HHsearch alignment for GI: 254780466 and conserved domain: KOG1541

>KOG1541 consensus.
Probab=94.90  E-value=0.051  Score=32.44  Aligned_cols=58  Identities=29%  Similarity=0.453  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHCCCCC---CEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899999998528998---8899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSSTKPG---DIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S~~g---DiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
T Consensus        34 ~em~eRaLELLalp~~~~~~iLDIGCGsGLSg~vL~~~Gh~wiGvDiSpsML~~a~~~e~e   94 (270)
T KOG1541          34 AEMAERALELLALPGPKSGLILDIGCGSGLSGSVLSDSGHQWIGVDISPSMLEQAVERELE   94 (270)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHEECCCCCEEEEECCCHHHHHHHHHHHHH
T ss_conf             7788878987608998871799834577743200216895588622898999999976640