HHsearch alignment for GI: 254780466 and conserved domain: PRK03522

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed.
Probab=97.26  E-value=0.0019  Score=41.12  Aligned_cols=58  Identities=22%  Similarity=0.242  Sum_probs=45.4

Q ss_pred             HHHHHHHHHHCC-CCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHHHHHHHHHH
Q ss_conf             899999998528-9988899868885179999998098169997289999999999963
Q gi|254780466|r  210 EALLSRILVSST-KPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYIDIATKRIAS  267 (375)
Q Consensus       210 ~~LleriI~~~S-~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~~a~~Rl~~  267 (375)
T Consensus       219 ~~L~~~~~~~~~~~~~~~vlDlycG~G~~sl~lA~~~~~V~gvE~~~~av~~A~~na~~  277 (375)
T PRK03522        219 AQLYATARDWVRELPPKSMWDLFCGVGGFGLHCATPDMQLTGIEISAEAIACAKQSAAE  277 (375)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHH
T ss_conf             99999999986315897899965785388898764178899998459999999999998