RPSBLAST alignment of GI: 254780464 and SCOP domain: d3cx5b2

Alignment
>d3cx5b2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 150
 Score = 59.5 bits (144), Expect = 5e-10
 Identities = 25/197 (12%), Positives = 49/197 (24%), Gaps = 50/197 (25%)

Query: 219 PAVYVGGEYIQKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGDGMSSRLFQEVREKR 278
           P  ++G E   +         +   G            +LA+ L   +S           
Sbjct: 3   PKFFLGEENRVRFIGDS----VAAIGIPVNKASLAQYEVLANYLTSALSEL--------- 49

Query: 279 GLCYSISAHHENFSDNGVLYI-ASATAKENIMALTSSIVEVVQSLLENIEQREIDKECAK 337
                 SA  + F+D G+  +         + +    IV       +  + +++    A 
Sbjct: 50  -SGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVA------DLKKGKDLSP--AI 100

Query: 338 IHAKLIKSQERSYLRALEISKQVMFCGSILCSEKIIDTISAITCEDIVGVAKKIFSSTPT 397
            + KL            E                      +   E      K        
Sbjct: 101 NYTKL------KNAVQNE--------------------SVSSPIELNFDAVKDFKLGKFN 134

Query: 398 LAILGPPMDHVPTTSEL 414
              +G  + ++P   EL
Sbjct: 135 YVAVG-DVSNLPYLDEL 150

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: LuxS/MPP-like metallohydrolase
superfamily: LuxS/MPP-like metallohydrolase
family: MPP-like
domain: Cytochrome bc1 core subunit 2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]