HHsearch alignment for GI: 254780466 and conserved domain: PRK11873

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed.
Probab=95.94  E-value=0.024  Score=34.36  Aligned_cols=51  Identities=24%  Similarity=0.404  Sum_probs=43.0

Q ss_pred             HCCCCCCEEEECCCCCHHHH-HHHHHHC--CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             52899888998688851799-9999809--816999728999999999996305
Q gi|254780466|r  219 SSTKPGDIILDPFFGSGTSG-AVAKKLR--RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       219 ~~S~~gDiVLDPF~GSGTT~-~aA~~lg--R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
T Consensus        69 a~l~pGe~VLDLGcG~G~d~~~aA~~VG~~G~ViGVD~s~~ML~~Ar~~a~~~G  122 (258)
T PRK11873         69 AELKPGETVLDLGSGAGFDCFLAARRVGPTGKVIGVDMTPEMLAKARANARKAG  122 (258)
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             657999989994788777599999986999779998599999999999999759