RPSBLAST alignment for GI: 254780464 and conserved domain: TIGR02110

>gnl|CDD|162709 TIGR02110, PQQ_syn_pqqF, coenzyme PQQ biosynthesis probable peptidase PqqF. In a subset of species that make coenzyme PQQ (pyrrolo-quinoline-quinone), this probable peptidase is found in the PQQ biosynthesis region and is thought to act as a protease on PqqA (TIGR02107), a probable peptide precursor of the coenzyme. PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. Length = 696
 Score = 61.0 bits (148), Expect = 5e-10
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query: 30  IRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE-IVEEIEKVGGDINAYTSLEHTSYHA 88
           + AGS +E     G+AHFLEH+LF G  +    + ++  +++ GG +NA T    T++  
Sbjct: 28  VAAGSHDEPSAWPGLAHFLEHLLFLGGERFQGDDRLMPWVQRQGGQVNATTLERTTAFFF 87

Query: 89  WVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEE 126
            +    +   L  + DML+       D +RER V+  E
Sbjct: 88  ELPAAALAAGLARLCDMLARPLLTAEDQQREREVLEAE 125