RPSBLAST alignment of GI: 254780464 and protein with PDBid: 3cx5

>3cx5_B Cytochrome B-C1 complex subunit 2, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: d.185.1.1 d.185.1.1 PDB: 1kb9_B* 1kyo_B* 1p84_B* 2ibz_B* 1ezv_B* 3cxh_B* Length = 352
 Score =  212 bits (541), Expect = 1e-55
 Identities = 72/404 (17%), Positives = 135/404 (33%), Gaps = 53/404 (13%)

Query: 12  ITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKV 71
           +TV     P   + + V +  GSR   ++  G+AH L    F+ T  R+A ++V E E +
Sbjct: 1   LTVSARDAPTKISTLAVKVHGGSRYATKD--GVAHLLNRFNFQNTNTRSALKLVRESELL 58

Query: 72  GGDINAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSE 131
           GG   +    E+ +  A  LK+ +P  +  + D+L  ++F P ++               
Sbjct: 59  GGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVA 118

Query: 132 DDSWDFLDARFSEMVWKDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGA 191
           +             +   + +G P+L   + +   + + I  F  + YT + + V     
Sbjct: 119 EQCPVKSAEDQLYAITFRKGLGNPLLY--DGVERVSLQDIKDFADKVYTKENLEVSGENV 176

Query: 192 VDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRD 251
           V+ +      ES  +     K   S     +  GE  + R + +    +G          
Sbjct: 177 VEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGI---PVNKAS 233

Query: 252 FYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDNGVLYI-ASATAKENIMA 310
                +LA+ L   +S        E  GL    SA  + F+D G+  +         + +
Sbjct: 234 LAQYEVLANYLTSALS--------ELSGLIS--SAKLDKFTDGGLFTLFVRDQDSAVVSS 283

Query: 311 LTSSIVEVVQSLLENIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSE 370
               IV       +  + +++    A  + KL            E             S 
Sbjct: 284 NIKKIVA------DLKKGKDLSP--AINYTKL------KNAVQNESV-----------SS 318

Query: 371 KIIDTISAITCEDIVGVAKKIFSSTPTLAILGPPMDHVPTTSEL 414
            I     A          K           +G  + ++P   EL
Sbjct: 319 PIELNFDA---------VKDFKLGKFNYVAVG-DVSNLPYLDEL 352