HHsearch alignment for GI: 254780466 and conserved domain: PRK10909

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional.
Probab=97.64  E-value=0.00059  Score=44.17  Aligned_cols=112  Identities=23%  Similarity=0.272  Sum_probs=69.7

Q ss_pred             CCCCCCCCCCCCCC--CHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHC-CEEEEEEECHHHHHHHHHHHHHCCCC
Q ss_conf             45778753368778--1899999998528998889986888517999999809-81699972899999999999630568
Q gi|254780466|r  195 LRNKDGEKLHPTQK--PEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLR-RSFIGIEMKQDYIDIATKRIASVQPL  271 (375)
Q Consensus       195 ~k~~~g~k~HPTqK--P~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lg-R~~IGiE~~~~Y~~~a~~Rl~~~~~~  271 (375)
T Consensus        24 L~~p~~~~~RPT~drvREalFn~L--~~~i~~~~vLDLFAGSGalGlEALSRGA~~v~fVE~~~~~~~~i~~N~~~l~~~  101 (198)
T PRK10909         24 LPVPDSPGLRPTTDRVRETLFNWL--APVIVDARCLDCFAGSGALGLEALSRYAAGATLLEMDRAVSQQLIKNLATLKAG  101 (198)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHH--HHHCCCCEEEECCCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCC
T ss_conf             368999996878388999999875--764299879982777468899999879978999978999999999999984888


Q ss_pred             -----CHHHHCCCCCCC--------CCC------CCCHHHHHHCCCCCCCCEEECC
Q ss_conf             -----765630244433--------377------5523469882865877657668
Q gi|254780466|r  272 -----GNIELTVLTGKR--------TEP------RVAFNLLVERGLIQPGQILTNA  308 (375)
Q Consensus       272 -----~~~~~~~~~~~~--------~~~------rvpfg~lie~g~l~~g~~L~~~  308 (375)
T Consensus       102 ~~~ii~~da~~~L~~~~~~fDlIF~DPPY~~~~~~~~l~~l~~~~~L~~~gliiiE  157 (198)
T PRK10909        102 NARVVNTNALSFLAQPGTPHNVVFVDPPFRKGLLEETINLLEQNGWLADDALIYVE  157 (198)
T ss_pred             CEEEEEHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEEEE
T ss_conf             67999556999862559952189989997655599999999988891899699999