HHsearch alignment for GI: 254780466 and conserved domain: COG0220

>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only].
Probab=95.11  E-value=0.072  Score=31.52  Aligned_cols=69  Identities=26%  Similarity=0.414  Sum_probs=46.8

Q ss_pred             CCCEECCCHHHHHHHCCCC-CCCEEEE---CCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             2708517259989728414-7118984---77876155871333678513001344357789899999889999999986
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAK-SVDLIFA---DPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRV   95 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~-sVDlI~t---DPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~Rv   95 (375)
T Consensus        99 Nlri~~~DA~~~l~~~~~~~sl~~I~i~FPDP--WpKkRH~KRR---------------l----~----~~~fl~~~a~~  153 (227)
T COG0220          99 NLRLLCGDAVEVLDYLIPDGSLDKIYINFPDP--WPKKRHHKRR---------------L----T----QPEFLKLYARK  153 (227)
T ss_pred             CEEEEECCHHHHHHHCCCCCCEEEEEEECCCC--CCCCCCCCCC---------------C----C----CHHHHHHHHHH
T ss_conf             46998077999997358988565799979999--9876643321---------------4----7----88999999997


Q ss_pred             CCCCCEEEEECCHHHHHH
Q ss_conf             396872999834688899
Q gi|254780466|r   96 LKPNGTLWVIGSYHNIFR  113 (375)
Q Consensus        96 LK~~Gsi~v~~~~~~i~~  113 (375)
T Consensus       154 Lk~gG~l~~aTD~~~y~e  171 (227)
T COG0220         154 LKPGGVLHFATDNEEYFE  171 (227)
T ss_pred             CCCCCEEEEEECCHHHHH
T ss_conf             268978999726799999