HHsearch alignment for GI: 254780466 and conserved domain: COG0863

>COG0863 DNA modification methylase [DNA replication, recombination, and repair].
Probab=100.00  E-value=0  Score=359.21  Aligned_cols=284  Identities=37%  Similarity=0.556  Sum_probs=250.8

Q ss_pred             CHHHHCCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHH-HHHHHHHHH
Q ss_conf             3355327085172599897284147118984778761558713336785130013443577898999998-899999999
Q gi|254780466|r   15 SIFEWKDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAF-TRAWLLACR   93 (375)
Q Consensus        15 ~~~~~~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f-~~~wl~e~~   93 (375)
T Consensus        11 ~~~~~~~~i~~~d~~~~l~~~~~~svDli~tdppy~~~~~~~~~~~~~~~~~~~~~-~~---~~~~~~~~~~~~~~~~~~   86 (302)
T COG0863          11 IWIDELSKIYKGDCLEILKSLPENSVDLIFTDPPYNNVKAGRKLGFLKRWLDAWDG-WD---SRGIYLKFILLQWLAEQK   86 (302)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHCCCCCCCHHHHHHHHHH-HH---HHHHHHHHHHHHHHHHHH
T ss_conf             44554445557678788753722258767659973443322332201224566532-57---788887555689998755


Q ss_pred             HHCCCCCEEEEECCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHH-HCCCCCCCCEECCCCCC
Q ss_conf             86396872999834688899998764057860124687315677775775176540213221-00566665023410011
Q gi|254780466|r   94 RVLKPNGTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWA-SPSPKAKGYTFNYDALK  172 (375)
Q Consensus        94 RvLK~~Gsi~v~~~~~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~-~K~~~~k~y~fny~~~k  172 (375)
T Consensus        87 rvl~~~~~~~v~~~~~~~~~~~~~~~~~gf~~~~~iiw~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (302)
T COG0863          87 RVLKPGGSLYVIDPFSNLARIEDIAKKLGFEILGKIIWKKPSPRNSRIAKYLLFDYEPLIWANNKSDKLNVDKFKEDIVL  166 (302)
T ss_pred             HEECCCCEEEEECCCCCCHHHHHHHHHCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCC
T ss_conf             31525770799538755348999999759736502889746886067778875010556664046421011103531223


Q ss_pred             CCCCCEEECCCCCC----CCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCE
Q ss_conf             23798010465422----10258541457-78753368778189999999852899888998688851799999980981
Q gi|254780466|r  173 AANEDVQMRSDWLI----PICSGSERLRN-KDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRS  247 (375)
Q Consensus       173 ~~n~~~~~~s~w~~----pi~~g~er~k~-~~g~k~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~  247 (375)
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hp~~~P~~l~~r~i~~~s~~~diVlDpf~GsGtt~~aa~~~~r~  246 (302)
T COG0863         167 DPFEDLRIREPYNKLIRLPDKKGNWSNPIDSYGKKLHPAQKPLALIERLIRDYSFPGDIVLDPFAGSGTTGIAAKNLGRR  246 (302)
T ss_pred             CCCCCHHHCCCHHHHCCCCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCHHHHHHHHCCC
T ss_conf             43300331443011103655456500466544445787415588999999955887778874176887199999981141


Q ss_pred             EEEEEECHHHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             69997289999999999963056876563024443337755234698828658776
Q gi|254780466|r  248 FIGIEMKQDYIDIATKRIASVQPLGNIELTVLTGKRTEPRVAFNLLVERGLIQPGQ  303 (375)
Q Consensus       248 ~IGiE~~~~Y~~~a~~Rl~~~~~~~~~~~~~~~~~~~~~rvpfg~lie~g~l~~g~  303 (375)
T Consensus       247 ~ig~e~~~~y~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~  301 (302)
T COG0863         247 FIGIEINPEYVEVALKRLQEGLNRIPILIKNRVEERGSFVIESFYLEEGV-IEKHE  301 (302)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCHHEECHHHHHHHH-HHCCC
T ss_conf             34352348899999999986500005654214443102000000013331-22067