HHsearch alignment for GI: 254780466 and conserved domain: TIGR01177

>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain..
Probab=96.54  E-value=0.0022  Score=40.65  Aligned_cols=70  Identities=23%  Similarity=0.276  Sum_probs=60.9

Q ss_pred             CCCCCCCHHHHHHHHHHC-CCCCCEEEECCCCCHHHHHHHHHHCCEEEEE-EECHHHHHHHHHHHHHCCCCC
Q ss_conf             368778189999999852-8998889986888517999999809816999-728999999999996305687
Q gi|254780466|r  203 LHPTQKPEALLSRILVSS-TKPGDIILDPFFGSGTSGAVAKKLRRSFIGI-EMKQDYIDIATKRIASVQPLG  272 (375)
Q Consensus       203 ~HPTqKP~~LleriI~~~-S~~gDiVLDPF~GSGTT~~aA~~lgR~~IGi-E~~~~Y~~~a~~Rl~~~~~~~  272 (375)
T Consensus       182 ~~p~~~~p~~~~~~~~~~~~~~g~~~~dp~~g~gg~~~~~gl~g~~~~g~gd~~~~~~~g~~~~l~~~~~~~  253 (358)
T TIGR01177       182 FKPGSLDPKLARALVNLAGVKEGDRLLDPFCGTGGFLIEAGLLGAKPIGCGDLDWKLVEGARLNLEHYGIED  253 (358)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCCCEECCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHCCCHHHHHHCCCCC
T ss_conf             256555546777776542024675100422266603323333211000244035676425211133305543