+  +
Sbjct: 73  HVTTLKNGLRVATVWMPGSSSTVGVWIDSGSRFETPETNGSAHFLEHMIFKGTKSRSRHQ 132

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + E+IE  G  +NAYTS E T+Y+A      +P   E++ D+L NS  +P  +E E++V+
Sbjct: 133 LEEQIEHKGAHLNAYTSREQTAYYARCFNNDIPWCTELLSDILQNSLIDPDHMENEKHVI 192

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E    + +  R     ++D  +G  ILG  E I +   E ++ +++RNYTADR
Sbjct: 193 LREMEEVEKSHDEVVFDRLHMTAFRDCSLGFTILGPVENIKNMQREYLLDYINRNYTADR 252

Query: 184 MYV----------VCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD- 232
           M              VG  +H+  VS  E +F+    A  K  ++   +VG E +++ D 
Sbjct: 253 MVFYTPIIISQVLCAVGNFEHDKFVSLAEKHFSTIPKAVTKVELEKPYFVGSELLERNDE 312

Query: 233 -LAEEHMMLGFNGCAYQSRDFYLTNILASI--------------LGDGMSSRLFQEVREK 277
                H+ +   G  + S D     ++ SI                 G  +      R  
Sbjct: 313 MGPYAHIAVALEGVPWNSPDSVAFMLMQSIIGTYNKSNEGVVPGKVSGNKTIHAVANRMT 372

Query: 278 RGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAK 337
            G     SA +  + D G+    +   +  +      ++  + SL  ++   E+++   +
Sbjct: 373 VGCAEFFSAFNTCYKDTGLFGFYAKADEVAVDHCVGELLFGITSLSYSVTDEEVERAKRQ 432

Query: 338 IHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTP 396
           +  + +   E +   A E+++Q++  G  +   + +  +  I  E++  VA K    S  
Sbjct: 433 LMLQFLSMTESTSSVAEEVARQILVYGRRMPVAEFLLRLEKIDAEEVKRVAWKYLHDSEV 492

Query: 397 TLAILGPPMDHVPTTSELIHALEGFR 422
            ++ +GP +  +P+  +L       R
Sbjct: 493 AVSAMGP-LHGMPSLVDLRQKTYWLR 517


>gi|221309549|ref|ZP_03591396.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313873|ref|ZP_03595678.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318796|ref|ZP_03600090.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221323068|ref|ZP_03604362.1| mitochondrial processing peptidase-like protein [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|255767376|ref|NP_389553.2| specific processing protease [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|321315438|ref|YP_004207725.1| specific processing protease [Bacillus subtilis BSn5]
 gi|239938816|sp|Q04805|YMXG_BACSU RecName: Full=Uncharacterized zinc protease ymxG; AltName:
           Full=ORFP
 gi|225185003|emb|CAB13544.2| specific processing protease [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484225|dbj|BAI85300.1| mitochondrial processing peptidase-like [Bacillus subtilis subsp.
           natto BEST195]
 gi|320021712|gb|ADV96698.1| specific processing protease [Bacillus subtilis BSn5]
          Length = 409

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 126/410 (30%), Positives = 231/410 (56%), Gaps = 4/410 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ ++ E  P + S  + V I  GSR+E  E +G++HFLEHM FKGT+ ++A
Sbjct: 2   IKRYTCQNGVRIVLENNPTVRSVAIGVWIGTGSRHETPEINGISHFLEHMFFKGTSTKSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+ +++++E+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSTFDENELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  ET++SF  + +  ++   YT 
Sbjct: 122 VVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLASFNGDSLRQYMHDYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G +  +  +  VE +F           ++   +   +  +K++  + H+ LG
Sbjct: 182 DRVVISVAGNIS-DSFIKDVEKWFGSYEAKGKATGLEKPEFHTEKLTRKKETEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G        Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I  
Sbjct: 241 FKGLEVGHERIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L+ +I E + +   + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGANQLQQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPT 410
           +  G     ++II+ ++A+  E + G+A+++F+    LA++  P  ++P+
Sbjct: 361 LLLGKHKTLDEIINELNAVNLERVNGLARQLFTEDYALALI-SPSGNMPS 409


>gi|198433490|ref|XP_002129466.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           [Ciona intestinalis]
          Length = 476

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 99/429 (23%), Positives = 195/429 (45%), Gaps = 15/429 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++  ++G+ V +E   + +  V + I AGSR E  + +G AHFLEHM FKGT  RT  +
Sbjct: 44  RVTTLANGLRVASEDSGLSTCTVGLWIDAGSRYETNDNNGTAHFLEHMAFKGTANRTQLD 103

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  E+E +G  +NAYTS E T Y+A    + +P A+EI+ D++ NS+   ++IERER V+
Sbjct: 104 LELEVENMGAHLNAYTSREQTVYYAKSFSKDLPQAVEILADIIQNSTLGEAEIERERGVI 163

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +G  ILG  E I     + +++++ ++Y   R
Sbjct: 164 LREMEEIEQNQQEVVFDYLHSTAYQGTSLGLTILGPSENIKKINRQDLVTYIKQHYNPSR 223

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRDLAEEHM 238
           M +   G V+H+  V+  + +F     +  ++     +            +   +   H+
Sbjct: 224 MVLAAAGGVNHDKLVNLAKEFFGTTVSSDNQDPSPLKLQPCTFTGSDLRHRNDHMPYVHV 283

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAHHEN 290
            +   G  ++  D     I   I+G                     + GLC S  + +  
Sbjct: 284 AMAVEGVGWEHPDTIPLMIANQIIGTWDRSSANGAHFPNPLVRRMAREGLCVSFQSFNTL 343

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           ++D G+  I   +  +NI   T  + +    L  ++ + E+ +    +   +    + + 
Sbjct: 344 YTDTGLWGIYFVSDNDNIYDCTIRVQDEWMRLCTDLTEFEVSRAQNTLLTNMALMLDGTT 403

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVP 409
               +I +Q++  G  +   ++   IS +   D+  V K+  + S P +A +GP  + +P
Sbjct: 404 PICEDIGRQMLCYGRRIPWPEMARRISHVNISDVKKVMKQYVWDSCPAVASIGP-TEALP 462

Query: 410 TTSELIHAL 418
             + +   +
Sbjct: 463 DYANIRAKM 471


>gi|50427275|ref|XP_462250.1| DEHA2G16214p [Debaryomyces hansenii CBS767]
 gi|49657920|emb|CAG90746.1| DEHA2G16214p [Debaryomyces hansenii]
          Length = 464

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 114/439 (25%), Positives = 203/439 (46%), Gaps = 22/439 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + S   +G+TV +EVMP   +A V V I AGSR +  +  G AHFLEH+ FKGT KR+
Sbjct: 26  QFKTSILPNGLTVASEVMPGTKTATVGVWINAGSRADNPKSSGTAHFLEHLAFKGTGKRS 85

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L+  +   ++I+ D+L+ S      IE ER
Sbjct: 86  QLNLELEIENLGSQINAYTSRENTVYYTKCLENDISQNIDILSDLLTKSKLEARAIENER 145

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+E    +    + +      + +K+Q +GR ILG  E I +     +++++  NY 
Sbjct: 146 HVILQESDEVDKMYDEVVFDHLHAVAFKNQDLGRTILGPRELIKTINRSDLVNYIQTNYK 205

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM ++ VG V+H+  V + E +F     ++I  +      P  Y     IQ   L   
Sbjct: 206 GDRMALIGVGCVNHDELVKKAEQFFGHIKKSEIPFTQNGGDLPIFYGDEIRIQDDSLPNT 265

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLF---------------QEVREKRGLC 281
           ++ L   G ++ + DF+  ++   I+G    S                     +      
Sbjct: 266 YVALAVEGVSWSAPDFFTASVANGIVGTWDRSIGIGSNSPSPLAVTAATGGPNQTPIANS 325

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  +    +  + + +   E  +    NI   EI++  A++ A 
Sbjct: 326 YMAYTTSYADTGLMGVYFTAEKDADLKLFVEAVQKEWSRLKSNNITDDEIERSKAQLKAS 385

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +Q++  G+ L  E + + + +IT +D+V  A       P  ++ 
Sbjct: 386 LVLALDDSTAIAEDIGRQLVNTGNRLSPEDVFERVESITRKDVVDWANYRLKDRPVAVSA 445

Query: 401 LGPPMDHVPTTSELIHALE 419
           +G  +  +P+  E+   + 
Sbjct: 446 IG-NVKTLPSHKEITKGMS 463


>gi|54025856|ref|YP_120098.1| putative protease [Nocardia farcinica IFM 10152]
 gi|54017364|dbj|BAD58734.1| putative protease [Nocardia farcinica IFM 10152]
          Length = 456

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 126/409 (30%), Positives = 207/409 (50%), Gaps = 8/409 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P   SA + V +  GSR+E +   G AHFLEH+LFK T  R+A
Sbjct: 32  VRRTVLPGGLRVVTEHVPGVRSASIGVWVGVGSRDEGRTVAGAAHFLEHLLFKATPTRSA 91

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ E T Y+A VL E +PLA++++ D++ N     +D++ ER 
Sbjct: 92  LDIAQAMDAVGGELNAFTAKEQTCYYAHVLDEDLPLAVDMVSDVVLNGLCRSADVDVERQ 151

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D +   F   ++ D  IGRP++G  E+I S T  ++  F  R Y  
Sbjct: 152 VVLEEIAMRDDDPEDLVGDAFLTALFGDHPIGRPVIGSVESIESMTAAQLRGFHQRRYRP 211

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
           DRM V   G V+HE  V  V   F          A  +E               RD  + 
Sbjct: 212 DRMVVAVAGNVEHEHTVELVHRAFENRLDPAAQPAPRREGRFRPHGAPELQWSFRDSEQA 271

Query: 237 HMMLGFNGCAYQSRDFYLT-NILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNG 295
           H++ G         +     ++L +++G G+SSRLFQ +RE+RGL YS+ +  + F+D G
Sbjct: 272 HLVFGVRAFGRHEGERRWPLSVLNTVVGGGLSSRLFQRIREERGLAYSVYSSVDTFADTG 331

Query: 296 VLYIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
              +      EN+  +      V++ +    +   E  +    +   L+   E S  R  
Sbjct: 332 AFSVYIGCQPENLGEVARLAKGVLEEVAEHGVTDAECARAKGSLRGGLVLGLEDSASRMN 391

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            I +  +  G+     + +  I A+T E++  +A+ + S    +++ GP
Sbjct: 392 RIGRSELSYGNHRSVSETLARIDAVTTEEVAAIARTLLSRPFGVSVAGP 440


>gi|66500205|ref|XP_393509.2| PREDICTED: mitochondrial-processing peptidase subunit beta-like
           [Apis mellifera]
          Length = 477

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 105/428 (24%), Positives = 196/428 (45%), Gaps = 14/428 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++    G+ + TE     +A V + I AGSR E  E +G+AHF+EHM FKGTTKR+  +
Sbjct: 46  QVTTLDCGMRIATEDSGAPTATVGLWIDAGSRFETDENNGVAHFMEHMAFKGTTKRSQTD 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T ++A  L E VP A+EI+ D++ NS    ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVFYAKCLAEDVPKAVEILSDIIQNSKLGENEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  + I S T   ++++V   Y   R
Sbjct: 166 LREMQEVETNLQEVVFDHLHASAYQGTPLGRTILGPTKNIKSITRNDLLNYVKSYYGPPR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVA---KIKESMKPAVYVGGEYIQKRD-LAEEHMM 239
             +   G V+H   V   + +F         +I   ++P  Y G E   + D +   H+ 
Sbjct: 226 FILAGAGGVNHNALVELAQKHFGQMKGPFYDEIPSILEPCRYTGSEIRVRDDTIPLAHVA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   G  +   D     +  +++G    S+                 GLC+S  + +  +
Sbjct: 286 IAVEGAGWTDPDNIPLMVANTLMGAWDRSQGGGVNNISYLAEASATDGLCHSYQSFNTCY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  I        I     ++      L   + ++E+D+    +   ++   + +  
Sbjct: 346 QDTGLWGIYFVCDPMEIQDFVFNVQREWMRLCTTVTEKEVDRAKNILKTNMLLQLDGTTA 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGV-AKKIFSSTPTLAILGPPMDHVPT 410
              +I +Q++     +   ++   I ++   +I  +  K I+   P +A +GP ++++  
Sbjct: 406 ICEDIGRQMLCYNRRIPLHELEARIDSVNASNIHDIGMKYIYDQCPVIAAVGP-IENLLD 464

Query: 411 TSELIHAL 418
            + +   +
Sbjct: 465 YNLIRAGM 472


>gi|125972940|ref|YP_001036850.1| peptidase M16-like protein [Clostridium thermocellum ATCC 27405]
 gi|256005695|ref|ZP_05430651.1| peptidase M16 domain protein [Clostridium thermocellum DSM 2360]
 gi|281417151|ref|ZP_06248171.1| peptidase M16 domain protein [Clostridium thermocellum JW20]
 gi|125713165|gb|ABN51657.1| peptidase M16-like protein [Clostridium thermocellum ATCC 27405]
 gi|255990326|gb|EEU00452.1| peptidase M16 domain protein [Clostridium thermocellum DSM 2360]
 gi|281408553|gb|EFB38811.1| peptidase M16 domain protein [Clostridium thermocellum JW20]
 gi|316940824|gb|ADU74858.1| peptidase M16 domain protein [Clostridium thermocellum DSM 1313]
          Length = 419

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 126/404 (31%), Positives = 223/404 (55%), Gaps = 4/404 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +  K  +G+ V+ E +P + S  + + +  GSRNE Q  +G++HF+EHMLFKGT  R+A
Sbjct: 2   YKRIKLENGVRVVCEKIPYLRSVSIGIWVGTGSRNESQSNNGISHFIEHMLFKGTDNRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI + I+ +GG +NA+T  E T Y+   L  H  +AL+++ DM  NS F   DIE E+ 
Sbjct: 62  REIADSIDSIGGQLNAFTGKECTCYYTKTLDSHADIALDVLSDMFFNSRFEEKDIEVEKK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEIGM ED   + +    SE VW+D  +G PILG  ET+ +   +KI ++++  Y  
Sbjct: 122 VILEEIGMYEDSPEELVHDILSETVWEDNSLGLPILGTRETLLNINKDKIKAYINERYLP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSV-AKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
               +   G  + +  +  ++  F   +   K  ++++ A +     I+ +D  + H+ +
Sbjct: 182 QNTVIAVAGNFEEDRIIDVIKEKFGGWNASGKDSKTIEDAKFKVNSKIKVKDTEQIHICM 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G A+ S + Y    + ++LG GMSSR+FQ++RE++GL YSI ++  ++ + G+  I 
Sbjct: 242 GFEGVAHGSDELYPLLAVNNVLGGGMSSRMFQKIREEKGLVYSIYSYPSSYKNAGLFTIY 301

Query: 301 SATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +    E++  +   I++ ++ LL+  + + E++K   ++    I   E +  R   + K 
Sbjct: 302 AGMNAEHLEKVVELIIKEIKILLKEGLSKDELEKSKEQLKGSYILGLESTSSRMNSMGKS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILG 402
            +    I   ++I+  I A+  E +  V K+IF     + AI+G
Sbjct: 362 EVLMDRIYTPDEILKKIDAVNQESVERVIKQIFCLDKISFAIVG 405


>gi|332670054|ref|YP_004453062.1| peptidase M16 domain-containing protein [Cellulomonas fimi ATCC
           484]
 gi|332339092|gb|AEE45675.1| peptidase M16 domain protein [Cellulomonas fimi ATCC 484]
          Length = 448

 Score =  193 bits (491), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 124/419 (29%), Positives = 212/419 (50%), Gaps = 18/419 (4%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   SA V   +  GSR+E    +G  HFLEH+LFKGT +R+A
Sbjct: 27  VRRSVLPGGVRVLTEQMPGLRSATVGAWVGVGSRDETSGHYGSTHFLEHLLFKGTARRSA 86

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I E  + VGG+ NA T  EHT Y+A VL + +P+A+++I DM++++  +  ++E ER 
Sbjct: 87  MDIAEAFDAVGGEANAATGKEHTCYYARVLDDDLPMAVDVIADMVTSARLDTDELETERG 146

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D +  +F+  V  +  +GRPI G P+TI +   + +      +YT 
Sbjct: 147 VILEELAMNDDDPSDVVHEQFAAAVLGEHPLGRPIGGTPDTIRAVPRDAVWEHYRWHYTP 206

Query: 182 DRMYVVCVGAVDHEFCVSQV----------------ESYFNVCSVAKIKESMKPAVYVGG 225
             + V   G VDH+    QV                 +     + + +   +      G 
Sbjct: 207 ATLVVTAAGGVDHDTLCGQVADALAAGGWALDGDDAPTGRRPLTASSVAAGVDGIPADGV 266

Query: 226 EYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSIS 285
           E   +R   + ++++G           +  ++L ++LG GMSSRLFQE+REKRGL YS  
Sbjct: 267 ELTIQRHTEQANVIVGGTALTATDPRRFTLSVLNAVLGGGMSSRLFQEIREKRGLAYSTY 326

Query: 286 AHHENFSDNGVLYIASATAKENIMALTS-SIVEVVQSLLENIEQREIDKECAKIHAKLIK 344
           +     +D GV  + +  A   +  +    + E  +     I   E+++   ++   L+ 
Sbjct: 327 SFASGHADTGVFGLYAGCAPGKVDEVVELMVAEWERLADGGITPAELERSLGQLAGGLVL 386

Query: 345 SQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
             E +  R   + K  +  G +L  ++ +D I A+T  D+  +A ++ S   ++  +GP
Sbjct: 387 GMEDTGSRMSRLGKAELVHGELLSIDESLDRIRAVTAADVQELAAELASRPRSVVRVGP 445


>gi|6686233|sp|O32965|Y855_MYCLE RecName: Full=Uncharacterized zinc protease ML0855
 gi|2342618|emb|CAB11391.1| protease/peptidase [Mycobacterium leprae]
          Length = 445

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 135/406 (33%), Positives = 213/406 (52%), Gaps = 7/406 (1%)

Query: 5   ISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T+ RTA +
Sbjct: 24  RTTLPGGLRVVTEHLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTSTRTAMD 83

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I + I+ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+VV
Sbjct: 84  IAQAIDAVGGELNAFTAKEHTCYYAHVLDSDLELAVDLVADVVLNGRCAVDDVELERDVV 143

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           LEEI M +DD  D L   F   ++ D  +GRP++G  E++S+ T  ++ SF  R YT +R
Sbjct: 144 LEEIAMRDDDPEDALGDMFLAALFGDHPVGRPVIGTMESVSAMTRTQLHSFHVRRYTPER 203

Query: 184 MYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           M V   G VDH+  V+ V  +F          A  ++S           + KRD  + H+
Sbjct: 204 MVVAVAGNVDHDEMVALVREHFGSRLIRGRQSAPPRKSTGRINGGPALTLGKRDAEQTHV 263

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LG           +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G L 
Sbjct: 264 LLGVRTPGRSWEHRWALSVLHTALGGGLSSRLFQEIRETRGLAYSVYSALDIFADSGALS 323

Query: 299 IASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           + +A        +   I EV+ S+  + I + E       +   +I   E S      + 
Sbjct: 324 VYAACLPGRFADVMQVISEVLASVAGDGITEAECRIAKGSLRGGIILGLEDSNSWMSRLG 383

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  +  G     E  +  I  +T E +  +A ++ +     A+LGP
Sbjct: 384 RSELNYGKYRGIEHTLQQIDEVTVEQVNALAHQLLNKRYGAAVLGP 429


>gi|15827381|ref|NP_301644.1| zinc protease [Mycobacterium leprae TN]
 gi|221229858|ref|YP_002503274.1| putative zinc protease [Mycobacterium leprae Br4923]
 gi|13092931|emb|CAC31236.1| putative zinc protease [Mycobacterium leprae]
 gi|219932965|emb|CAR70950.1| putative zinc protease [Mycobacterium leprae Br4923]
          Length = 424

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 135/406 (33%), Positives = 213/406 (52%), Gaps = 7/406 (1%)

Query: 5   ISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T+ RTA +
Sbjct: 3   RTTLPGGLRVVTEHLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTSTRTAMD 62

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I + I+ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+VV
Sbjct: 63  IAQAIDAVGGELNAFTAKEHTCYYAHVLDSDLELAVDLVADVVLNGRCAVDDVELERDVV 122

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           LEEI M +DD  D L   F   ++ D  +GRP++G  E++S+ T  ++ SF  R YT +R
Sbjct: 123 LEEIAMRDDDPEDALGDMFLAALFGDHPVGRPVIGTMESVSAMTRTQLHSFHVRRYTPER 182

Query: 184 MYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
           M V   G VDH+  V+ V  +F          A  ++S           + KRD  + H+
Sbjct: 183 MVVAVAGNVDHDEMVALVREHFGSRLIRGRQSAPPRKSTGRINGGPALTLGKRDAEQTHV 242

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
           +LG           +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G L 
Sbjct: 243 LLGVRTPGRSWEHRWALSVLHTALGGGLSSRLFQEIRETRGLAYSVYSALDIFADSGALS 302

Query: 299 IASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           + +A        +   I EV+ S+  + I + E       +   +I   E S      + 
Sbjct: 303 VYAACLPGRFADVMQVISEVLASVAGDGITEAECRIAKGSLRGGIILGLEDSNSWMSRLG 362

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  +  G     E  +  I  +T E +  +A ++ +     A+LGP
Sbjct: 363 RSELNYGKYRGIEHTLQQIDEVTVEQVNALAHQLLNKRYGAAVLGP 408


>gi|328852145|gb|EGG01293.1| hypothetical protein MELLADRAFT_50153 [Melampsora larici-populina
           98AG31]
          Length = 479

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 105/435 (24%), Positives = 180/435 (41%), Gaps = 21/435 (4%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             +I+  S+G+TV TE  P   +A V + I +GSR ++    G AHFLEH+ FKGT KRT
Sbjct: 43  QTQITTLSNGLTVATEPHPHSQTATVGIWIDSGSRADKHG--GTAHFLEHLAFKGTQKRT 100

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  +NAYTS E T Y A    + VP  +EII D+L NS  +   IERER
Sbjct: 101 QHALELEIENLGAHLNAYTSREQTCYFARSFSDDVPKVVEIISDILQNSKLDEGAIERER 160

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L E    +    + +      + ++ + +G+ ILG  E+I S     +  ++   YT
Sbjct: 161 SVILREQEEVDKAHEEVVFDHLHAVAFQGEDLGKTILGPKESILSMQRSHLTDYIKSYYT 220

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           ADRM +V  G + HE  V      F     +     +     +        ++      +
Sbjct: 221 ADRMVLVGAGGIQHEALVELASKNFGSLPTSSSPIPLGGRGQIRPTQFTGSEVRIRDDTM 280

Query: 241 ------------GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHH 288
                       G+N           +         G S+     +         +++  
Sbjct: 281 DTINLAIAVEGVGWNSPDLFPMLVMQSIFGNWDRSLGSSALTSSRLSHTLSTNNLVNSFL 340

Query: 289 ENFSDNGVLYIASAT----AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIK 344
              +      +           N+  L    +   Q +     + E+ +  A++ A ++ 
Sbjct: 341 SFSTSYSDTGLWGIYLVSENLTNLDDLVHLTLREWQRMATAPTEMEVSRAKAQLKASMLF 400

Query: 345 SQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
           S + S   A +I +Q++  G  +  ++I   + A+T E I  VA+K        +A LG 
Sbjct: 401 SLDSSNNIADDIGRQLVTSGKRMTPQEIQAAVEAVTPETIRRVAQKYLWDKDIAIAALGR 460

Query: 404 PMDHVPTTSELIHAL 418
             + +   S +   +
Sbjct: 461 -TEGLLDYSRIRADM 474


>gi|269838052|ref|YP_003320280.1| peptidase M16 domain-containing protein [Sphaerobacter thermophilus
           DSM 20745]
 gi|269787315|gb|ACZ39458.1| peptidase M16 domain protein [Sphaerobacter thermophilus DSM 20745]
          Length = 421

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 123/407 (30%), Positives = 210/407 (51%), Gaps = 6/407 (1%)

Query: 3   LRISKTSSGITVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT- 60
            + +   +G+ V+T  M  + SA + +  R GSR E  ++ G++HFLEHM+FKGT +R  
Sbjct: 2   YQKTVLPNGVRVVTSRMDHVRSATLILYFRVGSRYESDDQAGISHFLEHMVFKGTERRPD 61

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              + +EIE VGG +NA TS E T+Y   V   H+  A +++ DML +S+F+P ++E+ER
Sbjct: 62  PIMLTQEIEGVGGILNAATSRESTNYWVKVPSAHLARAFDVLADMLRHSTFDPEELEKER 121

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V++EEI    D   D +     E+VW  Q +GRP++G  +T+S+ + E +I+++   Y 
Sbjct: 122 FVIIEEIRGIHDTPDDLIHDVIDELVWDGQSVGRPVIGSVDTVSAISREDLITYLRTQYR 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ--KRDLAEEHM 238
            DR+ +   G + HE  V   E YF     + +   ++  V      ++   R   + H+
Sbjct: 182 PDRLVIAAAGDIHHEQVVELAEQYFGDLPASDVNTFVQAEVRQQEPRVRLLTRPTEQAHL 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            +      Y     Y+  ++ ++L  GMSSRLFQE+RE+ GL Y +  +   ++D G   
Sbjct: 242 CVAVPALPYTDDRRYVQEMIDAVLSSGMSSRLFQEIRERLGLVYEVYGYFREYADVGQGV 301

Query: 299 IASATAKENIMALTSSI-VEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           + + T    +     +I  E  +   E +   E+++       +++   E S   A  + 
Sbjct: 302 VYAGTDPARVEQTIEAILREFDKLRREPVPADELERTKELRRGRIVMGLEDSRAVAAWVG 361

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
            Q    G IL  E+++  I A+T E I  +A ++F      LAI+GP
Sbjct: 362 SQEAVFGEILTPEEVMARIDAVTAEQIQELATELFRPDLLNLAIVGP 408


>gi|328867398|gb|EGG15781.1| mitochondrial processing peptidase beta subunit [Dictyostelium
           fasciculatum]
          Length = 470

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 107/421 (25%), Positives = 191/421 (45%), Gaps = 13/421 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +I+   +GI V TE    ++A + V + +GS  E ++ +G+AHFLEHM+FKGT KR +  
Sbjct: 40  KITTLPNGIRVATEQSFGETASIGVWVDSGSVYENEKNNGVAHFLEHMIFKGTEKRPSPN 99

Query: 64  IVE-EIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +E E+E +GG++NA+TS EH++Y+  VLKE++P A++I+ D+L NS F+   I+ ER+ 
Sbjct: 100 FIETEVENMGGNLNAFTSREHSAYYMKVLKENIPNAVDILSDILQNSKFDQKLIDDERHT 159

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   +    + +  +     ++   +GR ILG  E I+S T   I  F+  NYT  
Sbjct: 160 ILSEMQYIQSQENELVFDQLHATAFQGSPLGRTILGPVENINSITRNDIKKFMEDNYTGQ 219

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           R+ +   GAV+HE  V QV+  F                   G  ++ RD +   +    
Sbjct: 220 RLVIAASGAVNHEQLVQQVKEKFGSIKAGDAAPRQLITNEFVGSELRVRDDSIPLVHFAV 279

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVRE----------KRGLCYSISAHHENFS 292
                         +       G  SR     R             GL  S S     ++
Sbjct: 280 AVKGLSWSSPDYFVLELIQTMIGNWSRSIAAGRNVSSNLGEVVATEGLAESYSTFFSCYN 339

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+           +  L   +++  Q +       E+ +    + A  +   + +   
Sbjct: 340 DTGLFGNFGVAQPGRVDDLVCEMLKEWQRIANACTDAEVQRAKQSLIASSLMQYDGTSKI 399

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHVPTT 411
              I +QV+  G  +   ++   I+ I+  D+  VA+++    +P +  +G  +++ P  
Sbjct: 400 CESIGRQVLTLGRRITPAELYLRIAEISVSDVRRVARELLVDVSPAVTAIG-SVENFPDY 458

Query: 412 S 412
           +
Sbjct: 459 N 459


>gi|39996694|ref|NP_952645.1| M16 family peptidase [Geobacter sulfurreducens PCA]
 gi|39983575|gb|AAR34968.1| peptidase, M16 family [Geobacter sulfurreducens PCA]
 gi|298505705|gb|ADI84428.1| zinc-dependent peptidase, PqqL family [Geobacter sulfurreducens
           KN400]
          Length = 418

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 121/408 (29%), Positives = 214/408 (52%), Gaps = 2/408 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +  +   +G+ +I+E MP + S  + + +  GSR+ER+E +G+AHF+EH++FKGT +R A
Sbjct: 2   VNKTILDNGVRIISEYMPHVHSVSIGIWVANGSRHERREHNGVAHFVEHLMFKGTERRNA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ VGG +NA+TS E+  Y+A VL + +P  ++++ D+  NS F+  +IE+ER 
Sbjct: 62  LDIAREIDSVGGVLNAFTSREYVCYYAKVLDKFLPKTIDLLADIFLNSIFDSEEIEKERK 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M ED   D++   F    W+   +G  ILG  E+I   + E II+ +   Y +
Sbjct: 122 VVLQEINMLEDTPDDYVHDLFHRSFWRGHPLGMSILGSVESIEGLSREAIITHLKEKYRS 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           D + +   G V H+  +S V+  F        ++      Y     + ++DL + H+ LG
Sbjct: 182 DDIIIAVAGNVRHDELLSLVDGLFGRVPEGSGRDICHLPAYEKQVEVVEKDLEQVHICLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
                      +   ++ ++LG  MSSRLFQE+RE+ GL YS+ ++  + +D G L +  
Sbjct: 242 TKAFPQNHPRRFEVYLVNTLLGGSMSSRLFQEIRERLGLAYSVYSYVVSHTDAGSLVVYV 301

Query: 302 ATAKENIMALTSSIVEVVQSLLEN-IEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T+ E +  +    V  ++ L    +   E++    +I   +  S E S  R  +++K  
Sbjct: 302 GTSPEKLDDVLDITVAELKRLKTELVPLPELESAKEQIKGSIYLSLESSDNRMTKLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHV 408
           ++ G  +   ++ D   ++T   I+ +A +IF        L   +D  
Sbjct: 362 IYFGRYIPIHELADGFDSVTSRGILELAGEIFDERYLTLALMGKIDSA 409


>gi|147902934|ref|NP_001079714.1| ubiquinol-cytochrome c reductase core protein I [Xenopus laevis]
 gi|29351607|gb|AAH49288.1| Uqcrc1 protein [Xenopus laevis]
          Length = 478

 Score =  193 bits (489), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 97/432 (22%), Positives = 187/432 (43%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           ++S   +G+ V +E     +  V V I AGSR E  + +G  +FLEH+ FKGT KR    
Sbjct: 47  QLSTLDNGLRVASEESSQATCTVGVWIGAGSRYESDKNNGAGYFLEHLAFKGTKKRPQAA 106

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +E+E +G  +NAYT+ E T+ +     + +P A+EI+ D++ NSS   S IE+ER V+
Sbjct: 107 LEQEVESLGAHLNAYTTREQTAIYIKAQSKDLPKAVEILADVVQNSSLEDSQIEKERQVI 166

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   + +  + +        ++   +GR ++G  E   +     ++ +V+ N+ A R
Sbjct: 167 LREMQEIDSNLQEVVFDYLHATAYQGTALGRTVVGPSENARNLNRADLVDYVNSNFKAPR 226

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G V H+      + +F           +               +  DL   H+ 
Sbjct: 227 MVLAAAGGVSHKELCDLAQRHFSGLSYEYEKDAVPLLPPCRFTGSEIRARNDDLPLAHVA 286

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENF 291
           +   G  + S D     +  +I+G+   +    +           +  LC S    +  +
Sbjct: 287 IAVEGPGWNSSDNISLLVANAIIGNYDVTYGGGKNLSSRVASVAAEHKLCQSYQTFNIRY 346

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+  +   T K NI  +         SL  ++   E+ +    +   L+   + +  
Sbjct: 347 SDTGLFGMHFVTDKHNIEDMLHIAQGEWMSLCTSVTDSEVAQAKNALKTALVAQLDGTTP 406

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              +I +Q++  G  +  E++   I A+  + +  +  K      P +A +GP ++ +P 
Sbjct: 407 VCEDIGRQILSYGQRVSLEELNARIDAVDAKKVSEICSKYLYDKCPAVAGVGP-IEQIPD 465

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 466 YNRIRSAMYWLR 477


>gi|300088489|ref|YP_003759011.1| peptidase M16 domain-containing protein [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299528222|gb|ADJ26690.1| peptidase M16 domain protein [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 421

 Score =  193 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 132/423 (31%), Positives = 210/423 (49%), Gaps = 9/423 (2%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTK-RT 60
            R +   +G+ ++T+ MP   S+ + V +   SR E     G++HF+EHMLF+GT K RT
Sbjct: 2   YRKTTLPNGLRILTQEMPHTLSSSICVFVGTSSRYEPDNLGGVSHFIEHMLFRGTEKHRT 61

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I E IE VGG +N  T  E T Y A V   H    L+ + DM+ +S F+P D+ERER
Sbjct: 62  AHDISEAIEGVGGIMNGGTDKESTVYWAKVASSHFMPTLDTLADMMLHSRFDPEDLERER 121

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V++EEI M+ED     +      ++W +  +GR I G   TI       I++F+S +Y 
Sbjct: 122 QVIIEEIHMTEDQPDQKVCQLIDSILWPNHPLGRDIAGTESTIRDMGRADILNFMSGHYR 181

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYV--GGEYIQKRDLAEEHM 238
            D   V   G + HE  +  V   F      +                 I+ RD+ + + 
Sbjct: 182 PDNTVVSIAGGLTHEQMIKAVIDEFGEWESREPSCVFTGFTPNGGRRMIIEHRDIEQAYF 241

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            L     +      Y  ++L  ILG+GMSSRLF E+R+K GL Y+I ++ +   D G L 
Sbjct: 242 QLAMPAMSTVDPRRYTQSLLNVILGEGMSSRLFTEIRDKLGLAYAIQSYADFLQDTGALT 301

Query: 299 IASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
           +A++   +N+    ++++  ++ L   I + E++K       ++    E S   A  +  
Sbjct: 302 VAASVDTDNLEQAVAAVINELEKLKTTITRHELNKARELSKGRMALRLEDSRHVATWLGG 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGPPMDHVPTTSELIHA 417
           Q +  G IL  E++I  +  IT +DI  +A++I       LA++GP  D  P    L H 
Sbjct: 362 QEILAGEILTPEEVITRLDKITLKDITDLAEEIIQADKFHLAVVGPVADETP----LRHL 417

Query: 418 LEG 420
           L+G
Sbjct: 418 LDG 420


>gi|154686088|ref|YP_001421249.1| MlpA [Bacillus amyloliquefaciens FZB42]
 gi|154351939|gb|ABS74018.1| MlpA [Bacillus amyloliquefaciens FZB42]
          Length = 411

 Score =  192 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 129/403 (32%), Positives = 223/403 (55%), Gaps = 3/403 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++     +G+ V+ E  P + S  + V I  GSR+E  + +G++HFLEHM FKGT  R+A
Sbjct: 2   IKRYTCQNGVRVVLENNPTVRSVAIGVWIGTGSRHETPDTNGISHFLEHMFFKGTNTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           +EI E  +++GG +NA+TS E+T Y+A VL EH   AL+++ DM  +S+F+  ++++E+N
Sbjct: 62  REIAESFDRIGGQVNAFTSKEYTCYYAKVLDEHANYALDVLADMFFHSAFDEDELKKEKN 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VV EEI M ED   D +    S+  + +  +G PILG  ET+SSF  + +   +   YT 
Sbjct: 122 VVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGYPILGTEETLSSFNGDSLRQHMDDFYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
           DR+ +   G V  E  +  VE +F           +    +   +  +K+D  + H+ LG
Sbjct: 182 DRVVISVAGNVT-EQFIKDVEKWFGTYEAKGKASGISEPEFHYEKLTRKKDTEQAHLCLG 240

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G      D Y   +L ++LG  MSSRLFQ+VRE +GL YS+ ++H ++ D+G+L I  
Sbjct: 241 FKGLKVGDPDIYDLIVLNNVLGGSMSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYG 300

Query: 302 ATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T    +  L+ +I E +     + I  +E++    ++   L+ S E +  +     K  
Sbjct: 301 GTGANQLGLLSETIQETLSVLKRDGITPKELENSKEQMKGSLMLSLESTNSKMSRNGKNE 360

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +  G     ++II  ++A++ E + G+++++F+    L+++ P
Sbjct: 361 LLLGKHKTMDEIITELNAVSLESVNGLSRRLFTDDYALSLISP 403


>gi|29839691|sp|Q9Y8B5|MPPB_LENED RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP; Flags: Precursor
 gi|5006903|gb|AAD37722.1|AF146393_1 mitochondrial processing peptidase beta subunit [Lentinula edodes]
          Length = 466

 Score =  192 bits (487), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 122/436 (27%), Positives = 203/436 (46%), Gaps = 19/436 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
            IS  S+G+TV TE  P   +A V V I AGSR E  + +G AHFLEHM FKGT +R+  
Sbjct: 30  EISTLSNGLTVATESQPHAQTATVGVWIDAGSRAETDKTNGTAHFLEHMAFKGTGRRSQH 89

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +  E+E +G  +NAYTS E T Y+A    + VP+A++II D+L NS      IERER+V
Sbjct: 90  ALELEVENIGAHLNAYTSREQTVYYAKSFSKDVPVAVDIISDILQNSKLESGAIERERDV 149

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    +    + +      + ++ Q +GR ILG    I S   + + S++  NYTAD
Sbjct: 150 ILREQQEVDKQLEEVVFDHLHAVAFQGQPLGRTILGPKNNILSIQRDDLASYIQTNYTAD 209

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIK-------ESMKPAVYVGGEYIQKRDLAE 235
           RM +V  G VDH+  V   E +F+   V+             KP        I+  +L  
Sbjct: 210 RMVLVGTGGVDHQSLVKLAEKHFSSLPVSANPLALGRLSSERKPTFVGSEARIRDDELPT 269

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLC--------YSISAH 287
            H+ +   G  + S D++   ++ SI G+   S     +   R            S  + 
Sbjct: 270 AHVAIAVEGVGWSSPDYFPMMVMQSIFGNWDRSLGASSLLSSRLSHIISSNSLANSFMSF 329

Query: 288 HENFSDNGVLYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQ 346
             ++SD G+  I   +             ++    +     + E+++  +++ A L+ S 
Sbjct: 330 STSYSDTGLWGIYLVSENLMNLDDTLHFTLKEWTRMSIAPTEGEVERAKSQLKAGLLLSL 389

Query: 347 ERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPM 405
           + +   A +I +Q++  G  +   +I + + A++ +DI  VA+K        LA  G  +
Sbjct: 390 DGTTAVAEDIGRQIVTSGKRMTPAQIENAVDAVSVDDIKRVAQKYLWDKDFALAAFG-NI 448

Query: 406 DHVPTTSELIHALEGF 421
           D +     + + +   
Sbjct: 449 DGLKDYGRIRNDMSSM 464


>gi|302833104|ref|XP_002948116.1| hypothetical protein VOLCADRAFT_109656 [Volvox carteri f.
           nagariensis]
 gi|300266918|gb|EFJ51104.1| hypothetical protein VOLCADRAFT_109656 [Volvox carteri f.
           nagariensis]
          Length = 496

 Score =  192 bits (487), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 109/426 (25%), Positives = 201/426 (47%), Gaps = 18/426 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           RI+   +G+ V TE +P  ++  + + I +GSR E    +G+AHFLEH+LFKGT KRT K
Sbjct: 61  RITTLPNGLRVATESIPFAETTTLGIWINSGSRFENDANNGVAHFLEHILFKGTKKRTVK 120

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  E+E +GG +NAYT  E T Y+A V+ + V  A++I+ D+L NS+ +   I+RER+V
Sbjct: 121 DLEVEVENMGGQLNAYTGREQTCYYAKVMAKDVGKAVDILSDILLNSNLDARAIDRERDV 180

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+      S + +        ++   +GR ILG  E I S T ++++ ++  +Y   
Sbjct: 181 ILREMEEVNKQSSELVFDHLHATAFQYSPLGRTILGPVENIKSITRDQLVEYMKTHYRGP 240

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-------MKPAVYVGGEYIQKRDLAE 235
           RM +   GAV+H+  V      F          S                 + +  D  +
Sbjct: 241 RMVLAAAGAVNHDELVKLASDAFGAIPDEDPTTSVRSLLAKEPYRFTGSYVHDRWPDATD 300

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDG--------MSSRLFQEVREKRGLCYSISAH 287
             M + F G ++   D     I+ ++LG           SS +  +     GL  +  A 
Sbjct: 301 CCMAVAFKGASWTDPDSIPLMIMQTMLGAWDKNSTVGKHSSSMLVQTVASEGLADAFMAF 360

Query: 288 HENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
           + N+ D G+  +   T ++       SI+  +  +  ++ + ++ +   ++ A L+  Q+
Sbjct: 361 NTNYHDTGLFGVYGVTDRDRCEDFAYSIMSHLTKMCFDVREADVVRAKNQLKASLMFFQD 420

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK-IFSSTPTLAILGPPMD 406
            +   A  I ++++  G  +   ++   I A+    I  VA + I+     +A +G  + 
Sbjct: 421 STNHVAESIGRELLVYGRRIPKAEMFARIDAVDANTIRAVADRFIYDQDMAVASVG-DVQ 479

Query: 407 HVPTTS 412
            +P  +
Sbjct: 480 FMPDYN 485


>gi|325119067|emb|CBZ54619.1| hypothetical protein NCLIV_050470 [Neospora caninum Liverpool]
          Length = 530

 Score =  192 bits (487), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 110/448 (24%), Positives = 200/448 (44%), Gaps = 36/448 (8%)

Query: 5   ISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            +   +GI V T+ +P   +A V V I +GSR + +E +G AHFLEHM FKGT +R+  +
Sbjct: 78  TTTLPNGIRVATQRLPFHQTATVGVWIDSGSRYDSKETNGAAHFLEHMTFKGTKRRSRIQ 137

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +EIE +G  +NAYTS E T Y+A   K+ +P  ++I+ D+L NS+ +   ++ E++V+
Sbjct: 138 LEQEIENMGAHLNAYTSREQTVYYAKAFKKDLPQCVDILSDILLNSTIDEEAVQMEKHVI 197

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E  + + +  R     ++D  +G  ILG  E I + T   I+ +++RNYT+DR
Sbjct: 198 LREMEEVEKQTEEVIFDRLHTTAFRDSPLGYTILGPEENIRNMTRSHILDYINRNYTSDR 257

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKI-------------------KESMKPAVYVG 224
           M +   G VDH+   + VE +F      K                    +          
Sbjct: 258 MVIAAAGDVDHKELTALVEKHFAAVPQPKKNKIILPTEKPFFCGSELLHRNDDMGPHRPC 317

Query: 225 GEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSR--------------L 270
              I++R +           CA+   D     ++ +I+G                     
Sbjct: 318 RCRIRRRPVEVPRKADLCLRCAWAFADAVTFMLMQAIVGSYRKHDEGIVPGKVSANTTVR 377

Query: 271 FQEVREKRGLCYSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQRE 330
               +   G     SA +  +SD G+    +   +  +      I+  + SL   +   E
Sbjct: 378 NVCNKMMVGCAEMFSAFNTCYSDTGLFGFYAQCDEVALEHCVMEIMFGITSLSYAVTDEE 437

Query: 331 IDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKK 390
           +++  A++  +L+   + +   A +I +Q++  G  +   + +  +  I  E++  VA K
Sbjct: 438 VERAKAQLKTQLLGHLDSTTAVAEDIGRQMLAYGRRMPLAEFLKRLEVIDAEEVKRVAWK 497

Query: 391 IF-SSTPTLAILGPPMDHVPTTSELIHA 417
               +   +A LGP +  +P    +  A
Sbjct: 498 YLHDAEVAVAGLGP-LFGMPQLINIRRA 524


>gi|226366131|ref|YP_002783914.1| M16B family peptidase [Rhodococcus opacus B4]
 gi|226244621|dbj|BAH54969.1| putative M16B family peptidase [Rhodococcus opacus B4]
          Length = 448

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 137/408 (33%), Positives = 210/408 (51%), Gaps = 7/408 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P   SA V V +  GSR+E+    G AHFLEH+LFK T  R+A
Sbjct: 25  VRRTMLPGGLRVVTEYVPGVRSASVGVWVGVGSRDEQPTVAGAAHFLEHLLFKATPSRSA 84

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT ++A VL + +PLA++++ D++       SD++ ER 
Sbjct: 85  LDIAQVMDGVGGELNAFTSKEHTCFYAHVLDDDLPLAIDLVSDVVLRGRCRSSDVDVERQ 144

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+I S T  ++ SF  R YT 
Sbjct: 145 VVLEEISMRDDDPEDLLGDAFLTALYGDHPVGRPVIGSVESIESMTRTQLHSFHVRRYTP 204

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
            RM V   G V+HE  V  V   F          A  +             +  RD  + 
Sbjct: 205 QRMVVAVAGNVEHEHTVELVRRAFAGHLESASEPAPRRGGTLRLRTEPALSLTNRDSEQV 264

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + +G G+SSRLFQEVRE RGL YS+ +  + FSD G 
Sbjct: 265 HLSLGVRAFGRHESHRWALSVLNAAVGGGLSSRLFQEVREIRGLAYSVYSGIDTFSDTGA 324

Query: 297 LYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             I +    EN+  +T+ I EV+     E I   E  +    +   L+   E S  R   
Sbjct: 325 FSIYAGCQPENLGEVTTVIREVLSNVAAEGITDAECARAKGSLRGGLVLGLEDSGSRMHR 384

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           I +  +  G+     + +  I A+T +++  VA+ +       A++GP
Sbjct: 385 IGRSELNYGNHRSITETLGKIDAVTTDEVRDVARVLLQRPFAAAVVGP 432


>gi|229820963|ref|YP_002882489.1| peptidase M16 domain protein [Beutenbergia cavernae DSM 12333]
 gi|229566876|gb|ACQ80727.1| peptidase M16 domain protein [Beutenbergia cavernae DSM 12333]
          Length = 445

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 122/413 (29%), Positives = 212/413 (51%), Gaps = 12/413 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    GI V+TE MP   S  +   I  GSR+E    HG  HFLEH+LFKGT +R A
Sbjct: 21  VRRSVLPGGIRVLTESMPGQRSVSMGAWIAVGSRDEHDGHHGSTHFLEHLLFKGTARRDA 80

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI    + VGG+ NA T  E+T Y+A VL   +P+A+++I DM+++++ +  + E ER 
Sbjct: 81  MEIATAFDAVGGEANASTGKEYTCYYARVLDADLPMAVDVITDMVTSATLDAGEFETERG 140

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEE+ M++DD  D    +F+  V+    +GRPI G P +I S   + +     R Y  
Sbjct: 141 VILEELAMNDDDPSDVAHEQFAAAVFGAHPLGRPIGGTPGSIRSVPRDAVWEHYRRTYAP 200

Query: 182 DRMYVVCVGAVDHEFCVSQV-----ESYFNVCSVAKIKESMKPA-----VYVGGEYIQKR 231
             + V   G+VDHE   +Q+       +    + A +   +           G     +R
Sbjct: 201 PELVVTAAGSVDHEALCAQIADGVAGPWTLDDAAAPVSRRVAGGTVAGLPDAGTAITVRR 260

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
              + +++LG  G        +  ++L ++LG GMSSRLFQEVRE+RGL YS+ +    +
Sbjct: 261 STEQANVVLGAPGLVATDPRRFTMSVLNAVLGGGMSSRLFQEVRERRGLAYSVYSFATGY 320

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSY 350
           ++ G   + +  A   +  +T  + E  +    + I   E+++   ++   L+   E S 
Sbjct: 321 AEAGAFGVYAGCAPSKVADVTRILGEQWEQLAADGITAEELERGVGQLSGSLVLGLEDSG 380

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            R   + +  +  G ++  ++ ++ + A+T +D+  +A ++ +   +L ++GP
Sbjct: 381 SRMSRLGRSEIVFGELVSVDETLERLRAVTADDVRELAAELAAGPRSLVVVGP 433


>gi|308176849|ref|YP_003916255.1| M16 family peptidase [Arthrobacter arilaitensis Re117]
 gi|307744312|emb|CBT75284.1| putative M16 family peptidase [Arthrobacter arilaitensis Re117]
          Length = 456

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 115/412 (27%), Positives = 203/412 (49%), Gaps = 11/412 (2%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R S    G+ V+TE MP   S  V   +  GSR+E    +G  HFLEH+LFKGT KRTA
Sbjct: 36  VRRSILPGGVRVLTEAMPGQRSTTVGFWVPVGSRDEEAGHYGSTHFLEHLLFKGTAKRTA 95

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            EI +  + VGG+ NA T+ E T Y+A VL   +P+AL++I DM++++  +P ++E+ER 
Sbjct: 96  LEIAQSFDAVGGESNAATAKESTCYYARVLDTDLPMALDVIADMVTSAVIDPQELEQERG 155

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EE+ M  DD+ D    RF   V  D  +GRPI G PE I   + E ++     +Y  
Sbjct: 156 VIIEELAMDADDAMDVAHERFVANVLGDHPLGRPIGGTPEEIMEISREAVMEHYRAHYRP 215

Query: 182 DRMYVVCVGAVDHEFCVSQV----ESYFNVCSVAKIKESMKPAVYVGGE-----YIQKRD 232
             + +   G+++H+     V               + E  +              +  R 
Sbjct: 216 GELIITAAGSLEHDKLCELVLKALTEAGWELDPMAVPEPRRMGEPAKINSKAGLEVINRP 275

Query: 233 LAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
             + ++++G  G         +  +L ++LG GMSSRLFQE+REKRGL YS  +    ++
Sbjct: 276 GEQANIIIGCAGITGHDDRRQVLAVLNAVLGGGMSSRLFQEIREKRGLVYSTYSFSAAYT 335

Query: 293 DNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           D G   + +  A      +   +   + +   + I + E+ +   ++    + + E    
Sbjct: 336 DAGYFGMYAGCAPAKAAQVIGLLGAELDRLAKDGITESELAQAKGQLSGGTVLALEDPGS 395

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           R   + +  M  G     ++ +  ++A++ +D+  +A+++ +    + ++GP
Sbjct: 396 RMSRLGRAEMITGEFQDIDEALARVNAVSAQDVQDLARELAAKDRVITVVGP 447


>gi|77919162|ref|YP_356977.1| Zn-dependent peptidase [Pelobacter carbinolicus DSM 2380]
 gi|77545245|gb|ABA88807.1| predicted Zn-dependent peptidase [Pelobacter carbinolicus DSM 2380]
          Length = 419

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 119/404 (29%), Positives = 216/404 (53%), Gaps = 3/404 (0%)

Query: 3   LRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ S   +GI +ITE +P   SA V   +  GSR+E  E+ G++HFLEHMLFKGT  R+A
Sbjct: 2   VQKSVLDNGIRIITERVPGAYSATVGFWVECGSRHESSEQSGVSHFLEHMLFKGTVTRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
             I +EI+ VGG +NA+TS E++ Y+A V   H+ +A++++ D++ NS F+  ++E+ER 
Sbjct: 62  PSIAKEIDAVGGALNAFTSCEYSCYYAKVAGRHLSMAVDLLADIILNSVFDFDELEKERR 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+EI M ED   + +   F+   W++  +GRPI G  +++ S     +++++ + Y  
Sbjct: 122 VILQEIHMLEDSPEECIHEMFTHSFWQEHPLGRPIAGSVQSVQSLERRDLLAYLEKFYCG 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             + +   G V HE  V Q+        V     +  P +      +  +D+ + H  LG
Sbjct: 182 SNLIICVAGDVQHEDLVEQISRLAGDLPVGCKSAAGSPPLTHSTIQVAHKDIEQVHFCLG 241

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
                 +    +  NIL ++LG  MSSRLFQ +RE+RG+ YS+ ++  + SD+G L + +
Sbjct: 242 TRAPDQRHGQRFTGNILNTMLGGSMSSRLFQTLREERGMAYSVYSYLTSHSDSGALVVYA 301

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
            T+   +    + ++  + +     +   E+      I  + + S E +  R   ++K  
Sbjct: 302 GTSASEVQHAINIVLRELSRFQHHEVNPEELQAAKELIKGQFMLSLESTENRMTRLAKNE 361

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGP 403
           ++ G +   ++I++ +  +T EDI+ +  K        L ++GP
Sbjct: 362 IYLGHVQTPDEIVEHVQQVTGEDILQLTGKYLRDEHLNLQMVGP 405


>gi|46107960|ref|XP_381039.1| hypothetical protein FG00863.1 [Gibberella zeae PH-1]
          Length = 474

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 111/433 (25%), Positives = 193/433 (44%), Gaps = 18/433 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           + +   +G+TV TE  P   ++ V V I AGSR E  E +G AHFLEH+ FKGT KRT +
Sbjct: 40  QTTTLKNGLTVATEHSPFSQTSTVGVWIDAGSRAETDENNGTAHFLEHLAFKGTAKRTQQ 99

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  EIE +GG +NAYTS E+T Y A      VP  ++I+ D+L NS    S IERER+V
Sbjct: 100 QLELEIENMGGHLNAYTSRENTVYFAKAFNSDVPQCVDILSDILQNSKLEESAIERERDV 159

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    E    + +        ++ Q +GR ILG  + I   T  ++  ++  NYTAD
Sbjct: 160 ILRESEEVEKQVEEVVFDHLHATAFQHQPLGRTILGPRQNIRDITRTELTDYIKNNYTAD 219

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-----------KESMKPAVYVGGEYIQKR 231
           RM +V  G + HE  V   E +F     +              + M   V V  + +   
Sbjct: 220 RMVLVGAGGIPHEQLVQLAEKHFAGLPSSGPQTGAYLRSKQKADFMGSDVRVRDDNMPTA 279

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENF 291
           ++A     + +N   Y +       +       G +     ++          ++     
Sbjct: 280 NIALAVEGVSWNSEDYFTALVAQAIVGNYDKAVGQAPHQGSKLSGWVHKHDLANSFMSFS 339

Query: 292 SDNGVLYIASAT----AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
           +      +          + +  L    +     L  N+   E ++  A++ A ++ S +
Sbjct: 340 TSYNDTGLWGIYLVSDKPDRVDDLVHFAIREWMRLCTNVSASETERAKAQLKASILLSLD 399

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVA-KKIFSSTPTLAILGPPMD 406
            +   A +I +Q++  G  +   +I   I AIT +DI+  A +K++     ++ +G  ++
Sbjct: 400 GTTAVAEDIGRQLVTTGRRMAPNEIERKIDAITEKDIMDFANRKLWDRDIAVSAVG-TIE 458

Query: 407 HVPTTSELIHALE 419
            +     L + ++
Sbjct: 459 GLFDYQRLRNTMK 471


>gi|301058152|ref|ZP_07199204.1| peptidase M16 inactive domain protein [delta proteobacterium
           NaphS2]
 gi|300447784|gb|EFK11497.1| peptidase M16 inactive domain protein [delta proteobacterium
           NaphS2]
          Length = 889

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 111/424 (26%), Positives = 198/424 (46%), Gaps = 7/424 (1%)

Query: 4   RISKTSSGITVIT-EVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +     +G+TVI  E        V+V ++ GS NE  EE G+ H +EHM+FKGT  +   
Sbjct: 44  KRYTLENGLTVILKEDHSAPVTSVQVWVKTGSANETPEEAGITHQIEHMIFKGTPTKGTG 103

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           EI   +E  GG INAYTS + T Y+  +    +  AL+++ D + NS F+P ++++E+ V
Sbjct: 104 EIARAVETAGGRINAYTSFDRTVYYVEIDSARLDTALDVLLDAVQNSVFDPEELKKEKEV 163

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEE   S D   + L      + +K    GRPI+G  +TI SF  + I+ +V + YT  
Sbjct: 164 VLEEYRRSLDIPENQLSWTIMRLAYKKHPYGRPIIGYEKTIRSFNRKMILKYVDKWYTPK 223

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCS---VAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            M VV VG  + E     ++           A+     +P      + +    + + ++ 
Sbjct: 224 NMVVVAVGDFETEKVFETIKKLVRNFPERTGAEPARPKEPPQTELRKTVINNRVQQAYLD 283

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           + ++  A   +D Y  ++L SILGDG SSRL+  ++    L Y +SA+    +D G+  +
Sbjct: 284 ICWHIPALTHKDIYALDVLESILGDGKSSRLYTGLKMDANLVYHVSANTYALADPGLFSV 343

Query: 300 ASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +    E +    ++I + + +     ++  E+DK      A  +   E    +A  +  
Sbjct: 344 DATLKPEKLKEALAAIGKEISRVARTPVDPSELDKAKTTAEASFVFDMEDMAGQASTLGY 403

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHV-PTTSELIH 416
                G +  ++  +  I  +T EDI+ V++        ++ I+ P    +     E++ 
Sbjct: 404 FQTMTGDMYHADDYLARIKQVTAEDILRVSQTYLRPENLSIGIMVPEGQKIHMDADEVMS 463

Query: 417 ALEG 420
             + 
Sbjct: 464 LFKA 467



 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 86/402 (21%), Positives = 173/402 (43%), Gaps = 7/402 (1%)

Query: 8   TSSGITVIT-EVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVE 66
             +G+ VI  E   +    V      G R E++ E G++ F+  ML +GT KRTA +I  
Sbjct: 488 LKNGMRVIIKENKRVPEVSVVGVFLGGKRLEKEGEWGISDFVAEMLTRGTRKRTAADIAA 547

Query: 67  EIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEE 126
            +E   G ++ ++           L + +   L+++ D++ +++F   +IE+ R  +L  
Sbjct: 548 TVESWAGSLDGFSGRNSVGVSGKFLSKDLYAGLDLLSDVVLHANFPSHEIEKVREDILAA 607

Query: 127 IGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYV 186
           I   +D     L   F + ++     G P  G PETI+  T  ++ ++           +
Sbjct: 608 IRAKKDRPTAQLFELFYKTLYPHYPYGHPSTGTPETINRLTRAELEAWYESIRIPSNFVL 667

Query: 187 VCVGAVDHEFCVSQVESYFNVCSVAK---IKESMKPAVYVGGEYIQKRDLAEEHMMLGFN 243
             VG +D    V  +E+ F     +     +   +P +    +   KR  A+ HM +G+ 
Sbjct: 668 AIVGDLDRNQLVPYLETLFEPFRPSSKILPELEPEPPLTGPRKAHLKRPGAQTHMTVGYL 727

Query: 244 GCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASAT 303
           G   +S +     ++ + L  GM  RLF ++R++R L YS++A      + G   +  A 
Sbjct: 728 GAELKSINNAPMALVDTALS-GMGGRLFSKLRDRRSLAYSVTAFRSPGLETGSFGVYLAC 786

Query: 304 AKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMF 362
             + +     ++   +  L +  + ++E+      +   L    + +  +AL+++   ++
Sbjct: 787 DPDKLQQAEKAVFAELALLRDKGLTEKELTAAKRYLLGNLKIGMQTNGSQALQMALDELY 846

Query: 363 CGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTL-AILGP 403
                   K I+ I ++T +DI    K I      +   +GP
Sbjct: 847 GMGFDHMPKYIERIESVTTDDINRAVKDIILPDRYVFVTVGP 888


>gi|224066099|ref|XP_002198007.1| PREDICTED: similar to ubiquinol-cytochrome c reductase, complex III
           subunit VII [Taeniopygia guttata]
          Length = 481

 Score =  192 bits (486), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 90/432 (20%), Positives = 174/432 (40%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +++   +G+ V +E     +  V V I AGSR E  + +G A F+EHM FKGT KR    
Sbjct: 50  QVTTLENGLRVASEESNQPTCTVGVWIEAGSRYEDTKTNGAAFFMEHMAFKGTKKRPGSA 109

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
             +E+E +G  +N YTS E T+++   L + +P  +E++ D++ N +   S IE+ER V+
Sbjct: 110 FEKEVESLGAHLNGYTSREQTAFYIKALSKDMPKVVELLSDLVQNCALEDSQIEKERGVI 169

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L+E+   + +  D          ++   +   + G  E I   T   + S+V  ++ A R
Sbjct: 170 LQELKEMDSNLADVTFDYLHATAYQGTSLAHTVEGTTENIKRLTRADLASYVDIHFKAPR 229

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV----CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G + H   V   + +F           +               +   L   H+ 
Sbjct: 230 MVLAAAGGISHRELVDAAKQHFTGAPLTHKGDSVPTLKHCRFTGSEIRARDDALPLAHIA 289

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVR--------EKRGLCYSISAHHENF 291
           L   G  +   D  + N+  +I+G    +      +         K  LC+S    + ++
Sbjct: 290 LAVEGPGWADPDNVVLNVANAIIGRYDRTFGGGTNQSSKLATLAVKHNLCHSFEPFNTSY 349

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+      +   ++  +          L  +  + E+ +    +   ++   + +  
Sbjct: 350 SDTGLFGFHFVSDPLSVDDMMFCAQGEWMRLCTSTTESEVTRAKNYLRNAMVAQLDGTTR 409

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
               I   ++  G  +  E+    ISA+    +  V  K      P LA +GP ++ +  
Sbjct: 410 VCENIGSHLLHYGRRIPLEEWDARISAVDARMVRDVCSKYIYDKCPALAAVGP-VEQLLD 468

Query: 411 TSELIHALEGFR 422
            + +   +   R
Sbjct: 469 YNRIRGGMYWVR 480


>gi|111226358|ref|XP_001134518.1| mitochondrial processing peptidase beta subunit [Dictyostelium
           discoideum AX4]
 gi|74955664|sp|Q4W6B5|MPPB_DICDI RecName: Full=Mitochondrial-processing peptidase subunit beta;
           AltName: Full=Beta-MPP
 gi|66267717|dbj|BAD98567.1| beta subunit of mitochondrial processing peptidase [Dictyostelium
           discoideum]
 gi|90970511|gb|EAS66835.1| mitochondrial processing peptidase beta subunit [Dictyostelium
           discoideum AX4]
          Length = 469

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 116/424 (27%), Positives = 196/424 (46%), Gaps = 16/424 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +I+  S+GI V TE    + A V V + +GS  E  + +G+AHFLEHM+FKGT KR   +
Sbjct: 36  KITTLSNGIRVATEQTYGEVASVGVWVDSGSVYETDKNNGVAHFLEHMIFKGTAKRPTPQ 95

Query: 64  -IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I  EIE +GG +NA+TS EH++Y+  VLK++VP A++I+ D+L NS F  S IE+ER+ 
Sbjct: 96  SIETEIENMGGSLNAFTSREHSAYYMKVLKDNVPNAVDILSDILQNSKFETSLIEQERDT 155

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    +    + +  +     ++   +GR ILG  E I S T E+I  F++ NYT D
Sbjct: 156 ILSENDYIQSKEDEVVFDQLHAAAFQGSALGRTILGPVENIKSITREQIQEFINENYTGD 215

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY------IQKRDLAEE 236
           R+ +   GAV+HE  V QV+  F    ++++ + +K A                      
Sbjct: 216 RLVISAAGAVNHEQLVEQVKEKFANVKMSQVSKDVKRAAITNDFIGSELRVRDDEQPLIH 275

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLC-------YSISAHHE 289
             +            F L  I   I          + +    G          S S    
Sbjct: 276 FAVAVRALPWTDPDYFVLELIQTMIGNWNRGIAAGKNIASNLGEIVATEDLAESYSTFFT 335

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
            + D G+         E +  L + +++  Q +  +  + E+++   K+ A  +   + +
Sbjct: 336 CYQDTGLFGNYGVCQPERVDDLVAEMLKEWQRIATSCNKNEVERNKQKLLATTLMQYDGT 395

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHV 408
                 I +Q++  G  L   ++   I+ IT  D+  VA  +    +P +  +GP + + 
Sbjct: 396 SKVCEGIGRQILTLGRRLSPFEVYTRINEITVADVQRVASTLLRDVSPAVTAIGP-IANY 454

Query: 409 PTTS 412
           P  +
Sbjct: 455 PDYN 458


>gi|302039397|ref|YP_003799719.1| putative M16 family Zn-dependent peptidase [Candidatus Nitrospira
           defluvii]
 gi|300607461|emb|CBK43794.1| putative Zn-dependent peptidase, M16 family [Candidatus Nitrospira
           defluvii]
          Length = 417

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 118/405 (29%), Positives = 210/405 (51%), Gaps = 4/405 (0%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            R     + + ++ E++P   S  + + +  GSR+E+  E G++HFLEHM FKGT  RTA
Sbjct: 2   YRKIVLDNRLRIVAELLPTLKSVTIGIWVNVGSRDEQPGEEGLSHFLEHMFFKGTRSRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I  EI+ +GG++NA+T+ E T+++  VL + +  ALE++ D+   S F   ++E+E+ 
Sbjct: 62  TQISREIDALGGEMNAFTTRETTTFYVKVLDQQLEAALELLSDLFYRSRFESKEVEKEKQ 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D +     +       +GRPILG+   I +     ++S+V  +Y  
Sbjct: 122 VVLEEIRMVQDDPEDLVQELHMKHTLGSHPLGRPILGQAPRIQALGRNDLVSYVGSHYDP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEY-IQKRDLAEEHMML 240
           +R  V   G          +  YF+           +    V G   ++++ L + H+ L
Sbjct: 182 ERTVVAVAGNFTWRRLEQLLARYFSDSHKGVAARPSRRPPEVKGGVLVKRKALEQVHLCL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           G  G +   +D Y  + L  +LG  +SSRLFQEVREKRGL YSI +    +SD G+  + 
Sbjct: 242 GLQGLSAGHKDRYAAHALNGVLGGSVSSRLFQEVREKRGLVYSIYSFLSTYSDGGMTTVY 301

Query: 301 SATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           + T  + +  +   +   ++      I+ +++ +   ++   L+ S E S+ R  +++K 
Sbjct: 302 AGTRPKEVERVVEVVCRELKKLRTHGIDAKDLARVKNQMKGSLMLSLESSHSRMSKLAKD 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST-PTLAILGP 403
            +  G+ +  E++I  I  +T + +  VA+ +      ++  LGP
Sbjct: 362 ELTQGNHVSLEQMIAEIDRVTTDQVYRVAQTLLDQRCLSITALGP 406


>gi|111023692|ref|YP_706664.1| metalloendopeptidase [Rhodococcus jostii RHA1]
 gi|110823222|gb|ABG98506.1| metalloendopeptidase [Rhodococcus jostii RHA1]
          Length = 514

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 135/408 (33%), Positives = 210/408 (51%), Gaps = 7/408 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +R +    G+ V+TE +P   SA V V +  GSR+E+    G AHFLEH+LFK T  R+A
Sbjct: 91  VRRTVLPGGLRVVTEYVPGVRSASVGVWVGVGSRDEQPTVAGAAHFLEHLLFKATPSRSA 150

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+TS EHT ++A VL + +PLA++++ D++       +D++ ER 
Sbjct: 151 LDIAQVMDGVGGELNAFTSKEHTCFYAHVLDDDLPLAIDLVSDVVLRGRCRSADVDVERQ 210

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G  E+I S T  ++ SF  R YT 
Sbjct: 211 VVLEEISMRDDDPEDLLGDAFLTALYGDHPVGRPVIGSVESIESMTRTQLHSFHVRRYTP 270

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVC-----SVAKIKESMKPAVYVGGEYIQKRDLAEE 236
            RM V   G V+HE  V  V   F          A  +             +  RD  + 
Sbjct: 271 PRMVVAVAGNVEHEPTVELVRRAFAGHLDSASEPAPRRAGTLRLRAEPTLSLTNRDSEQV 330

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG           +  ++L + +G G+SSRLFQEVRE RGL YS+ +  + FSD G 
Sbjct: 331 HLSLGVRAFGRHESHRWALSVLNAAVGGGLSSRLFQEVREIRGLAYSVYSGIDTFSDTGA 390

Query: 297 LYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALE 355
             I +    EN+  +T+ I EV+     + I   E  +    +   L+   E S  R   
Sbjct: 391 FSIYAGCQPENLGEVTTVIREVLSNVAADGITDAECARAKGSLRGGLVLGLEDSGSRMHR 450

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           I +  +  G+     + +  I A+T +++  VA+ +       A++GP
Sbjct: 451 IGRSELNYGNHRSITETLSKIDAVTTDEVRDVARVLLQRPFGAAVVGP 498


>gi|332655168|ref|ZP_08420909.1| peptidase, M16 family [Ruminococcaceae bacterium D16]
 gi|332516028|gb|EGJ45637.1| peptidase, M16 family [Ruminococcaceae bacterium D16]
          Length = 419

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 128/403 (31%), Positives = 212/403 (52%), Gaps = 5/403 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            R     +G  ++T+ +P   SA +   + AGSR+E   E+G AHF+EHM FKGT  R+A
Sbjct: 2   YRSITLPNGARILTQRIPGVRSAALGFFVGAGSRHELASENGAAHFIEHMSFKGTATRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            ++  E++ +GG +NAYT+ EHT Y+A  L  H+  A++++ DML  S F+  D+E ER 
Sbjct: 62  GDLAREMDAIGGQVNAYTTKEHTCYYARCLDSHLDRAVDLLCDMLFASRFDQRDVEVERG 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+LEEIGM ED   D    R S  V+K   +GRPILG+  T+   T E +  +   +Y  
Sbjct: 122 VILEEIGMYEDTPEDLCAERLSMAVYKGDSLGRPILGRASTLEKMTGEWLRQWQQEHYRP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLG 241
             M V   G+   +   + VE    +              Y     ++K+ + + H++L 
Sbjct: 182 QAMVVSLAGSFTQQHVDALVERLSALPQGPTSPGRQAY--YRSAVTVRKKAIEQNHLILA 239

Query: 242 FNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIAS 301
           F G +Y     Y   +L SILG G SSRLFQ++RE+RGLCYS+ ++  + +D G L I +
Sbjct: 240 FPGLSYLDERRYQLLLLNSILGGGCSSRLFQQLREQRGLCYSVYSYVSDHADTGFLGIYT 299

Query: 302 ATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQV 360
             ++E       ++  +V Q   +   Q E+D+   +  A ++   E    R   +   +
Sbjct: 300 GLSREQEEPALETVRAIVSQLADQGPSQEELDRAREQAKANILMGLESVQARMSHLGSSM 359

Query: 361 MFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILG 402
           +  G +   E+++     +T ED+  ++++IF+    +L+ +G
Sbjct: 360 LLYGRVREPEELLAAYDQVTREDLRTLSQEIFTFPRASLSAVG 402


>gi|118462445|ref|YP_882852.1| protease [Mycobacterium avium 104]
 gi|118163732|gb|ABK64629.1| protease [Mycobacterium avium 104]
          Length = 457

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 133/424 (31%), Positives = 215/424 (50%), Gaps = 7/424 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 34  LRRSTLPGGLRVVTEYLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRTA 93

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 94  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDADLELAVDLVADVVLNGRCAAEDVELERD 153

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +++S T  ++ SF  R YT 
Sbjct: 154 VVLEEIAMRDDDPEDALGDMFLGALFGDHPVGRPVIGTARSVASMTRTQLHSFHVRRYTP 213

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ-----KRDLAEE 236
           +RM V   G VDH+  V+ V  +F    V   +                     RD  + 
Sbjct: 214 ERMVVAVAGNVDHDEVVAMVREHFGPHLVRGRQPIAPRKGAGRVNGRPGLLLGTRDAEQT 273

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG        +  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G 
Sbjct: 274 HVSLGVRTPGRGWQHRWALSVLHTALGGGLSSRLFQEIRELRGLAYSVYSTVDIFADSGA 333

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L + +A   E    + +    V++S+    I + E       +   L+   E S  R   
Sbjct: 334 LSVYAACQPERFAEVMAVTGGVLESVARDGITESECRIAKGSLRGGLVLGLEDSGSRMSR 393

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELI 415
           + +  +  G     E  +  I  ++ +++  +A+++ +     A+LGP         +L 
Sbjct: 394 LGRNELNYGRHRSIEHTLAQIDRVSVDEVNAIARRLLTQRYGAAVLGPYSTKRSLPQQLR 453

Query: 416 HALE 419
             + 
Sbjct: 454 AMVR 457


>gi|126138650|ref|XP_001385848.1| mitochondrial processing protease [Scheffersomyces stipitis CBS
           6054]
 gi|126093126|gb|ABN67819.1| mitochondrial processing protease [Scheffersomyces stipitis CBS
           6054]
          Length = 465

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 114/439 (25%), Positives = 198/439 (45%), Gaps = 22/439 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + S   +G+TV +E MP   +A V V I AGSR +     G AHFLEH+ FKGT KR+
Sbjct: 27  TFQTSVLPNGLTVASESMPGTRTATVGVWINAGSRADNPASSGTAHFLEHLAFKGTNKRS 86

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L+  +   ++I+ D+L+ S      IE ER
Sbjct: 87  QLNLELEIENIGSQINAYTSRENTVYYTKCLETDINQNIDILSDLLTKSKLEERAIENER 146

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+E    +    + +      + +K Q +GR ILG  E I +   + ++++++ NY 
Sbjct: 147 HVILQESDEVDKMYDEVVFDHLHAVAFKSQDLGRTILGPRELIKTIQRDDLVNYITTNYK 206

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM ++ VG V+HE  V Q + YF     ++          P  Y     IQ   L   
Sbjct: 207 GDRMALIGVGCVNHEDLVKQAQKYFGDIKKSEKPFKQSGGDLPVFYGDEIRIQDDSLPTT 266

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR---------------GLC 281
           H+ L   G ++ + DF+  ++   I+G    S                            
Sbjct: 267 HVALAVEGVSWSAPDFFTASVANGIIGTWDRSIGVGSNSPSPLAVTAAIGGAGNTPIANS 326

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  +       + + + + E  +    +I   E+++  A++ A 
Sbjct: 327 YMAYTTSYADTGLMGVYFTADKDANLKLFIDAVMKEWARLKSGDITVEEVERSKAQLKAS 386

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +Q++  G  L  E++ + + AIT +D++  A       P  L+ 
Sbjct: 387 LVLALDDSTAIAEDIGRQLVNTGFRLSPEEVFERVEAITKKDVIDWANYRLKDKPIALSA 446

Query: 401 LGPPMDHVPTTSELIHALE 419
           +G  +  +P+   L   + 
Sbjct: 447 VG-NVKTLPSHQYLTKGMS 464


>gi|115942954|ref|XP_001176678.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           isoform 1 [Strongylocentrotus purpuratus]
 gi|115953922|ref|XP_001177664.1| PREDICTED: similar to Peptidase (mitochondrial processing) beta
           isoform 1 [Strongylocentrotus purpuratus]
          Length = 487

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 101/412 (24%), Positives = 188/412 (45%), Gaps = 12/412 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++  ++G  V +E   I +A V + I AGSR E  + +G+AH+LEHM FKGT+ RT  E
Sbjct: 46  RVTTLNNGFRVSSEDSGIPTATVGLWIDAGSRYENAKNNGVAHYLEHMAFKGTSNRTQME 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           +  EIE +G  +NAYTS E T Y+A   +  VP A+EI+ D++ NS+   ++IERER V+
Sbjct: 106 LELEIENMGAHLNAYTSREQTVYYAKCFESDVPRAVEILADIIQNSTLGEAEIERERGVI 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E +  + +        ++   +GR ILG  E I S   + + +++S +Y   R
Sbjct: 166 LREMQEVETNLQEVIFDHLHATAYQGTPLGRTILGPTENIRSINRDDLQNYISTHYKGPR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYFNV---CSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           + +   G V+H+  V   E +F         +I           G  ++   +   H+ L
Sbjct: 226 IVLSGAGGVNHDELVKLAEKHFGNLGTEYENEIPALTPCRFTGSGITVRDDKMPLAHIAL 285

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENFS 292
              G  +   D     +  +++G    S         R         +C+S  A +  ++
Sbjct: 286 CVEGVGWAHPDNIPLMVANTLIGSWDRSFGGGANTSSRLARVAYEDNICHSFQAFNTCYT 345

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+  +   +   ++  +   +      L  ++ + E+ +    +   ++   + S   
Sbjct: 346 DTGLWGVYMVSDPLSVEDMVYHVQNQWMYLCTSVTESEVARAKNLLRTNMLLQLDGSTPI 405

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGP 403
             +I +Q++  G  +   ++   I +I+ + I  V  +      P +A +G 
Sbjct: 406 CEDIGRQMLCYGRRIPLPELEARIDSISAKTIRDVCTRYIYDKCPAVAGVGK 457


>gi|253583479|ref|ZP_04860677.1| zinc protease [Fusobacterium varium ATCC 27725]
 gi|251834051|gb|EES62614.1| zinc protease [Fusobacterium varium ATCC 27725]
          Length = 407

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 117/408 (28%), Positives = 203/408 (49%), Gaps = 4/408 (0%)

Query: 1   MNLRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MN+ I K  +GI V+ E    + +  + + ++ GSRNE  +E G++HF+EHM+FKGT  R
Sbjct: 1   MNIEIRKLDNGIPVLMENIDSVSTVSLGIFVKTGSRNEYPDESGVSHFIEHMMFKGTKNR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +AKEI E I+  GG INAYTS + T+Y+  +L   +   ++++ DM  NS+F   ++++E
Sbjct: 61  SAKEISELIDNEGGLINAYTSRDTTAYYIQMLSSKIDTGIDVLSDMFLNSTFTQENLDKE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           RNV++EEI M +D   + +    +       +    +LG  E++++ T EK + +    Y
Sbjct: 121 RNVIIEEIRMYDDIPEE-IVHDENVKYAITGVQSNIVLGTIESLNNITREKFLKYFDEQY 179

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQK-RDLAEEHM 238
            A  + V   G +D +  V+++         +  K  M  +  +     +  ++  + H+
Sbjct: 180 IASNLVVSVAGKIDFDHVVAELNKGLGKFRDSNFKRDMDTSFTINHGENRIKKETNQVHL 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
                G +      Y   I++S+L   MSSRLFQ++RE+RGL YS+ ++   F + G+  
Sbjct: 240 CFNTRGNSQIEDMKYPGAIISSVLAGNMSSRLFQKIREERGLAYSVYSYGTAFIEGGLFT 299

Query: 299 IASATAKENIMALTSSIV-EVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T KE+   +   I  E        I   E+ K   +  + L  S E S  +   ++
Sbjct: 300 IYAGTTKESYQEVIDIIKAEFEDIKKNGITPYELQKSKNQFLSMLTFSLENSKGKMTRMA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPM 405
              M  G +   ++II  I  IT EDI   A+ +F        +   +
Sbjct: 360 STYMLYGRVTEIDEIISKIENITLEDIKKTAEYLFQEEFYSCTILGDI 407


>gi|193213779|ref|YP_001994978.1| processing peptidase [Chloroherpeton thalassium ATCC 35110]
 gi|193087256|gb|ACF12531.1| processing peptidase [Chloroherpeton thalassium ATCC 35110]
          Length = 429

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/406 (27%), Positives = 219/406 (53%), Gaps = 6/406 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +   +G+TVITE +P   S  V +    GSR+E  E +G AHF+EHM+FKGT+KR  
Sbjct: 19  VQKTVLPNGLTVITEHVPGVRSLSVGLWTNTGSRDETPENNGAAHFIEHMVFKGTSKRDY 78

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + +E VGG +NA+T+ EHT ++A  L EH+ + ++++ D++   +F   ++E+E++
Sbjct: 79  IQISKSLESVGGYLNAFTTKEHTCFYARSLAEHLKITIDVLTDLVFRPTFPEEELEKEKD 138

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI  +ED   D +   F + +++   +G PI G  E++ + T    I+F+   Y  
Sbjct: 139 VIIEEIKSTEDTPDDLIFDDFDKFLFESHPLGLPIAGTEESVDALTRNDTIAFLKACYRP 198

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAK--IKESMKPAVYVGGEYIQKRDLAEEHMM 239
           ++M +V  G + H+  ++  E +          ++++     Y        + + + H++
Sbjct: 199 EKMLLVGTGNLTHDALLNFAECFVPKRKTKPKSVRQTYDFGQYQPFTKEIAKPIQQAHIL 258

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +G        ++++   +L ++LG GMSSRL   +REK GL YS+ +    F +     I
Sbjct: 259 IGAPYI-RDDKNYFSAILLNTLLGGGMSSRLNLSLREKHGLVYSVFSSISTFDEINTFSI 317

Query: 300 ASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            + T K+ +    + I E + Q L +N+ +RE+D   A++   +I  QE    R   +++
Sbjct: 318 YAGTDKDKVKKTVALIHEELGQLLGKNVPKRELDLAKAQLKGAVIMGQESVSKRQSHLAR 377

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFS-STPTLAILGP 403
              + G     +++I+ + +++ +DI  VA+++   S  +  I  P
Sbjct: 378 DHYYFGRDFSFDELIEMVESVSAKDIRSVAEQMLDASKFSTLIYQP 423


>gi|124515693|gb|EAY57202.1| Processing peptidase [Leptospirillum rubarum]
          Length = 411

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 133/407 (32%), Positives = 223/407 (54%), Gaps = 4/407 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M  +    ++G+ V  + MP   +A + V +R GSR E  EE G+ HFLEHM FKGTT R
Sbjct: 1   MPYKEHTLANGVRVYWDPMPESRAASIGVWVRTGSRFEAAEEGGVTHFLEHMCFKGTTTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A++I  E++ +GG++NA+TS E TS++A VL E+   A  ++GD+L+NS F+P ++ERE
Sbjct: 61  SAEDIANEMDFLGGEMNAFTSQEVTSFYATVLTENSRQAGNLLGDILTNSVFDPVELERE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R VVLEE+  S+DD  D +      + + D   G PILG  E+I+ F+   +  +  ++Y
Sbjct: 121 RGVVLEELAESKDDPEDRVMENLFRIYFGDHPFGAPILGTEESITRFSRLSVREYFKKHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKI-KESMKPAVYVGGEYIQKRDLAEEHM 238
               ++V   G V  +  +  +E+ F   SV  +    +   V       ++ D  + H+
Sbjct: 181 HPGNLFVTIAGNVHWDEVIDALENAFQNISVRNLSSSPLTTPVPTFSRMEEEDDYEQVHL 240

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            LG  G            +L + LG GMSSRLFQEVREKRGL YS+ +   +FSD G++ 
Sbjct: 241 CLGLRGLPQPHPRQTALRVLTTHLGGGMSSRLFQEVREKRGLAYSVFSSPLSFSDGGIVR 300

Query: 299 IASATAKENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I+++T       L S +VE ++      +   E+ +   ++ + L+   E +  R  ++ 
Sbjct: 301 ISASTRPSRREELASVLVEELRRLEKIPLTSSELTRSKNQLKSSLLLGLESAGGRMSKMG 360

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGP 403
           + ++  G  +   +I   I  +T EDI+ +A+++ +     +++LGP
Sbjct: 361 RDLLNWGREIAVTEIEQWIDQVTAEDILHLAQELKWGEEQAISVLGP 407


>gi|322712068|gb|EFZ03641.1| mitochondrial processing peptidase beta subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 514

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/433 (26%), Positives = 200/433 (46%), Gaps = 18/433 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           + +   +G+TV TE  P   ++ V V I AGSR E  E +G AHFLEH+ FKGT KR+ +
Sbjct: 80  QTTTLKNGLTVATEHSPWAQTSTVGVWIDAGSRAETDENNGTAHFLEHLAFKGTAKRSQQ 139

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  EIE +GG +NAYTS E+T Y A      VP  ++I+ D+L NS    S IERER+V
Sbjct: 140 QLELEIENMGGHLNAYTSRENTVYFAKAFNSDVPQCVDILSDILQNSKLEESAIERERDV 199

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    E    + +        ++ Q +GR ILG  + I   T  ++ S++  NYTAD
Sbjct: 200 ILRESEEVEKQVEEVVFDHLHATAFQHQPLGRTILGPRQNIRDITRTELTSYIKNNYTAD 259

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK-----------PAVYVGGEYIQKR 231
           RM +V  G + HE  V   E +F        +                 V V  + +   
Sbjct: 260 RMVLVGAGGIPHEQLVELAEKHFAGLPAKSPENQAYLLSKQKADFIGSDVRVRDDTMGTA 319

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQE---VREKRGLCYSISAHH 288
           ++A     + ++   Y +       +       G +     +   +  +  L  +  +  
Sbjct: 320 NVALAVEGVSWSSDDYFTALVTQAIVGNYDKAMGNAPNQGSKLSGLVHRHELANNFMSFS 379

Query: 289 ENFSDNGVLYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
            ++SD G+  I   T        L    +     L  N+ + E+++  A++ A ++ S +
Sbjct: 380 TSYSDTGLWGIYLTTDNITRLDDLVHFTMREWMRLCTNVGEAEVERAKAQLKASILLSLD 439

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVA-KKIFSSTPTLAILGPPMD 406
            +   A +I +Q++  G  +   +I   I AIT ++++  A +K++     ++ +G  ++
Sbjct: 440 GTTAVAEDIGRQLITTGRRMMPGEIERRIDAITEKEVMDFANRKLWDKDIAISAVG-NIE 498

Query: 407 HVPTTSELIHALE 419
            +     L + ++
Sbjct: 499 ALFDYQRLRNTMK 511


>gi|251772267|gb|EES52837.1| Processing peptidase [Leptospirillum ferrodiazotrophum]
          Length = 411

 Score =  191 bits (484), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 135/411 (32%), Positives = 222/411 (54%), Gaps = 5/411 (1%)

Query: 1   MNLRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M       S+G+ V ++      SA + V +RAGSR E  +E GM HFLEHM FKGT  R
Sbjct: 1   MPYIKHTLSNGLAVYSDPVTSSRSAAIGVWVRAGSRYESPKEAGMTHFLEHMCFKGTPSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
            A+EI  E++ +GG++NA+TS E T ++A +L E+V  A  ++GD+L+ S F+  +++RE
Sbjct: 61  NAQEIANEMDFLGGEMNAFTSQEMTCFYAHLLTENVSRAALLLGDLLTRSVFDGEELDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R VV+EEI  S DD  D +     E  +    + RPILG  E++SSF+ E + S+  RNY
Sbjct: 121 RGVVIEEIAESRDDPDDLVTQNLYEAHFGSHPLSRPILGTEESLSSFSREDVQSYFRRNY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRD--LAEEH 237
            +  M+V   G          +E  F+    A  +     + ++      +++  L + H
Sbjct: 181 HSGSMFVTVSGRFSWPSLRESLEQAFSDLPQAPSQRMEDRSAFLPAYGKTQKEKKLEQVH 240

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + +G  G      D  L  +L   LG GMSSRLFQEVREKRGL YS+ +  ++F+D G++
Sbjct: 241 VAIGMPGLPVAHPDQTLLRLLNVHLGGGMSSRLFQEVREKRGLAYSVYSTGQSFADGGLV 300

Query: 298 YIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I+++T       L   + E + +     +   E+ +   ++ + L+   E    R  ++
Sbjct: 301 RISASTRPSKKRELLEILGEEIARLESVPLTDEELSRAKNQVKSSLLLGLESIGTRMNKM 360

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMD 406
            + +++ G  +  E I   I + T EDI+ +A+   FS++ +L++LGP  +
Sbjct: 361 GRDILYWGEEVPVETIEARIDSATPEDILRLARAQGFSASRSLSVLGPEKE 411


>gi|126335781|ref|XP_001367487.1| PREDICTED: similar to core I protein [Monodelphis domestica]
          Length = 481

 Score =  190 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 98/433 (22%), Positives = 185/433 (42%), Gaps = 15/433 (3%)

Query: 4   RISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +++   SG+ V +E      +  V V I  GSR E +  +G A+F+EH+ FKGT  R  +
Sbjct: 49  QVTTLDSGLRVASEDYSRHPTCTVGVWIDVGSRYEHEANNGAAYFVEHLAFKGTKNRPGR 108

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            + EEIEK+G  +NAYT+ EHT+Y+   L + +P A+EI+GD++ N S   S IE+ERNV
Sbjct: 109 ALEEEIEKMGAHLNAYTTREHTAYYIKALSKDLPKAVEILGDIVQNCSLEDSQIEKERNV 168

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L+E+  S++   D +        ++   + + + G  E     + + +  F+  +Y A 
Sbjct: 169 ILQEMQESDNSLRDVVFDYLHATAYQGTPLAQAVEGPSENARKLSRQDLTEFIETHYKAP 228

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVA----KIKESMKPAVYVGGEYIQKRDLAEEHM 238
           RM +   G V H+  V     +F+    +     +               +   L   H+
Sbjct: 229 RMVLAAAGDVKHKQLVDLAAKHFSNVPTSYAEDAVPLPSSCRFTGSEIRHRDDALPLAHV 288

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREK--------RGLCYSISAHHEN 290
            +   G  + + D     +  SI+G    +      +            +C S    +  
Sbjct: 289 AMAVEGPGWANPDNVALLVANSIIGHYDCTYGGGVHQSSPLASVSAANKVCQSFQTFNIC 348

Query: 291 FSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSY 350
           +S+ G+  I   T + NI  +   +      L  +  + ++ +    +   L+   + + 
Sbjct: 349 YSETGLFGIHFVTDRMNIDDMVFFLQGQWMRLCTSATESDVMRGKNILRNALVSHLDGTT 408

Query: 351 LRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVP 409
               +I + ++  G  +   +    IS I    I  V  K      P +A +GP ++ +P
Sbjct: 409 PVCEDIGRSLLTYGRRISLSEWESRISDIDASVIREVCSKYLYDQCPAVAAVGP-IEQLP 467

Query: 410 TTSELIHALEGFR 422
             + +   +   R
Sbjct: 468 DYNRIRSGMFWLR 480


>gi|62859721|ref|NP_001016710.1| ubiquinol-cytochrome c reductase core protein I [Xenopus (Silurana)
           tropicalis]
 gi|89267876|emb|CAJ83320.1| ubiquinol-cytochrome c reductase core protein I [Xenopus (Silurana)
           tropicalis]
          Length = 478

 Score =  190 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 96/432 (22%), Positives = 185/432 (42%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           +IS  ++G+ V +E     +  V V I  GSR E  + +G  +FLEH+ FKGT KR    
Sbjct: 47  QISSLANGLRVASEESGQATCTVGVWIGTGSRYENDKNNGAGYFLEHLAFKGTKKRPQAA 106

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +E+E +G  +NAYT+ E T+ +     + +P A+EI+ D++ N S   S IE+ER+V+
Sbjct: 107 LEQEVESLGAHLNAYTTREQTAIYIKAQSQDLPKAVEILADVVQNCSLEDSQIEKERHVI 166

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   + +  + +        ++   +GR ++G  E         ++ +VS ++ A R
Sbjct: 167 LREMQEIDSNLQEVVFDYLHATAYQGTALGRTVVGPSENARRLNRADLVDYVSSHFKAPR 226

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G V+H+      + +F           +               +  DL   H+ 
Sbjct: 227 MVLAAAGGVNHKELCDLAQRHFSGLSYEYEKDAVPLLPPCRFTGSEIRARNDDLPLAHLA 286

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEV--------REKRGLCYSISAHHENF 291
           +   G  + S D     +  +I+G    +    +           +  LC S    H  +
Sbjct: 287 IAVEGPGWNSSDNIPLLVANAIVGSYHVTYGGGKNLSSRVASVAAEHKLCQSFQPFHIRY 346

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+  +   T + NI  +          L   +   E+ +    +   L+   + +  
Sbjct: 347 SDTGLFGLHFVTDRHNIEDMLHIAQGEWMRLCTGVTDSEVAQAKNALKTALLAQLDGTTP 406

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              +I +QV+  G  +  E++   I A++ + +  +  K      P +A +GP ++ +P 
Sbjct: 407 VCEDIGRQVLTLGQRISLEELNARIDAVSAKKVSEICSKYLYDKCPAVAGVGP-IEQIPD 465

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 466 YNRIRSAMYWLR 477


>gi|31213235|ref|XP_315561.1| AGAP005558-PA [Anopheles gambiae str. PEST]
 gi|21299699|gb|EAA11844.1| AGAP005558-PA [Anopheles gambiae str. PEST]
          Length = 472

 Score =  190 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 86/432 (19%), Positives = 180/432 (41%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
            ++   SG+ V +E +P   A V + I AGSR E +  +G A+F EH+ FKGTTKR+   
Sbjct: 41  EVTTLDSGLRVASESVPSQVATVGLFIDAGSRYEDKHSNGTANFFEHLAFKGTTKRSQSA 100

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +E+E +G  ++A T  + TS+ A  L + VP  +EI+ D++ N   + +D++R R V+
Sbjct: 101 LEQEVESMGAQLDASTGRDQTSFTARCLSKDVPKLVEILADVVQNPRLDDADVKRAREVI 160

Query: 124 -LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
             E   +   +  + +        ++   +   + G    I S   + +  +V+ +Y A 
Sbjct: 161 LGEIEQVDAGNLREVVFDHLHSTAFQGTSLSNTVWGPSSNIRSIKADDVRGYVNSHYKAP 220

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSV---AKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           RM +   G V         E +          K  +            ++   L   ++ 
Sbjct: 221 RMVLAAAGDVRQAELEKLAEKHLGKIESTFDGKAPQLSPVRFTGSEMRVRDDSLPLAYVA 280

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   GC     D    ++ ++++G    +         +         LC++  + +  +
Sbjct: 281 VAVEGCGVSDSDAMALSVASALIGTWDRTFGGGVNNASKLAVASAHDKLCHNFESFNLTY 340

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
            D G+  I           +  ++      L   +   E+++   ++  +L+   E  + 
Sbjct: 341 RDTGLWGIYFECDPLMCEDMLFNVQNEWMRLCTMVTDGEVERAKRQLKTRLLAQLEGPHA 400

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPT 410
              +I +QV+  G       +   I  +T +++  VA +  F   P +A +GP ++++P 
Sbjct: 401 ICEDIGRQVLALGRREPLHDVERRIENVTAQNVRDVAMRYIFDRCPAVAAVGP-VENLPD 459

Query: 411 TSELIHALEGFR 422
              +  ++   R
Sbjct: 460 YMRIRSSMYWTR 471


>gi|223937580|ref|ZP_03629483.1| peptidase M16 domain protein [bacterium Ellin514]
 gi|223893743|gb|EEF60201.1| peptidase M16 domain protein [bacterium Ellin514]
          Length = 420

 Score =  190 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 115/419 (27%), Positives = 207/419 (49%), Gaps = 4/419 (0%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            ++++  +G+TV+T  MP + S  + + +  G R E  E +G+ HF+EH+LFKGT KRTA
Sbjct: 2   YQVTQLKNGLTVVTAEMPYMTSVSLGLWVGVGGRYEPAELNGVCHFIEHLLFKGTKKRTA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I E++E +GG +NA+TS E T YH+    +H    L+++ DM  NS F+P DI +ER 
Sbjct: 62  RDISEDVEGIGGYMNAFTSEEVTCYHSRARYDHFDDLLDVLVDMFLNSRFDPEDINKERG 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+ EE+ M  D     +    +E  W  Q +GRP+ G  +T+   +   +I ++ RNY A
Sbjct: 122 VIKEELAMYLDQPQHLVQELLNETHWPGQPLGRPLTGTEKTLDGLSRPLVIDYLKRNYVA 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKE--SMKPAVYVGGEYIQKRDLAEEHMM 239
           +R  +   G + H+  V  V             +   +          +  ++  +  + 
Sbjct: 182 NRTVIAAAGRLKHKQIVKAVSRIAPRFPQGPHPKFVPVIEDQQAPRIRLHTKETEQTQIA 241

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           LG + C+      +   +L +ILG+ MSSRLFQ +RE  GL YS+ +    F D G + I
Sbjct: 242 LGISTCSRHDPRRHALRLLNTILGENMSSRLFQVLREDLGLAYSVYSSPSYFEDTGTITI 301

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIE-QREIDKECAKIHAKLIKSQERSYLRALEISK 358
           ++    +N+      I+  ++ L +    Q E  +    I  ++    E +  R + + +
Sbjct: 302 SAGLDLKNLNKALKLIIHELKRLTDTAPGQAEFRRARDYIIGQIDLGLESTDNRMMWLGE 361

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHA 417
           Q +  G I+  +++   +S +T  ++  VA++          L  P+ +     +L+  
Sbjct: 362 QFLGYGKIMSPQEMKRRVSQVTPAEVRAVAREFLRPEHLNLALVSPLKNDKALHKLLSM 420


>gi|302874670|ref|YP_003843303.1| peptidase M16 domain-containing protein [Clostridium cellulovorans
           743B]
 gi|307690716|ref|ZP_07633162.1| peptidase M16 domain-containing protein [Clostridium cellulovorans
           743B]
 gi|302577527|gb|ADL51539.1| peptidase M16 domain protein [Clostridium cellulovorans 743B]
          Length = 416

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 128/418 (30%), Positives = 211/418 (50%), Gaps = 13/418 (3%)

Query: 7   KTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIV 65
              +G+ V+ E    + S  V + +  GSRNE  E +G++HF+EHMLFKGT  R AKEIV
Sbjct: 6   TIDNGLRVVLENIDHVSSVSVGLWVENGSRNETAESNGISHFIEHMLFKGTYNRNAKEIV 65

Query: 66  EEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLE 125
           E IE  GG INA+T  E T Y+   L  H+  +  ++ DM+ NS F+P DIERE+ VV+E
Sbjct: 66  EAIEDYGGQINAFTGKEATCYYTKTLDSHMERSFGVLSDMIFNSKFDPVDIEREKKVVIE 125

Query: 126 EIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMY 185
           EI MSED   D L    S  +W D  I  PILG  ET+ SFT E+++ ++   Y  +   
Sbjct: 126 EINMSEDSPEDVLSDLHSIAIWGDDPIALPILGTEETVKSFTREQLLEYIECRYIPENCV 185

Query: 186 VVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAV-YVGGEYIQKRDLAEEHMMLGFNG 244
           +   G +D +     V  YF   S    K +      +     ++++ + + H+ LG  G
Sbjct: 186 LSICGNIDFDVTTKLVNKYFGSWSSKNKKVTKHSTPIFQNKFLVKQKPIEQVHLSLGIKG 245

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
               +RD Y  +++ ++ G   SS LFQ++RE+RG+CYSI +++  + + G++ + +   
Sbjct: 246 IETGNRDNYPLHVINNVFGGTASSILFQKLREERGMCYSIYSYNSPYMNTGIMNVYAGLN 305

Query: 305 KENIMALTSSIVEVVQS-LLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
            ++       I   +   + + I +  ++K   ++    +   E +  +     K  +F 
Sbjct: 306 PKDTKEAIIQIKNELSILVEKGISKETLNKTKEQLKGNYMLGLESTSNKMFANGKNALFL 365

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTL---AILGPPMDHVPTTSELIHAL 418
             I   + I+  I+ IT EDI  V K  F     +   A++G  +D      +++   
Sbjct: 366 NRINTPKDIMKKINDITLEDINRVMKNTFGEG--IINGALVGDNID-----DDILKIF 416


>gi|300024405|ref|YP_003757016.1| processing peptidase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526226|gb|ADJ24695.1| processing peptidase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 433

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 137/421 (32%), Positives = 228/421 (54%), Gaps = 3/421 (0%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           M   ++  S+G+ V T  MP +++  + V +  GSR+ER ++HG++HFLEHM FKGT  R
Sbjct: 1   MTTELTTLSNGVRVATHRMPNLETVSLGVWVAVGSRHERDDQHGLSHFLEHMAFKGTKSR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +A+ I E IE VGGD+NA T L+ T+Y+A VLK    +ALE+I D+L NS F P D++RE
Sbjct: 61  SARMIAETIESVGGDLNAATGLDTTAYYARVLKGDEGVALELIADILLNSKFAPEDLDRE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+ +EI  ++D   D +      + + +Q IGRPILG   ++  F    +  ++  +Y
Sbjct: 121 RVVIQQEIASTDDSPDDIIFDLMQSVAFPEQAIGRPILGTKASVGRFRAADLSGYLDEHY 180

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
             + + V   GAV H+  V  VE+ F   +  + + +   A Y GG     +   + H++
Sbjct: 181 LPEAIVVSAAGAVHHDEIVRHVEALFGGLTQRR-RGTESLARYRGGSTASAKPFEQSHVL 239

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           +G    +     FY   + + +LG GMSSRLFQEVRE RGLCYSI +      D G+L +
Sbjct: 240 IGLPSPSCLEPAFYTAQVFSGLLGGGMSSRLFQEVREDRGLCYSIYSTVWGVKDTGMLAV 299

Query: 300 ASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEISK 358
            +AT  E +  L + +     SL +      E+ +  A++ A L+ + E S + A ++++
Sbjct: 300 HAATGPEMVDELAAVVAGEFASLADAGPTDAELLRAKAQLKAGLLMALESSSVNAEQMAR 359

Query: 359 QVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIHAL 418
           Q++     +   ++ID + A+  + I   A  + S + ++A++G         + +    
Sbjct: 360 QLLAQDRFVAMSELIDEVEAVDRDRIRDFAGSLRSESASVAVIGSGRKSAAQATRVAALF 419

Query: 419 E 419
            
Sbjct: 420 N 420


>gi|269956018|ref|YP_003325807.1| peptidase M16 domain-containing protein [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269304699|gb|ACZ30249.1| peptidase M16 domain protein [Xylanimonas cellulosilytica DSM
           15894]
          Length = 442

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 124/418 (29%), Positives = 207/418 (49%), Gaps = 13/418 (3%)

Query: 2   NLRISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +R S    G+ V+TE MP   SA V   +  GSR+E     G  HFLEH+LFKGT +R+
Sbjct: 25  TIRRSVLPGGVRVLTEHMPGQRSATVGAWVGVGSRDESDGHFGSTHFLEHLLFKGTARRS 84

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A +I E  + VGG+ NA T  EHT Y+A VL   +P+A+++I DM++++  +  ++E ER
Sbjct: 85  AMDIAEAFDAVGGEANAATGKEHTCYYARVLDSDLPMAIDVISDMVTSARLDTDELETER 144

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+LEE+ M++DD  D +   FS+ V     +GRPI G P+TI +   + +      +Y 
Sbjct: 145 GVILEELAMNDDDPSDVVHEEFSQAVLGTHPLGRPIGGTPDTIRAVPRDAVWEHYRWHYR 204

Query: 181 ADRMYVVCVGAVDHE-----------FCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ 229
            + + V   G VDH+                +E                     G     
Sbjct: 205 PETLVVAAAGGVDHDTVVGQVVDALAHGGWSLEEAVAPRERRVADAVTDGVPTEGIALSI 264

Query: 230 KRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHE 289
           +R + + ++++G  G +      +  ++L+++LG GMSSRLFQE+REKRGL YS  +   
Sbjct: 265 RRTVEQANVIVGSTGLSATDDRRFALSVLSAVLGGGMSSRLFQEIREKRGLAYSTYSFAA 324

Query: 290 NFSDNGVLYIASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQER 348
                G   + +  A   +  +   + E + +   + I   E+++   ++   L+   E 
Sbjct: 325 GHGGLGTFGLYAGCAPGKVDIVEKLLHEELDRLAADGITTAELERSVGQLSGGLVLGLED 384

Query: 349 SYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMD 406
           S  R   + K  +  G IL   + +D I A+T +D+  +A+ + S   ++  +GP  D
Sbjct: 385 SGSRMSRLGKAELVFGEILSLSESLDRIRAVTADDVRELAQDLASRPRSVVRVGPFGD 442


>gi|312194992|ref|YP_004015053.1| peptidase M16 domain protein [Frankia sp. EuI1c]
 gi|311226328|gb|ADP79183.1| peptidase M16 domain protein [Frankia sp. EuI1c]
          Length = 450

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 129/407 (31%), Positives = 215/407 (52%), Gaps = 7/407 (1%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P   SA + V +  GSR+E     G +HFLEH+LFKGT  R A 
Sbjct: 32  RRTVLPGGLRVLTEQVPGVRSAAIGVWVGVGSRDEDPATAGCSHFLEHLLFKGTPSRDAL 91

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            I   +E VGGD+NA+T+ E+T Y+A VL E +P+A++++ DM++NS    +D+E ER V
Sbjct: 92  TISASVEAVGGDLNAFTAKEYTCYYARVLDEDLPMAIDVVCDMVANSVITAADVEAERGV 151

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +LEEI M EDD  D +   F+E V     +GRP+LG  ++I +   + I  +    YTA 
Sbjct: 152 ILEEIAMHEDDPGDVVHDVFAEAVLGSSSLGRPVLGTIDSIEALHRDTIAEYYRGRYTAP 211

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAK-----IKESMKPAVYVGGEYIQKRDLAEEH 237
            + V   G +DH+  ++ V   F             +          G  + +R   + +
Sbjct: 212 ALVVAVAGNIDHDRTLAMVAEAFADRLAGPADSAGPRGGAYGYPGKPGLLVSRRPTEQAN 271

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           ++LG  G + +    +   +L++ LG GMSSRLFQEVREKRGL YS+ +   +F+D G+ 
Sbjct: 272 VVLGTAGMSRRDPRRFALGLLSTALGGGMSSRLFQEVREKRGLAYSVYSFATHFADAGLF 331

Query: 298 YIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + +  A +    +     + V+ +    I Q E+D+   +    L+   E +  R   +
Sbjct: 332 GLYAGCAPKRAREVLEICRDEVRQIAERGITQEELDRARGQTRGSLVLGLEDTGSRMSRL 391

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
            K  +  G +L  ++++  + A+T  D+  +A ++ +    L ++GP
Sbjct: 392 GKGELVHGELLSVDEVLARVDAVTLGDVQAIAGELVAQPWGLGVIGP 438


>gi|303280808|ref|XP_003059696.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458351|gb|EEH55648.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 504

 Score =  190 bits (482), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 120/428 (28%), Positives = 207/428 (48%), Gaps = 20/428 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           +++  ++G+ V TE  P  ++A V V I AGSR E    +G AHFLEHM FKGT KRT  
Sbjct: 74  KVTTLANGMRVATEETPFAETATVGVWIDAGSRYETAANNGTAHFLEHMAFKGTAKRTTA 133

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            + EE+E +G  +NAYTS E T+Y+A V K+ VP A++I+ D+L NSS     IERER V
Sbjct: 134 GLEEEVENLGAHLNAYTSREQTTYYAKVFKKDVPNAVDILSDILQNSSLEQRHIERERGV 193

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   E +  + L        ++   +GR ILG  + + + T E + +++ ++YTA 
Sbjct: 194 ILREMEEVEKEVEEVLFDHLHATAFQQTGLGRTILGSADNVRNITKENLSTYIKQHYTAP 253

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKP-------AVYVGGEYIQKRDLAE 235
           RM +V  GAVDH+  V   E  F+      + ES++                I+  D+  
Sbjct: 254 RMVLVGTGAVDHDALVKLAEGAFSNLPSGDLGESVRKLVSGDPAHFTGSDVRIRDDDMPN 313

Query: 236 EHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQ--------EVREKRGLCYSISAH 287
               + F G ++ S D     ++ ++LG    +            +      L  S  A 
Sbjct: 314 TSFCVAFKGASWTSPDAVPLMVMQAMLGSWDKAAAGAGHAGSDLAQDMHSNNLANSYMAF 373

Query: 288 HENFSDNGVLYIASATAKENIMALTSS-IVEVVQSLLENIEQREIDKECAKIHAKLIKSQ 346
           + N++D G+  +   T     +   +  ++  +++L+ + +  ++ +    + + L+   
Sbjct: 374 NTNYADTGLFGVHVNTDVREDLDDVAFVVMNSLRNLIYDPKIEDVTRAKQALKSSLLLHG 433

Query: 347 ERS-YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPP 404
           E S    A EI +Q++  G  +   ++   I A+T + +   A K      P +A +GP 
Sbjct: 434 ESSTSAAAEEIGRQLLTYGRRIPRAELFARIDAVTVDTVKATAWKYIRDECPAIAAIGP- 492

Query: 405 MDHVPTTS 412
              +P  +
Sbjct: 493 TQFLPDYN 500


>gi|301063520|ref|ZP_07204052.1| peptidase M16 inactive domain protein [delta proteobacterium
           NaphS2]
 gi|300442459|gb|EFK06692.1| peptidase M16 inactive domain protein [delta proteobacterium
           NaphS2]
          Length = 420

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 124/407 (30%), Positives = 213/407 (52%), Gaps = 5/407 (1%)

Query: 1   MNLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MN R +  ++G+ +++E +P + S  + + +  GSR+E   E+G++HF+EHM FKGT  R
Sbjct: 1   MN-RKTLLNNGVRIVSERLPHVRSVSLGIWVNTGSRDESPPENGVSHFIEHMSFKGTHNR 59

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +  +I ++++ +GG  NA+T  E T ++  VL  H P+  +I+ D+  + +F P D+ERE
Sbjct: 60  SGFQIAKDLDAIGGLSNAFTGKETTCFYGKVLDRHFPILADILSDIFIHPTFQPEDMERE 119

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           R V+ +EI M ED   D+L+  F  + W D  IGRPILG  ET++    + I  ++ ++Y
Sbjct: 120 REVIFQEISMVEDTPDDYLNVLFQSLFWPDHPIGRPILGSTETVARMDRQMIREYIKKHY 179

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFN-VCSVAKIKESMKPAVYVGGEYIQKRDLAEEHM 238
             +R+ VV  G VDH+  V      F      +K K         GG  +  + L + H 
Sbjct: 180 IPERVLVVAAGHVDHDAMVDYFRPIFEAGGDFSKEKPERSLPSNSGGVMVMPKALEQVHF 239

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            LG +  ++     +   +  +ILG  MSSRLFQE+RE RGL YS+ +    ++D G+  
Sbjct: 240 CLGSDAPSHVDASRFACALFNTILGGNMSSRLFQEIRENRGLAYSVYSFFSPYADAGLFG 299

Query: 299 IASATAKENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           + +AT   N+ ++       ++ +        E+D     +   +  S E S  R +  +
Sbjct: 300 VYAATDARNMNSVLEVTQNEIKKISRGELTAGELDIAKENVIGGMYLSSESSDSRMMRAA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAILGP 403
           K        +  E++  +I  ++ +D+V +A +IF +     A LGP
Sbjct: 360 KNEFIFERYVDYEEVAKSIEGVSVDDVVEMANRIFGNEQIAFAALGP 406


>gi|41408988|ref|NP_961824.1| PepR [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41397347|gb|AAS05207.1| PepR [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 440

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 133/424 (31%), Positives = 215/424 (50%), Gaps = 7/424 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           LR S    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  RTA
Sbjct: 17  LRRSTLPGGLRVVTEYLPAVRSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRTA 76

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
            +I + ++ VGG++NA+T+ EHT Y+A VL   + LA++++ D++ N      D+E ER+
Sbjct: 77  VDIAQAMDAVGGELNAFTAKEHTCYYAHVLDADLELAVDLVADVVLNGRCAAEDVELERD 136

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVLEEI M +DD  D L   F   ++ D  +GRP++G   +++S T  ++ SF  R YT 
Sbjct: 137 VVLEEIAMRDDDPEDALGDMFLGALFGDHPVGRPVIGTARSVASMTRTQLHSFHVRRYTP 196

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQ-----KRDLAEE 236
           +RM V   G VDH+  V+ V  +F    V   +                     RD  + 
Sbjct: 197 ERMVVAVAGNVDHDEVVAMVREHFGPHLVRGRQPIAPRKGAGRVNGRPGLLLGTRDAEQT 256

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV 296
           H+ LG        +  +  ++L + LG G+SSRLFQE+RE RGL YS+ +  + F+D+G 
Sbjct: 257 HVSLGVRTPGRGWQHRWALSVLHTALGGGLSSRLFQEIRELRGLAYSVYSTVDIFADSGA 316

Query: 297 LYIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALE 355
           L + +A   E    + +    V++S+    I + E       +   L+   E S  R   
Sbjct: 317 LSVYAACQPERFAEVMAVTSGVLESVARDGITESECRIAKGSLRGGLVLGLEDSGSRMSR 376

Query: 356 ISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELI 415
           + +  +  G     E  +  I  ++ +++  +A+++ +     A+LGP         +L 
Sbjct: 377 LGRNELNYGRHRSIEHTLAQIDRVSVDEVNAIARRLLTQHYGAAVLGPYGTKRSLPQQLR 436

Query: 416 HALE 419
             + 
Sbjct: 437 AMVR 440


>gi|18496665|gb|AAL74192.1|AF465782_1 ubiquinol-cytochrome c reductase core I protein [Oncorhynchus
           mykiss]
          Length = 477

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 98/432 (22%), Positives = 193/432 (44%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ + +E     +  V + I  GSR E ++ +G   FLEHM FKGT K T   
Sbjct: 46  RLTALDNGLRIASEETGHSTCTVGLWINCGSRYETEKNNGAGFFLEHMAFKGTKKHTQMA 105

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + +++E +G  ++AYTS EHT+Y+   L + +P A+E++ +++ +++ + +DIE++R+VV
Sbjct: 106 LEQQVESMGAHLSAYTSREHTAYYMKTLAKDLPKAVELLSEVVQSNALSEADIEQQRSVV 165

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E    D          ++   +G  +LG  +   + + + ++ F+  +Y A R
Sbjct: 166 LRELEEVEGSLQDVCLDLLHATAFQGTPLGHSVLGPSQNARTLSRQDLVDFIRSHYKAPR 225

Query: 184 MYVVCVGAVDHEFCVSQVESYF----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G V HE  V   + +F           +              ++  D+   H+ 
Sbjct: 226 MVLAAAGGVTHEELVGLAKQHFSGVSFEYEDDAVPVLSPCRFSGSEIRMRDDDIPLAHIA 285

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   G +  S D     +  SI+G    +    +    R         LC+S  A H ++
Sbjct: 286 IAVEGASATSPDIVPLMVANSIIGSYDITFGGGKHLSSRLARLASEESLCHSFQAFHSSY 345

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+L I   T K +I  +         +L   + + ++ +    + A L+   + +  
Sbjct: 346 SDTGLLGIYFVTDKHHIDDMMHWSQNAWMNLCTTVTESDVARAKNALKASLVGQLDGTTP 405

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              +I + V+  G  +   +    I A+T   +  V  K      P ++ +GP ++ +P 
Sbjct: 406 ICDDIGRHVLNYGRRIPLAEWDARIDAVTPRMVRDVCSKYIYDKCPAVSAVGP-VEQLPD 464

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 465 YNRMRSAMYWLR 476


>gi|321261359|ref|XP_003195399.1| mitochondrial processing peptidase beta subunit, mitochondrial
           precursor (beta-mpp) [Cryptococcus gattii WM276]
 gi|317461872|gb|ADV23612.1| Mitochondrial processing peptidase beta subunit, mitochondrial
           precursor (beta-mpp), putative [Cryptococcus gattii
           WM276]
          Length = 478

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 116/435 (26%), Positives = 195/435 (44%), Gaps = 18/435 (4%)

Query: 4   RISKTSSGITVITEVMPIDSAF-VKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R S  S+G++V TE +P  S   V + I AGSR +     G AHFLEH+ FKGT  R+  
Sbjct: 43  RTSTLSNGLSVSTETIPGASTSTVGLWIDAGSRADAPNASGTAHFLEHLAFKGTKSRSQT 102

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  E+E +G  +NAYTS E T Y+A    + VP A++I+ D+L NS    S IERER+V
Sbjct: 103 QLELEVENLGAHLNAYTSREQTVYYAKAFDKDVPQAVDILSDILQNSKLEESAIERERDV 162

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    E    + +      + ++   +G  ILG  E I+S +   + S++S+NYTAD
Sbjct: 163 ILREQEEVEKQYEEVVFDHLHSVAFQGSALGNTILGPKEHINSISKSDLQSYISKNYTAD 222

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-----MKPAVYVGGEYIQKRDLAEEH 237
           RM ++  G+++HE  V   E +F    V+            PA ++G E   + D  +  
Sbjct: 223 RMALIGAGSIEHEALVKLAEKHFASLPVSANPIPLGGQSHTPAEFIGSEVRIRDDSMDTI 282

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
            +             Y   ++   +       L         L + IS+++   S     
Sbjct: 283 NLAIAVEGVGWKSPDYWPMLVMQSIFGNWDRSLGASSLLSSRLSHIISSNNLANSYMSFS 342

Query: 298 YIASAT----------AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
              S T             N+  LT   ++    +  +    E+++  +++ A L+   +
Sbjct: 343 TSYSDTGLWGIYLVSENIMNVDDLTHFTLKEWTRMSISPTIAEVERAKSQLKASLLLGLD 402

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMD 406
            +   A +I +Q++  G      +I   + A+T E+I  VA+K        +A LG   D
Sbjct: 403 GTTAIAEDIGRQLITTGKRYTPREIERYVDAVTPEEIQRVAQKYLWDKDIAVAALGR-TD 461

Query: 407 HVPTTSELIHALEGF 421
            +   + L   +   
Sbjct: 462 GLFDYTRLRADMSSM 476


>gi|328769479|gb|EGF79523.1| hypothetical protein BATDEDRAFT_20015 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 484

 Score =  190 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 111/427 (25%), Positives = 199/427 (46%), Gaps = 13/427 (3%)

Query: 4   RISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           ++++ S+G TV TE  P   +A V V I AGSR E  + +G AHFLEHM FKGT  RT  
Sbjct: 54  KVTRLSNGFTVATESNPNNQTATVGVWIDAGSRFETAKTNGTAHFLEHMAFKGTKSRTQL 113

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  +IE +GG +NAYTS E T Y+A  L   V  ++EI+ D+L  S+ +   I RER+V
Sbjct: 114 QLESQIENIGGHLNAYTSREQTVYYAKALAGDVGTSVEILSDILQGSTLSEDAISRERDV 173

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    + +  + +        ++   +GR ILG  E I S + + +++++S NY  +
Sbjct: 174 ILRESEEVDKNKEEVVFDLLHGAAFQGSSLGRTILGSRENIKSISRQDLVNYISENYKPN 233

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           RM +   G VDH+  V   E +F        K   +   ++G +   + D      +   
Sbjct: 234 RMVLSAAGGVDHDALVKLAEKHFGSLKAGPEKTKPEKTPFIGSDVKARFDNHPTAHIALA 293

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVRE---------KRGLCYSISAHHENFSD 293
                 +   Y   ++A  +       L               + GL  S  + + ++SD
Sbjct: 294 VEGVSWTNPDYWPLLVAQSIIGSWDRSLGAASHVSSKLAQKVGEHGLANSFMSFNTSYSD 353

Query: 294 NGVLYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
            G+  + + +        L   I +    L  NI + E+ +   ++   L+ + + +   
Sbjct: 354 TGLFGVYAVSENFMHLSDLVHYIQKEWHRLAINITEAEVFRAKNQLKTSLLLALDGTTPI 413

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILG-PPMDHVPTT 411
           A +I +Q++  G  L   +I   I ++T  D++ V+ K       +A++G  P++ +   
Sbjct: 414 AEDIGRQMLVYGKRLTPWEIDGLIESVTVNDVMKVSSKYIYDRE-VAVIGYGPVEALQDY 472

Query: 412 SELIHAL 418
           + +  A+
Sbjct: 473 NRIRSAM 479


>gi|53802734|ref|YP_112603.1| M16 family peptidase [Methylococcus capsulatus str. Bath]
 gi|53756495|gb|AAU90786.1| peptidase, M16 family [Methylococcus capsulatus str. Bath]
          Length = 459

 Score =  190 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 95/433 (21%), Positives = 184/433 (42%), Gaps = 15/433 (3%)

Query: 2   NLRISKTSSGITVIT-EVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
            +     ++G+ V+  E      A  +V  + GS  E     G++H LEHM+FKGT K  
Sbjct: 23  QVHEFTLANGLRVLVQEDHRAPVAVSQVWYKVGSSYEYGGITGVSHMLEHMMFKGTKKHP 82

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
             E    I   GG  NA+T  ++T+Y   + +  +P++LE+  D + N      +  +E+
Sbjct: 83  PGEFSRIIAANGGSENAFTGQDYTAYFQTLERSRLPVSLELEADRMRNLRLLQDEFVKEQ 142

Query: 121 NVVLEEIG-MSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
            VV+EE    +ED     ++  F  + + D     P++G PE ++  T + + ++  R Y
Sbjct: 143 QVVIEERRLRTEDQPHARMEEHFHAVAFTDSPYRNPVIGWPEDVAGLTLDDLSAWYQRWY 202

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIK---ESMKPAVYVGGEYIQKRDLAEE 236
             +   +V VG V           +F     AK+       +         + K      
Sbjct: 203 APNNATLVVVGDVAPGEVFELARKHFGPLKPAKLPALKPQGEVPQLGLRRMVVKVPAKLP 262

Query: 237 HMMLGFNGCAYQS----RDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFS 292
           H+ +G+   + ++     + Y   + A IL  G S+RL   +   R +   + A ++ ++
Sbjct: 263 HLEMGYKVPSLKTAAAEWEAYALEVAAGILDGGNSARLTSRLVRGRQIAAGVGAGYDLYA 322

Query: 293 DNGVLYIASATA---KENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERS 349
               L+    T    K       + + EV +   E + + E+ +  A++ A  +  ++  
Sbjct: 323 RLSPLFSLEGTPAQGKTVAELEAALLEEVRRLREEPVAEDELARVKAQVLASNVYQRDSV 382

Query: 350 YLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHV 408
           + +A+++             E+ +D I+A+T E +  VA+K       T+A L P    +
Sbjct: 383 FYQAMQLGMAETVGLGWRKVEEYVDKINAVTAEQVREVARKYLIDDGLTIAHLEPQ--PI 440

Query: 409 PTTSELIHALEGF 421
           P  +++    EG 
Sbjct: 441 PEGAKIQEGPEGM 453


>gi|47123260|gb|AAH70011.1| Ubiquinol-cytochrome c reductase core protein I [Danio rerio]
          Length = 474

 Score =  190 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 88/432 (20%), Positives = 179/432 (41%), Gaps = 14/432 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +G+ + +E     +  V + I  GSR E ++ +G   FLEHM FKGT K     
Sbjct: 43  RLTTLDNGLRIASEETNQPTCTVGLWIGCGSRYETEKNNGAGFFLEHMAFKGTKKHPQSA 102

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           + + +E +GG +NAYTS EHT+Y+   L + +P A+E++ +++ + S + +++E++R V 
Sbjct: 103 LEQAVESMGGHLNAYTSREHTAYYMKTLSKDLPKAVELLAEVVQSLSLSEAEMEQQRTVA 162

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E+   E    D          ++   +   + G    I + T   ++ +++ ++ A R
Sbjct: 163 LRELEEIEGSLQDVCLDLLHATAFQGTALSHSVFGPSANIRTLTRNDLLEYINCHFKAPR 222

Query: 184 MYVVCVGAVDHEFC----VSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
           M +   G V H+         +           +              ++   +   H+ 
Sbjct: 223 MVLATAGGVSHDEVVSLAKQHLGGISFEYEGDAVPVLSPCRFTGSEIRMRDDAMPLAHIA 282

Query: 240 LGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR--------GLCYSISAHHENF 291
           +   G    S D     +  SI+G    +    +    R         LC+S    + ++
Sbjct: 283 IAVEGPGAASPDIVPLMVANSIIGSYDITFGGGKHLSSRLAQRAAELNLCHSFQTFYSSY 342

Query: 292 SDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYL 351
           SD G+L I   T K  I  +         ++   + + ++ +    + A L+     +  
Sbjct: 343 SDTGLLGIYFVTEKLKIEDMMHWAQNAWINVCTTVTESDVARAKNALKASLVGQLNGTTP 402

Query: 352 RALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPT 410
              EI + ++  G  +   +    I A+T   +  V  K      P ++ +GP ++ +P 
Sbjct: 403 VCDEIGRHILNYGRRIPLAEWDARIEAVTPSVVRDVCSKYIYDKCPAVSAVGP-IEQLPD 461

Query: 411 TSELIHALEGFR 422
            + +  A+   R
Sbjct: 462 YNRMRSAMFWLR 473


>gi|15842320|ref|NP_337357.1| M16 family peptidase [Mycobacterium tuberculosis CDC1551]
 gi|254232880|ref|ZP_04926207.1| zinc protease pepR [Mycobacterium tuberculosis C]
 gi|13882615|gb|AAK47171.1| peptidase, M16 family [Mycobacterium tuberculosis CDC1551]
 gi|124601939|gb|EAY60949.1| zinc protease pepR [Mycobacterium tuberculosis C]
 gi|323718628|gb|EGB27792.1| zinc protease pepR [Mycobacterium tuberculosis CDC1551A]
          Length = 438

 Score =  190 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 134/422 (31%), Positives = 213/422 (50%), Gaps = 7/422 (1%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R +    G+ V+TE +P + SA V V +  GSR+E     G AHFLEH+LFK T  R+A 
Sbjct: 16  RRTTLPGGLRVVTEFLPAVHSASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPTRSAV 75

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           +I + ++ VGG++NA+T+ EHT Y+A VL   +PLA++++ D++ N      D+E ER+V
Sbjct: 76  DIAQAMDAVGGELNAFTAKEHTCYYAHVLGSDLPLAVDLVADVVLNGRCAADDVEVERDV 135

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           VLEEI M +DD  D L   F   ++ D  +GRP++G  +++S  T  ++ SF  R YT +
Sbjct: 136 VLEEIAMRDDDPEDALADMFLAALFGDHPVGRPVIGSAQSVSVMTRAQLQSFHLRRYTPE 195

Query: 183 RMYVVCVGAVDHEFCVSQVESYF-----NVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
            M V   G VDH+  V+ V  +F             ++            +  RD  + H
Sbjct: 196 WMVVAAAGNVDHDGLVALVREHFGSRLVRGRRPVAPRKGTGRVNGSPRLTLVSRDAEQTH 255

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           + LG           +  ++L + LG G+SSRLFQEVRE RGL YS+ +  + F+D+G L
Sbjct: 256 VSLGIRTPGRGWEHRWALSVLHTALGGGLSSRLFQEVRETRGLAYSVYSALDLFADSGAL 315

Query: 298 YIASATAKENIMALTSSIVEVVQSLLE-NIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            + +A   E    +     +V++S+    I + E       +   L+   E S  R   +
Sbjct: 316 SVYAACLPERFADVMRVTADVLESVARDGITEAECGIAKGSLRGGLVLGLEDSSSRMSRL 375

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSELIH 416
            +  +  G     E  +  I  +T E++  VA+ + S     A+LGP         +L  
Sbjct: 376 GRSELNYGKHRSIEHTLRQIEQVTVEEVNAVARHLLSRRYGAAVLGPHGSKRSLPQQLRA 435

Query: 417 AL 418
            +
Sbjct: 436 MV 437


>gi|332703815|ref|ZP_08423903.1| processing peptidase [Desulfovibrio africanus str. Walvis Bay]
 gi|332553964|gb|EGJ51008.1| processing peptidase [Desulfovibrio africanus str. Walvis Bay]
          Length = 424

 Score =  190 bits (481), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 136/405 (33%), Positives = 210/405 (51%), Gaps = 3/405 (0%)

Query: 6   SKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
           S+  +GI V+TE +P   SA + + I AGS +E+  + GMAHF EHM FKGT  RTA +I
Sbjct: 12  SQLDNGIRVVTERIPATRSASLGIWIEAGSLDEQPNQEGMAHFWEHMAFKGTLTRTALDI 71

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
            ++++++GG  NA+T  EHT +HA ++   +  A++I+ D++     +PSDI  E++VVL
Sbjct: 72  AKDLDRLGGFSNAFTGREHTCFHARMVDTGLADAMDILSDIVLRPRLDPSDILLEQDVVL 131

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
           +EI M  D   D+L   F  + W +  +   ILG   T+  F P  + ++   +Y   RM
Sbjct: 132 QEIAMVNDTPEDYLFEHFWSVYWTEPAMAHSILGNDNTVQGFVPAMLDAWRQEHYKPGRM 191

Query: 185 YVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNG 244
            V   GAVDHE  V+     F     A        +          RD+ + H++LGF G
Sbjct: 192 LVAAAGAVDHEKLVNLASRTFGSLPPASDARQQSLSGVQSRRQAIDRDMEQTHVLLGFPG 251

Query: 245 CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATA 304
            A      +    L S+LG  MSSRLFQEVRE+RGL YS+ + H+  ++ GVL + +AT 
Sbjct: 252 VALTDERRFALAYLNSLLGGQMSSRLFQEVRERRGLAYSVYSSHQALANQGVLQVYAATQ 311

Query: 305 KENIMALTSSIVEVVQSLLENI-EQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFC 363
                 + S I++ +  L +   ++ EI      +   L    E S  R L ++K     
Sbjct: 312 PGKCREMLSVILQELHELAQGKVDEAEIAHCRDHLLGMLYLGTESSEDRMLRLAKNHYLF 371

Query: 364 GSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT-LAILGPPMDH 407
           G  +  E+    ++A+  +DI  VA+   +     L ILGP +D 
Sbjct: 372 GRHVPVEETAAKLNAVNLDDIRAVARDFLAPDQACLCILGPDVDE 416


>gi|285808443|gb|ADC35969.1| putative protease [uncultured bacterium 98]
          Length = 419

 Score =  189 bits (480), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 127/403 (31%), Positives = 221/403 (54%), Gaps = 2/403 (0%)

Query: 8   TSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVE 66
             +G+ ++TE MP + S  + V +  GSR+E  +  G+AHF+EHMLFKGT  R+A++I +
Sbjct: 7   LPNGLRLLTEQMPHVRSVSIGVWLTRGSRHEPSQHAGIAHFVEHMLFKGTGSRSAEDIAQ 66

Query: 67  EIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEE 126
            I+ +GG ++A+T+ E+ SY+  VL EH+PLA++++ D++   +F   DIERE+ VVLEE
Sbjct: 67  AIDSIGGQMDAFTAKEYASYYIKVLDEHLPLAIDVLADIVLRPAFAAEDIEREKKVVLEE 126

Query: 127 IGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYV 186
           I M ED   D +   F+E  WKD  +GRPILG P+T+S+   E + S+ +  Y+A  + V
Sbjct: 127 IKMVEDTPDDLVHELFTEHFWKDHPLGRPILGTPDTVSALNAETLRSYFTDAYSAGNLIV 186

Query: 187 VCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCA 246
             VG +DH      V  +F   +         P   V    I+ ++L + H+ LG  G  
Sbjct: 187 AAVGNIDHSHVRDLVTKHFGHLTTIGEAIVDAPPHVVPEVVIRNKELEQSHVCLGTTGYQ 246

Query: 247 YQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIASATAKE 306
              +D Y + +L ++LG  MSSRLFQ VREKRGL Y++ +    + D G + + +  A  
Sbjct: 247 QDHKDRYASYVLNTVLGGSMSSRLFQNVREKRGLAYAVFSGLSAYRDAGNVTVYAGCANN 306

Query: 307 NIMALTSSIVEVVQSLLENIEQ-REIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGS 365
            +  L   +V  ++ + ++     EI +    +   L+ + E +  R   +++Q ++   
Sbjct: 307 AVAELIDVVVGELRRIKDDPPPEEEIRRAKDHLKGSLMLNLESTSSRMSHLARQEIYFDR 366

Query: 366 ILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHV 408
               ++ ++ +  ++  D+  VA+ +F      A +   ++ +
Sbjct: 367 QFGLDETLEGVELVSRADLERVARDLFGRDALAATVLGAVNGL 409


>gi|189424898|ref|YP_001952075.1| processing peptidase [Geobacter lovleyi SZ]
 gi|189421157|gb|ACD95555.1| processing peptidase [Geobacter lovleyi SZ]
          Length = 432

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 123/398 (30%), Positives = 214/398 (53%), Gaps = 5/398 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           ++ +   +G+ V+T+ +P   +  + V +  G+R E+  EHG AHF+EH+LFKGT +RTA
Sbjct: 11  VQETTFDNGVRVVTQQVPGMHTVSIGVWVSNGARCEQPSEHGTAHFIEHLLFKGTHRRTA 70

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           ++I  EI+ +GG +NA+TS E+  Y+A  L   +P  ++I+ DM  +S+F   +IE+ER 
Sbjct: 71  RQITREIDSLGGVLNAFTSYEYVCYYAKALARTLPQVVDILSDMFLHSTFPADEIEKERK 130

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           VVL+EI M +D   + +  R  +  WK   +G PILG  + I S T + I+ F +  Y  
Sbjct: 131 VVLQEIKMRDDAPEESIHDRLHQSFWKGHPLGHPILGTDQIIGSITRDTILEFRNHWYRP 190

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIK---ESMKPAVYVGGEYIQKRDLAEEHM 238
             + +   G V+H   V  ++  F+     + +   +            + +RDL +  +
Sbjct: 191 SEILIAAAGGVEHHVLVELLQESFSCLQPGEPRRTLQPHGRLATGRVMELCERDLEQTLI 250

Query: 239 MLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
            LG  G    S + Y   +L +ILG GMSSRLF+E+REKRGL YS+ ++  +F+D G L 
Sbjct: 251 CLGTEGLPTSSPERYSLMVLNAILGGGMSSRLFEEIREKRGLAYSVYSYVSSFADAGTLS 310

Query: 299 IASATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + + +E      + I+E + +   E + Q E++    +I  K++ S E S      ++
Sbjct: 311 IYAGSERERSCEAVTIILEEMSRLRDEAVPQDELEAAREQIKGKILMSLESSDSYMSRLA 370

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSST 395
           +  +  G     ++I+    A+T  D+  ++ ++F   
Sbjct: 371 RSYLNFGRYQPLDEIMAGFDAVTAGDLQQLSARLFRDE 408


>gi|68468931|ref|XP_721524.1| hypothetical protein CaO19.3026 [Candida albicans SC5314]
 gi|68469477|ref|XP_721253.1| hypothetical protein CaO19.10544 [Candida albicans SC5314]
 gi|46443162|gb|EAL02446.1| hypothetical protein CaO19.10544 [Candida albicans SC5314]
 gi|46443444|gb|EAL02726.1| hypothetical protein CaO19.3026 [Candida albicans SC5314]
          Length = 467

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 112/438 (25%), Positives = 197/438 (44%), Gaps = 22/438 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + S   +G+TV +E MP   +A V V I AGSR +  +  G AHFLEH+ FKGT  R 
Sbjct: 29  TYQTSILPNGLTVASESMPGTRTATVGVWINAGSRADNPKSSGTAHFLEHLAFKGTQTRP 88

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L   +   ++I+ D+L+ S      I+ ER
Sbjct: 89  QAALELEIENIGSQINAYTSRENTVYYTRCLASDIKQNIDILSDLLTKSKLENRAIDNER 148

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+E    +    + +      + +K+Q +GR ILG  E I +   + ++ +++ NY 
Sbjct: 149 HVILQESDEVDKMYDEVVFDHLHAVAFKNQDLGRTILGPREMIKTINRQDLVDYITTNYK 208

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM +V VG VDH+  V   +++F     ++   +      P  Y     IQ   +   
Sbjct: 209 GDRMALVGVGCVDHQELVKLGQNFFGNIVKSEEPFNQSGGTLPLFYGDEIRIQDDSMPTT 268

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR---------------GLC 281
           H+ L   G ++ + DF++ ++   I+G    S                            
Sbjct: 269 HVALAVEGVSWSAPDFFVASVANGIVGTWDRSVGIGSNSPSPLAVTAATGGPGKTPIANS 328

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  +       + + +   E  +    +I   E+++  +++ A 
Sbjct: 329 YMAYTTSYADTGLLGVYFTADKNANLKLLVDAIQKEWGRLSRGDITDEEVERSKSQLKAS 388

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +QV+  G  L  E++   + +IT +DIV  A       P  LA 
Sbjct: 389 LLLALDDSSAIAEDIGRQVVNTGYRLSPEEVFSRVESITKDDIVNWANYRLKGKPIALAA 448

Query: 401 LGPPMDHVPTTSELIHAL 418
           +G  +  +P+  E+   +
Sbjct: 449 VG-NVKTLPSHKEISEGM 465


>gi|322695918|gb|EFY87718.1| mitochondrial processing peptidase beta subunit [Metarhizium
           acridum CQMa 102]
          Length = 474

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 113/433 (26%), Positives = 200/433 (46%), Gaps = 18/433 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           + +   +G+TV TE  P   ++ V V I AGSR E  E +G AHFLEH+ FKGT KR+ +
Sbjct: 40  QTTTLKNGLTVATEHSPWAQTSTVGVWIDAGSRAETDENNGTAHFLEHLAFKGTAKRSQQ 99

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  EIE +GG +NAYTS E+T Y A      VP  ++I+ D+L NS    S IERER+V
Sbjct: 100 QLELEIENMGGHLNAYTSRENTVYFAKAFNSDVPQCVDILSDILQNSKLEESAIERERDV 159

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    E    + +        ++ Q +GR ILG  + I   T  ++ S++  NYTAD
Sbjct: 160 ILRESEEVEKQVEEVVFDHLHATAFQHQPLGRTILGPRQNIRDITRTELTSYIKNNYTAD 219

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK-----------PAVYVGGEYIQKR 231
           RM +V  G + HE  V   E +F        +                 V V  + +   
Sbjct: 220 RMVLVGAGGIPHEQLVELAEKHFAGLPTKSPETQAYLLAKQKADFIGSDVRVRDDTMGTA 279

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQE---VREKRGLCYSISAHH 288
           ++A     + ++   Y +       +       G +     +   +  +  L  S  +  
Sbjct: 280 NVALAVEGVSWSSDDYFTALVTQAIVGNYDKAMGNAPHQGSKLSGLVHRHELANSFMSFS 339

Query: 289 ENFSDNGVLYIASATAKENI-MALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
            ++SD G+  I   T        L    +     L  ++ + E+++  A++ A ++ S +
Sbjct: 340 TSYSDTGLWGIYLTTDNITRLDDLVHFAMREWMRLCTDVGEAEVERAKAQLKASILLSLD 399

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVA-KKIFSSTPTLAILGPPMD 406
            +   A +I +Q++  G  +   +I   I AIT ++++  A +K++     ++ +G  ++
Sbjct: 400 GTTAVAEDIGRQLITTGRRMMPGEIERRIDAITEKEVMDFANRKLWDKDIAISAVG-NIE 458

Query: 407 HVPTTSELIHALE 419
            +     L + ++
Sbjct: 459 ALFDYQRLRNTMK 471


>gi|15604090|ref|NP_220605.1| protease [Rickettsia prowazekii str. Madrid E]
 gi|6686079|sp|O05945|Y219_RICPR RecName: Full=Uncharacterized zinc protease RP219
 gi|2073473|emb|CAA72467.1| hypothetical processing peptidase [Rickettsia prowazekii]
 gi|3860781|emb|CAA14682.1| MITOCHONDRIAL PROTEASE (mpp) [Rickettsia prowazekii]
 gi|292571815|gb|ADE29730.1| protease [Rickettsia prowazekii Rp22]
          Length = 412

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 146/405 (36%), Positives = 233/405 (57%), Gaps = 3/405 (0%)

Query: 2   NLRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N  +SK  +G+T++T  MP + S  + +  + G+R E +EE G++HFLEHM FKGT  RT
Sbjct: 4   NFNVSKLKNGLTILTYNMPYVHSVAINLIAKVGARYENEEEEGISHFLEHMAFKGTKTRT 63

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
           A++I EE + +GG  NAYT  E+T Y+A VL E+   AL I+ D++ NS F   +I +E 
Sbjct: 64  AQQIAEEFDSIGGYFNAYTGHENTVYYARVLSENCHKALNILADIIQNSIFADEEIAKEY 123

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            ++++EI    D+  D +   F   V+K Q +G+ ILG  +T+ +FT E  ++F+ ++Y 
Sbjct: 124 QIIMQEIAHHHDNPDDLIYETFYNTVYKGQPLGKSILGTTKTLVTFTKEHFLNFIGKHYN 183

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML 240
           A+ +Y+   G ++H   V   E  F       +K S  PA Y+GG+    ++L +  ++L
Sbjct: 184 AENLYLSIAGNIEHNKIVMIAEELFASLKQG-VKSSFIPAKYIGGKGFIHKELEQTSLVL 242

Query: 241 GFNGCAY-QSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI 299
           GF   +Y      Y T +L+ I G GMSSRLFQ +REK GL Y + +++  + D+GV  I
Sbjct: 243 GFECTSYINLGQLYQTYLLSIIFGGGMSSRLFQSIREKLGLAYVVGSYNSAYFDSGVFTI 302

Query: 300 ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
            ++TA   +  L   I   +  + E +   EI +   ++ + L  +QE++  ++ EI K 
Sbjct: 303 YASTAHNKLELLYREIKNEIIKITETVSTEEIIRAKMQLRSNLQMAQEQNTYKSEEIGKN 362

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPP 404
               G  +  E+II+ I+ I  +DI+  A KIFS T TLAI+GP 
Sbjct: 363 YSVFGKYILPEEIIEIITNIRADDIINTANKIFSGTTTLAIIGPN 407


>gi|150390427|ref|YP_001320476.1| peptidase M16 domain-containing protein [Alkaliphilus
           metalliredigens QYMF]
 gi|149950289|gb|ABR48817.1| peptidase M16 domain protein [Alkaliphilus metalliredigens QYMF]
          Length = 406

 Score =  189 bits (480), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 117/390 (30%), Positives = 204/390 (52%), Gaps = 6/390 (1%)

Query: 3   LRISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
            +     +G+ ++TE +P + S  + + I+AGSRNE +  +G++HF+EHMLFKGT  R+A
Sbjct: 2   YKKYTLDNGLRIVTEHIPHVKSISIGLWIKAGSRNEDESNNGVSHFIEHMLFKGTENRSA 61

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I EEI+ +GG INA+TS E T Y+A VL EH  L L+++ DM   S  +  +I++ER+
Sbjct: 62  KDIAEEIDGIGGQINAFTSKECTCYYAKVLDEHYELVLDVLADMFFKSKLDSLEIDKERS 121

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V++EEI M ED   D      S+ ++    +G PILG  +T+ +   + +  ++   YT 
Sbjct: 122 VIIEEISMYEDSPEDLAHDLLSQTIYSGNTLGLPILGTQKTLENIDKKSMKDYMENYYTP 181

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMML- 240
           D   +   G  + +  +  +E  F        +      + +  E   K+   E+  +  
Sbjct: 182 DNTVIAIAGNFEEKSLLQAIEKRFANWESQPHRSKQASEIKLNFEEKVKKKEIEQVHLCL 241

Query: 241 GFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYIA 300
           GF G +  S++ Y   +  +ILG  MSSRLFQ +RE++GL YSI ++   ++D+G L I 
Sbjct: 242 GFQGTSLDSKNLYPLLVFNNILGGSMSSRLFQNIREEKGLAYSIYSYPSIYTDSGFLAIY 301

Query: 301 SATAKENIMALTSSIVEVV-QSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQ 359
           +    +    ++  I + +     + + + E  K   ++    I   E +  R   + K 
Sbjct: 302 AGMNPQQYSVVSELISQELSNLREKGLTETEFRKSKEQLKGNYILGLESTSGRMSSMGKS 361

Query: 360 VMFCGSILCSEKIIDTISAITCEDIVGVAK 389
            +  G I   ++++D I+ I   +I  V +
Sbjct: 362 ELLLGKIYSPKEVVDRINRI---EIKNVLQ 388


>gi|260944098|ref|XP_002616347.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238849996|gb|EEQ39460.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 465

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 113/440 (25%), Positives = 204/440 (46%), Gaps = 22/440 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
           N + +   +G+TV +E MP   +A V + I AGSR +     G AHFLEH+ FKGT+KR+
Sbjct: 27  NFKTTVLPNGLTVASEFMPGTKTATVGMWINAGSRADNPTSSGTAHFLEHLAFKGTSKRS 86

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L   +   ++I+ D+L+ S   PS IE+ER
Sbjct: 87  QYSLELEIEDLGSQINAYTSRENTVYYTKCLANDLEQNVDILSDLLTKSKLEPSAIEKER 146

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
            V+L+E    +    + +     E+ +++Q +GR ILG  E I +   + +++++  NY 
Sbjct: 147 AVILQESDEVDKMFDEVVFDHLHEIAYRNQDLGRTILGPREKIRTINRDDLVNYIQTNYK 206

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM ++  G VDH+  V   + YF     + +         P  Y     IQ   L   
Sbjct: 207 GDRMALIGAGCVDHDELVKNAQKYFGHIKASDVPFKQHGDDLPIFYGAERRIQDDSLPIT 266

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSR---------------LFQEVREKRGLC 281
           H+ L   G ++ + DF+ +++   I+G    S                +     E     
Sbjct: 267 HVALAVEGVSWSAPDFFTSSVANGIIGSWDRSIGIGSDSPSPLTVTAAMGGPGNEPIANS 326

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  + +  +  + + + + E  +    NI + E+++  A++ A 
Sbjct: 327 YMAYTTSYADTGLMGVYFTADSNTDMSLFVNAVLHEWARLKSGNITEEEVERSKAQLKAS 386

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +Q++  G  L  E + + +  I+ +D++  A       P  +  
Sbjct: 387 LVLALDDSTAIAEDIGRQLVNTGFRLSPEDVFERVENISRQDVIDWANYRLKDKPIAMCA 446

Query: 401 LGPPMDHVPTTSELIHALEG 420
           LG     +P+  +L+  +  
Sbjct: 447 LG-NCKTIPSHKDLVKGMSW 465


>gi|257468009|ref|ZP_05632105.1| Zinc protease [Fusobacterium ulcerans ATCC 49185]
 gi|317062295|ref|ZP_07926780.1| zinc protease [Fusobacterium ulcerans ATCC 49185]
 gi|313687971|gb|EFS24806.1| zinc protease [Fusobacterium ulcerans ATCC 49185]
          Length = 407

 Score =  189 bits (480), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 114/408 (27%), Positives = 201/408 (49%), Gaps = 4/408 (0%)

Query: 1   MNLRISKTSSGITVITEV-MPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKR 59
           MN+ I K  +GI V+ E    + +  + + +  GSRNE  +E G++HF+EHM+FKGT  R
Sbjct: 1   MNIEIRKLDNGIPVLMENIDSVSTVSLGIFVNTGSRNEYPDESGVSHFIEHMMFKGTKTR 60

Query: 60  TAKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERE 119
           +AKEI E I+  GG INAYTS + T+Y+  +L   +   ++++ DM  NS+F   ++++E
Sbjct: 61  SAKEISELIDNEGGLINAYTSRDMTAYYIQMLSSKIDTGIDVLSDMFLNSTFTQENLDKE 120

Query: 120 RNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNY 179
           RNV++EEI M +D   + +    +       +    +LG  E++++ T EK + +    Y
Sbjct: 121 RNVIIEEIRMYDDIPEE-IVHDENVKYAITGVQSNIVLGTIESLNNITREKFLKYFDEQY 179

Query: 180 TADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMM 239
            A  + V   G +D +  V+++         +  K  M  +  +     + +    +  +
Sbjct: 180 VASNIVVSVAGKIDFDHVVAELNKSLGKFRDSNFKREMDASFTINHGENRIKRETNQVHL 239

Query: 240 LGFNG-CAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLY 298
                  +      Y   I++S+L   MSSRLFQ++RE+RGL YS+ ++   F + G+  
Sbjct: 240 CFNTRGNSQIEDMKYPGAIISSVLAGNMSSRLFQKIREERGLAYSVYSYGTAFIEGGLFT 299

Query: 299 IASATAKENIMALTSSIVEVVQSL-LENIEQREIDKECAKIHAKLIKSQERSYLRALEIS 357
           I + T KE+   +   I +  + +    I   E+ K   +  + L  S E S  +   ++
Sbjct: 300 IYAGTTKESYQEVIDIIKDEFEDIKKNGITPYELQKSKNQFLSMLTFSLENSKGKMTRMA 359

Query: 358 KQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPM 405
              M  G +   ++II  I  IT EDI   A+ +F        +   +
Sbjct: 360 STYMLYGRVTEIDEIISKIENITLEDIKKTAEYLFQEEFYSCTILGDI 407


>gi|238879194|gb|EEQ42832.1| mitochondrial processing peptidase beta subunit [Candida albicans
           WO-1]
          Length = 467

 Score =  189 bits (479), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 112/438 (25%), Positives = 197/438 (44%), Gaps = 22/438 (5%)

Query: 2   NLRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRT 60
             + S   +G+TV +E MP   +A V V I AGSR +  +  G AHFLEH+ FKGT  R 
Sbjct: 29  TYQTSILPNGLTVASESMPGTRTATVGVWINAGSRADNPKSSGTAHFLEHLAFKGTQTRP 88

Query: 61  AKEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERER 120
              +  EIE +G  INAYTS E+T Y+   L   +   ++I+ D+L+ S      I+ ER
Sbjct: 89  QAALELEIENIGSQINAYTSRENTVYYTRCLASDIKQNIDILSDLLTKSKLENRAIDNER 148

Query: 121 NVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYT 180
           +V+L+E    +    + +      + +K+Q +GR ILG  E I +   + ++ +++ NY 
Sbjct: 149 HVILQESDEVDKMYDEVVFDHLHAVAFKNQDLGRTILGPREMIKTINRQDLVDYITTNYK 208

Query: 181 ADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEE 236
            DRM +V VG VDH+  V   +++F     ++   +      P  Y     IQ   +   
Sbjct: 209 GDRMALVGVGCVDHQELVKLGKNFFGNIVKSEEPFNQSGGTLPLFYGDEIRIQDDSMPTT 268

Query: 237 HMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR---------------GLC 281
           H+ L   G ++ + DF++ ++   I+G    S                            
Sbjct: 269 HVALAVEGVSWSAPDFFVASVANGIVGTWDRSVGIGSNSPSPLAVTAATGGPGKTPIANS 328

Query: 282 YSISAHHENFSDNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAK 341
           Y         +    +Y  +       + + +   E  +    +I   E+++  +++ A 
Sbjct: 329 YMAYTTSYADTGLLGVYFTADKNANLKLLVDAIQKEWGRLSRGDITDEEVERSKSQLKAS 388

Query: 342 LIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTP-TLAI 400
           L+ + + S   A +I +QV+  G  L  E++   + +IT +DIV  A       P  LA 
Sbjct: 389 LLLALDDSSAIAEDIGRQVVNTGYRLSPEEVFSRVESITKDDIVNWANYRLKGKPIALAA 448

Query: 401 LGPPMDHVPTTSELIHAL 418
           +G  +  +P+  E+   +
Sbjct: 449 VG-NVKTLPSHKEISEGM 465


>gi|326431443|gb|EGD77013.1| peptidase subunit beta [Salpingoeca sp. ATCC 50818]
          Length = 457

 Score =  189 bits (479), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 107/430 (24%), Positives = 203/430 (47%), Gaps = 11/430 (2%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++  ++G  V+TE  P  +A + V++ AGSR E  + +G AHFLEHM FKGT KRT +E
Sbjct: 29  RVTTLNNGFRVVTEQTPHQTATIGVHVDAGSRFETAQNNGTAHFLEHMAFKGTNKRTQQE 88

Query: 64  IVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVV 123
           I  + E+ G  ++AYTS E T Y A    +    A++++GD+L+N+ ++   +E ER V+
Sbjct: 89  IDSQAEQRGMRLDAYTSRESTVYMARCFSDDTDFAVDLLGDILTNAKYDAGKVEAERGVI 148

Query: 124 LEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADR 183
           L E         + +        +++  +G  ILG  E I S + E +I +V   YT  R
Sbjct: 149 LRENQEVNSIPEEVVMDYLHATAFQNSPLGYTILGPEENIKSISREDLIKYVETYYTGPR 208

Query: 184 MYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEE-HMMLGF 242
           M +V  G VDH+  V+  E  F   S      ++  + + G E   + D  +     +  
Sbjct: 209 MVLVGTGGVDHDQLVAAAEKAFGGLSADDKAPAVTTSDFHGSELRFRDDSEQTAKFAIAV 268

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSR--------LFQEVREKRGLCYSISAHHENFSDN 294
            G ++   DFY   + +S++G    +             +  +  L ++  +   +++D 
Sbjct: 269 EGVSWSDPDFYSMLVGSSLVGSWDRNFGGSANLSSPLARLAAEHSLAHNYMSFQTSYTDT 328

Query: 295 GVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
           G+    + T  + I     ++ +    L       E+++   ++ ++LI S + +     
Sbjct: 329 GLWGCYAVTDYDKIEDFAYALTQEWLRLANGATDAEVERVKRQLKSQLIFSVDSAQAAND 388

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKI-FSSTPTLAILGPPMDHVPTTSE 413
           EI +Q++  G  + + +I   + +++   +     K  +   P +A +GP ++ +P  + 
Sbjct: 389 EIGRQILTLGRRVPAAEINALLDSVSSSTVRSAMDKYVYDRCPAVAAIGP-VEQLPDYNR 447

Query: 414 LIHALEGFRS 423
           L   L   R+
Sbjct: 448 LRSNLVWLRT 457


>gi|58269330|ref|XP_571821.1| mitochondrial processing peptidase beta subunit, mitochondrial
           precursor (beta-mpp) [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134114327|ref|XP_774411.1| hypothetical protein CNBG3920 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257046|gb|EAL19764.1| hypothetical protein CNBG3920 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228057|gb|AAW44514.1| mitochondrial processing peptidase beta subunit, mitochondrial
           precursor (beta-mpp), putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 477

 Score =  189 bits (479), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 113/435 (25%), Positives = 195/435 (44%), Gaps = 18/435 (4%)

Query: 4   RISKTSSGITVITEVMPID-SAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           R S  S+G++V TE +P   +A V + I AGSR +     G AHFLEH+ FKGT  R+  
Sbjct: 42  RTSTLSNGLSVSTETIPGASTATVGLWIDAGSRADAPNASGTAHFLEHLAFKGTRSRSQT 101

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  E+E +G  +NAYTS E T Y+A    + VP A++I+ D+L +S    S IERER+V
Sbjct: 102 QLELEVENLGAHLNAYTSREQTVYYAKAFDKDVPQAVDILSDILQHSKLEESAIERERDV 161

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    E    + +      + ++   +G  ILG  E I+S +   + S++S+NYTAD
Sbjct: 162 ILREQEEVEKQYEEVVFDHLHSVAFQGSALGNTILGPKEHINSISKSDLQSYISKNYTAD 221

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-----MKPAVYVGGEYIQKRDLAEEH 237
           RM ++  G+++H+  V   E +F    V+            PA ++G E   + D  +  
Sbjct: 222 RMALIGAGSIEHDALVKLAEKHFAALPVSANPIPLGGQSHTPAEFIGSEVRIRDDSMDTI 281

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
            +             Y   ++   +       L         L + IS+++   S     
Sbjct: 282 NLAIAVEGVGWKSPDYWPMLVMQSIFGNWDRSLGASSLLSSRLSHIISSNNLANSYMSFS 341

Query: 298 YIASAT----------AKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQE 347
              S T             N+  LT   ++    +  +    E+++  +++ A L+   +
Sbjct: 342 TSYSDTGLWGIYLVSENLMNVDDLTHFTLKEWTRMSISPTIAEVERAKSQLKASLLLGLD 401

Query: 348 RSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMD 406
            +   A +I +Q++  G      +I   + A+T  +I  VA+K        +A LG   D
Sbjct: 402 GTTAIAEDIGRQMITTGKRYTPREIERYVDAVTPAEIQRVAQKYLWDKDIAVAALGR-TD 460

Query: 407 HVPTTSELIHALEGF 421
            +   + L   +   
Sbjct: 461 GLFDYTRLRADMSSM 475


>gi|295395381|ref|ZP_06805580.1| M16 family peptidase [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971703|gb|EFG47579.1| M16 family peptidase [Brevibacterium mcbrellneri ATCC 49030]
          Length = 426

 Score =  188 bits (478), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 122/407 (29%), Positives = 198/407 (48%), Gaps = 6/407 (1%)

Query: 3   LRISKTSSGITVITEVMPI-DSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTA 61
           +  +   +GI VI+E +P   S  V V + +GSR+E  +  G  HFLEHMLFKGT  R+A
Sbjct: 13  IYRTTLPNGIRVISETIPGIQSETVGVWVGSGSRDETDDNAGSTHFLEHMLFKGTATRSA 72

Query: 62  KEIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERN 121
           K+I    ++ GG+ NA T+ E T+Y++  L   +P     + DM+  S+   ++ ERER 
Sbjct: 73  KDIARTFDRTGGEANAMTAKECTAYYSRCLVADLPDVCATLWDMVLASTLAVAEFERERT 132

Query: 122 VVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTA 181
           V+L+E+ M  DD  D L   + E+++ D  +GRP+    E I +   +++       Y  
Sbjct: 133 VILDELAMGADDPEDVLFEAYDELIYADSPLGRPVGATKERIQALAYDELQHHYKEAYVG 192

Query: 182 DRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMK----PAVYVGGEYIQKRDLAEEH 237
            R+     G  DHE  V  V         A             V+  GE    R   ++ 
Sbjct: 193 PRLIFSAAGGADHEDLVDLVWRATQHLPEATAPVGTTSGRVTPVFSPGERHIARPTEQQS 252

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVL 297
           +++G  G      D +   +LAS+LG GMSSRLFQ VRE+RGL Y++      +SD G  
Sbjct: 253 LIMGVAGLHDGHDDRFTLTVLASLLGGGMSSRLFQTVREERGLAYAVHTTGSQYSDVGDF 312

Query: 298 YIASATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERSYLRALEI 356
            I +  A      +    VE  Q L  E     E+    A++ A  +   E + +R   +
Sbjct: 313 GIYAGCAPAVAQQVVDLCVEQCQRLASEGPMAAEVADTAAQVSAATVLGMESTAIRMNRL 372

Query: 357 SKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPTLAILGP 403
           +K  +    ++ + ++++ +  +T ED+  +A+++F     L  LGP
Sbjct: 373 AKSELSNRPLVDAAELVERVRGVTAEDVQALAQRLFGGPWALCSLGP 419


>gi|221131259|ref|XP_002156628.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 478

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 96/429 (22%), Positives = 183/429 (42%), Gaps = 12/429 (2%)

Query: 5   ISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEI 64
            S  S+G+ + +E   ID+  V + I AGSR E +  +G+AHFLEHM FKGT  RT  ++
Sbjct: 50  TSSLSNGLRIASEDSGIDTCTVGLWIDAGSRFETEANNGVAHFLEHMAFKGTKNRTQLQL 109

Query: 65  VEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVL 124
             E+E +G  +NAYTS E T Y+A   K+ +P A+ I+ D++ N   +   IERER V+L
Sbjct: 110 ELEVENMGAHLNAYTSREQTVYYAKCFKKDLPKAVNILSDIIQNPVLDEGAIERERGVIL 169

Query: 125 EEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRM 184
            E+   +    + +        ++   +G  ILG  + + S + + + ++++ +Y A RM
Sbjct: 170 REMQEVDTQLEEVVFDHLHATAYQGTPLGMTILGPSKNVKSISKKDLQNYINTHYRAPRM 229

Query: 185 YVVCVGAVDHEF-------CVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEH 237
            +   G V+H+          S ++S  +  SV K        V V  + +    +A   
Sbjct: 230 VLAAAGGVNHDELVKLAELNFSGLQSKVDDKSVLKPVRYTGSEVRVRDDDMPLAHIAMAV 289

Query: 238 MMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGV- 296
              G+    Y +       + +     G S  +  ++          +++    +     
Sbjct: 290 EGCGWANPDYFTLMVANMIVGSWDRSLGGSRNVAGQLAADVSKHSLANSYMSFNTCYTDT 349

Query: 297 --LYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRAL 354
                     K  I  L   I      L  ++   E+++    +    +   + S     
Sbjct: 350 GLWGAYMVCDKMKIDDLVYVIQREWMRLCTSVTDSEVNRAKNVLKTNFLLQFDGSTPVCE 409

Query: 355 EISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIF-SSTPTLAILGPPMDHVPTTSE 413
           +I +Q++  G  +   ++   I+ I  + +  +  K      P +A +GP ++ +P  + 
Sbjct: 410 DIGRQMLTYGRRIPLPELNYRINIIDAKMVKDICSKYIYDKCPVVAGVGP-VEQLPDYNR 468

Query: 414 LIHALEGFR 422
           +   +   R
Sbjct: 469 VRGNMYWIR 477


>gi|281208734|gb|EFA82909.1| mitochondrial processing peptidase beta subunit [Polysphondylium
           pallidum PN500]
          Length = 474

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 114/421 (27%), Positives = 204/421 (48%), Gaps = 13/421 (3%)

Query: 4   RISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE 63
           R++   +GI V TE    ++A + V + +GS  E ++ +G+AHFLEHM+FKGT KR +  
Sbjct: 44  RVTTLPNGIRVATEQSFGETASIGVWVDSGSVYENEKNNGVAHFLEHMIFKGTEKRPSPH 103

Query: 64  IVE-EIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
            +E EIE +GG++NA+TS EH++Y+  VLKE++P A++I+ D+L NS F  S+I++ER+V
Sbjct: 104 YIETEIENMGGNLNAFTSREHSAYYMKVLKENIPNAVDILSDILQNSKFEQSNIDKERHV 163

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E+   +    + +  +     ++   +GR ILG  E I+  +   I  F+S+NYT  
Sbjct: 164 ILSEMQYVQSKEEEVIFDQLHAAAFQGSALGRTILGPVENINKISRNDIKDFISQNYTGQ 223

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGF 242
           R+ +   GAV+H+  VS V+  F   +  +            G  ++ RD +   +    
Sbjct: 224 RLVIAAAGAVNHDKLVSAVKEKFGSIAAGEPSLRSAITSDFVGSELRVRDDSLPLVHFAV 283

Query: 243 NGCAYQSRDFYLTNILASILGDGMSSRLFQEVRE----------KRGLCYSISAHHENFS 292
                Q        +       G  +R     +             GL  S S     + 
Sbjct: 284 AVRGLQWNHPDYFVMELIQTMIGNWNRNLAGGKNLISNLAEVVATEGLAESYSTFFTCYQ 343

Query: 293 DNGVLYIASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLR 352
           D G+       A E +  L   +++  Q +  +  + E+++   K+ A  +   + +   
Sbjct: 344 DTGLFGNYGVAAPERVDDLICEMLKEWQRIANSASETEVERNKQKLLANTLMQYDGTSRI 403

Query: 353 ALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSS-TPTLAILGPPMDHVPTT 411
             +I  Q++  G  L + +I   I+ IT  D+  VA +I +  +P +  +GP ++  P  
Sbjct: 404 CEKIGLQMLTLGRRLSAHEIYLRITEITAADVRRVASQILTDVSPAVTAVGPTVNF-PDY 462

Query: 412 S 412
           +
Sbjct: 463 N 463


>gi|302927427|ref|XP_003054495.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735436|gb|EEU48782.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 474

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 118/433 (27%), Positives = 204/433 (47%), Gaps = 18/433 (4%)

Query: 4   RISKTSSGITVITEVMP-IDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAK 62
           + +   +G+TV TE  P   ++ V V I AGSR E  E +G AHFLEH+ FKGT KR+ +
Sbjct: 40  QTTTLRNGLTVATEHSPFAQTSTVGVWIDAGSRAETDETNGTAHFLEHLAFKGTAKRSQQ 99

Query: 63  EIVEEIEKVGGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNV 122
           ++  EIE +GG +NAYTS E+T Y A      VP  ++I+ D+L NS    S IERER+V
Sbjct: 100 QLELEIENMGGHLNAYTSRENTVYFAKAFNSDVPQCVDILSDILQNSLLEQSAIERERDV 159

Query: 123 VLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTAD 182
           +L E    E    + +        ++ Q +GR ILG  + I   T  ++++++  NYTAD
Sbjct: 160 ILRESEEVEKQVEEVVFDHLHATAFQHQPLGRTILGPRQNIRDITRTELVNYIKNNYTAD 219

Query: 183 RMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKES-----------MKPAVYVGGEYIQKR 231
           RM +V  G + HE  V   E +F+    +  K S           M   V V  + +   
Sbjct: 220 RMVLVGAGGIPHEQLVELAEKHFSGLPSSGPKNSAYLLSKTKADFMGSDVRVRDDAMPTA 279

Query: 232 DLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQE---VREKRGLCYSISAHH 288
           ++A     + +N   Y +       +       G +