HHsearch alignment for GI: 254780466 and conserved domain: TIGR00095

>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase..
Probab=95.56  E-value=0.048  Score=32.56  Aligned_cols=65  Identities=23%  Similarity=0.343  Sum_probs=42.7

Q ss_pred             CEECCCHHHHHHHCCCCC--CCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             085172599897284147--118984778761558713336785130013443577898999998899999999863968
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKS--VDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPN   99 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~s--VDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~   99 (375)
T Consensus       113 ~~~~~~~~~~~~~~~~~ts~~d~iylDPPf~~~~----------------------ad~~~~l~l~~~alerl~~~L~~~  170 (210)
T TIGR00095       113 TVLNDAERALLFLAKKQTSPFDIIYLDPPFNTGL----------------------ADLEAILELLGEALERLNKWLNPK  170 (210)
T ss_pred             EEHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC----------------------CCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             0000256665776517996114787148888761----------------------037999999999999873104878


Q ss_pred             CEEEEECCH
Q ss_conf             729998346
Q gi|254780466|r  100 GTLWVIGSY  108 (375)
Q Consensus       100 Gsi~v~~~~  108 (375)
T Consensus       171 ~~i~ve~~~  179 (210)
T TIGR00095       171 GLIVVEYDR  179 (210)
T ss_pred             CEEEEEECC
T ss_conf             579986341