HHsearch alignment for GI: 254780466 and conserved domain: TIGR01934

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities . Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity.
Probab=96.39  E-value=0.0028  Score=40.05  Aligned_cols=52  Identities=25%  Similarity=0.397  Sum_probs=36.0

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
T Consensus       109 ~f~~~dA~~-LP-F~D~sFD~~Tia--FGl------------------------RN~~d~~----~aL~E~~RVLKpgG~  156 (242)
T TIGR01934       109 SFIEADAEA-LP-FEDNSFDAVTIA--FGL------------------------RNVTDIQ----KALREMYRVLKPGGR  156 (242)
T ss_pred             HHEECHHHC-CC-CCCCCEEEEEEE--CCC------------------------CCCCCHH----HHHHHHHHCCCCCCE
T ss_conf             211000550-87-998624446640--255------------------------4746867----898773110188987


Q ss_pred             EEEE
Q ss_conf             9998
Q gi|254780466|r  102 LWVI  105 (375)
Q Consensus       102 i~v~  105 (375)
T Consensus       157 l~iL  160 (242)
T TIGR01934       157 LVIL  160 (242)
T ss_pred             EEEE
T ss_conf             9984