HHsearch alignment for GI: 254780466 and conserved domain: TIGR01934

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities . Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity.
Probab=90.69  E-value=0.67  Score=25.63  Aligned_cols=59  Identities=24%  Similarity=0.365  Sum_probs=45.6

Q ss_pred             HHHHHHHHHC-CCCCCEEEECCCCCHHHHHH-HHHHC----------CEEEEEEECHHHHHHHHHHHHHCC
Q ss_conf             9999999852-89988899868885179999-99809----------816999728999999999996305
Q gi|254780466|r  211 ALLSRILVSS-TKPGDIILDPFFGSGTSGAV-AKKLR----------RSFIGIEMKQDYIDIATKRIASVQ  269 (375)
Q Consensus       211 ~LleriI~~~-S~~gDiVLDPF~GSGTT~~a-A~~lg----------R~~IGiE~~~~Y~~~a~~Rl~~~~  269 (375)
T Consensus        30 ~~~~~~~~~~E~k~~~~~LDvA~GTGD~a~~~~k~~~~~~~a~~~~~~~vtg~D~S~~ML~~a~kk~~~~~  100 (242)
T TIGR01934        30 RAVKLIGVQLEGKKGQKVLDVACGTGDLAIELAKKAGKVGKAAETERAKVTGVDFSEEMLEVAKKKAPNEE  100 (242)
T ss_pred             HHHHHHHHHCCCCCCCCEEEEECCHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHH
T ss_conf             99998786236888897788723839999999863575553357763378987079889999987413420