HHsearch alignment for GI: 254780466 and conserved domain: PRK10901

>PRK10901 16S rRNA methyltransferase B; Provisional.
Probab=92.14  E-value=0.92  Score=24.79  Aligned_cols=50  Identities=10%  Similarity=0.248  Sum_probs=38.3

Q ss_pred             CCCCCCEEEECCCCCHHHH-HHHHHH-CCEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             2899888998688851799-999980-9816999728999999999996305
Q gi|254780466|r  220 STKPGDIILDPFFGSGTSG-AVAKKL-RRSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       220 ~S~~gDiVLDPF~GSGTT~-~aA~~l-gR~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
T Consensus       242 ~p~~g~~VLD~CAaPGGKt~~la~~~~~~~v~A~D~~~~Rl~~l~~n~~Rlg  293 (428)
T PRK10901        242 APQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRLG  293 (428)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCC
T ss_conf             9888987987168876689999996458928999698889999999999759