HHsearch alignment for GI: 254780466 and conserved domain: PRK13699

>PRK13699 putative methylase; Provisional.
Probab=100.00  E-value=0  Score=401.26  Aligned_cols=214  Identities=25%  Similarity=0.386  Sum_probs=172.0

Q ss_pred             CCCEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             27085172599897284147118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   20 KDKIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        20 ~nkI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
T Consensus         1 ~nkii~GDcle~l~~lpd~SVDliiTDPPY~~g~~~~~~---~------------~~~~d~~~ew~~~~~~e~~Rvlk~~   65 (227)
T PRK13699          1 MSRFILGNCVDVMARFPDNAVDFILTDPPYLVGFRDRQG---R------------TIAGDKTDEWLQPACNEMYRVLKKD   65 (227)
T ss_pred             CCCEEHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC---C------------CCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             984433019999952888772979989899889878899---7------------4457620899999999999995688


Q ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCEECCCCCCCCCCCEE
Q ss_conf             72999834688899998764057860124687315677775775176540213221005666650234100112379801
Q gi|254780466|r  100 GTLWVIGSYHNIFRIGTMLQNLNFWILNDIVWRKSNPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQ  179 (375)
Q Consensus       100 Gsi~v~~~~~~i~~i~~~l~~~gf~~~n~IIW~K~n~~pn~~g~r~~~~hE~iiw~~K~~~~k~y~fny~~~k~~n~~~~  179 (375)
T Consensus        66 g~~~~~~~~~~~~~~~~~~~~~gf~~~~~~vw~k~~~~---~~~~~~~~~e~~~~~~kg~~~~~--~-----~~------  129 (227)
T PRK13699         66 ALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKNYTS---KAAYVGYRHECAYILAKGRPALP--Q-----NP------  129 (227)
T ss_pred             CEEEEEECCCHHHHHHHHHHHCCCCCCCEEEECCCCCC---CCCCCCCCCEEEEEEECCCCCCC--C-----CC------
T ss_conf             16999933100469999999748866164784267788---76547764306899877986788--8-----87------


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCEEEEEEECHHHHH
Q ss_conf             04654221025854145778753368778189999999852899888998688851799999980981699972899999
Q gi|254780466|r  180 MRSDWLIPICSGSERLRNKDGEKLHPTQKPEALLSRILVSSTKPGDIILDPFFGSGTSGAVAKKLRRSFIGIEMKQDYID  259 (375)
Q Consensus       180 ~~s~w~~pi~~g~er~k~~~g~k~HPTqKP~~LleriI~~~S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGiE~~~~Y~~  259 (375)
T Consensus       130 ~~~v~~---~-------~~~~~~~HPtqKPv~L~e~lI~~~S~~gdlVLDPF~GSGTT~vAA~~lgR~fIGiEi~~~Y~~  199 (227)
T PRK13699        130 LPDVLG---W-------KYSGNRHHPTEKPVTSLQPLIESFTHPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHR  199 (227)
T ss_pred             CCCCCC---C-------CCCCCCCCCCCCCHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             887551---3-------578998899869299999999955999999997799875899999981994899968999999


Q ss_pred             HHHHHHHHCCCCCHH
Q ss_conf             999999630568765
Q gi|254780466|r  260 IATKRIASVQPLGNI  274 (375)
Q Consensus       260 ~a~~Rl~~~~~~~~~  274 (375)
T Consensus       200 ia~~Rl~~~~~~~~~  214 (227)
T PRK13699        200 AGQQRLAAVQRAMQQ  214 (227)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999998850