HHsearch alignment for GI: 254780466 and conserved domain: COG2189

>COG2189 Adenine specific DNA methylase Mod [DNA replication, recombination, and repair].
Probab=99.70  E-value=1.3e-17  Score=127.26  Aligned_cols=230  Identities=28%  Similarity=0.377  Sum_probs=141.3

Q ss_pred             CCCCEEEECCCCCCCCCCCEECCC----------CCEE-EECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             471189847787615587133367----------8513-00134435778989999988999999998639687299983
Q gi|254780466|r   38 KSVDLIFADPPYNLQLNGQLYRPD----------HSLV-DAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGTLWVIG  106 (375)
Q Consensus        38 ~sVDlI~tDPPYni~~~~~~~~~~----------~s~~-~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gsi~v~~  106 (375)
T Consensus       121 ~~~~~i~~~~~~~~~s~~~~~~~~~k~~~~~~~~~~~~~~~~-~~~~~~-~~s~wl~fm~~rL~la~~ll~~dg~ifvs~  198 (590)
T COG2189         121 NKNDIIYIDPLIALSSDYLRYLDKVKLIYIDPPYETGNNDRF-LYNDKF-NGSTWLSFMYNRLELAKKLLKDDGVIFVSI  198 (590)
T ss_pred             CCCCEECCCCCEEECCHHHHHCCCCHHHHHCCHHHCCCHHHE-EECCCC-CCCHHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             424200137731242102332563013331403323652330-305654-523588877788999999875552299230


Q ss_pred             CHHHHHHHHHHHHHCCCC---EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCC-----------C-------CE
Q ss_conf             468889999876405786---01246873156777757751765402132210056666-----------5-------02
Q gi|254780466|r  107 SYHNIFRIGTMLQNLNFW---ILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAK-----------G-------YT  165 (375)
Q Consensus       107 ~~~~i~~i~~~l~~~gf~---~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~~~k-----------~-------y~  165 (375)
T Consensus       199 DdnE~a~lkvl~Dei-Fg~~nfi~~~~w~~~~~~~~~~~~~~~~~~~y~~~y~k~~~~~~~~~~~~~~~~~~~~~~~~~~  277 (590)
T COG2189         199 DDNEQAYLKVLMDEI-FGEENFITNIIWKKKNSSGSDSNKFVYIDHEYILVYAKNKYNRLELELEELDRQGNIYVIYDEN  277 (590)
T ss_pred             CCCCCCCCEEEEECC-CCCCCCCEEEEECCCCCCCCCCCCCEEECEEEEEEECCCHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             577541134775134-4566500014612445788875420030101367623312444430431125555444454434


Q ss_pred             ------------E--------------CCCCCCCC----------------CCCEEEC---CC---------------CC
Q ss_conf             ------------3--------------41001123----------------7980104---65---------------42
Q gi|254780466|r  166 ------------F--------------NYDALKAA----------------NEDVQMR---SD---------------WL  185 (375)
Q Consensus       166 ------------f--------------ny~~~k~~----------------n~~~~~~---s~---------------w~  185 (375)
T Consensus       278 ~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  357 (590)
T COG2189         278 DNYLKKNKLNEIFRKINFKNKIIGKPFNGSGRIWANFKKYLIKGLKADQNYNDNGYPRYYPFNLRYKKEKLDKKSKNRVI  357 (590)
T ss_pred             CCHHHHCCCCHHCCCCCCCCCEECCCCCCCCCEEECCCHHCCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEE
T ss_conf             42554301000012467776333245477764010232101105554102445665223411211000134431575245


Q ss_pred             CCCCC-CCC---CCCCC--------------------C------C-------CCCCCCC---------------------
Q ss_conf             21025-854---14577--------------------8------7-------5336877---------------------
Q gi|254780466|r  186 IPICS-GSE---RLRNK--------------------D------G-------EKLHPTQ---------------------  207 (375)
Q Consensus       186 ~pi~~-g~e---r~k~~--------------------~------g-------~k~HPTq---------------------  207 (375)
T Consensus       358 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  437 (590)
T COG2189         358 DPINGNGTTYGETARRKGYNDLKYIIKSIKEVKIEKNPKAVPYLNDRILDYFAGDFTTAHAVSYWNKEDKGNLGIDFKRG  437 (590)
T ss_pred             EECCCCCCEEHHHHHHCCCCCCCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHCCHHHHHHCCCHHHHCCCCCCCCCC
T ss_conf             30357760207778631444322211010001032033223341124556554320202332001034421345543568


Q ss_pred             CCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHHCCC
Q ss_conf             818999999985289988899868885179999998098169997289999999999963056
Q gi|254780466|r  208 KPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIASVQP  270 (375)
Q Consensus       208 KP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~~~~  270 (375)
T Consensus       438 k~~~l~~~~i~~~~~~~d~vld~~~gsgtt~~~~~~~~r~~ig~e~~~~~~~~~~~r~~~v~d  500 (590)
T COG2189         438 KPEALLQRIIKITTNKNDLVLDFFAGSGTTTAVAHKLNRKYIGIEQMEYIENIILERLKKVID  500 (590)
T ss_pred             CHHHHHHHHHHCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             868888889870788764332212488751177886546761712888887653456666677