HHsearch alignment for GI: 254780466 and conserved domain: TIGR03534

>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific. Members of this protein family are HemK, a protein once thought to be involved in heme biosynthesis but now recognized to be a protein-glutamine methyltransferase that modifies the peptide chain release factors. All members of the seed alignment are encoded next to the release factor 1 gene (prfA) and confirmed by phylogenetic analysis. However, the family is diverse enough that even many members of the seed alignment do not score above the seed alignment, which was set high enough to exclude all instances of PrmB.
Probab=96.03  E-value=0.058  Score=32.08  Aligned_cols=90  Identities=24%  Similarity=0.358  Sum_probs=61.5

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCC-------CCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             0851725998972841471189847787615-------587133367851300134435778989999988999999998
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQ-------LNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRR   94 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~-------~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~R   94 (375)
T Consensus       140 ~~~~~d~~~---~~~~~~fDlIvsNPPYI~~~e~~~l~~eV~~~EP~~AL~gg-----------~dGl~~~~~ii~~a~~  205 (251)
T TIGR03534       140 RFLKSDWFE---PLPGGKFDLIVSNPPYIPEADIHLLDPEVRFHEPKLALFAG-----------EDGLDFYRRIIAQAPR  205 (251)
T ss_pred             EEEECCHHH---CCCCCCCCEEEECCCCCCHHHHHHCCCHHCCCCHHHHHCCC-----------CCHHHHHHHHHHHHHH
T ss_conf             865131432---15689866899789988745666328601026729997179-----------8469999999999998


Q ss_pred             HCCCCCEEEEECCHHHHHHHHHHHHHCCCCE
Q ss_conf             6396872999834688899998764057860
Q gi|254780466|r   95 VLKPNGTLWVIGSYHNIFRIGTMLQNLNFWI  125 (375)
Q Consensus        95 vLK~~Gsi~v~~~~~~i~~i~~~l~~~gf~~  125 (375)
T Consensus       206 ~L~~~G~l~~Eig~~q~~~v~~l~~~~gf~~  236 (251)
T TIGR03534       206 YLKPGGWLLLEIGYDQGEAVRALFEAAGFAD  236 (251)
T ss_pred             HCCCCCEEEEEECHHHHHHHHHHHHHCCCCE
T ss_conf             5367988999968378999999999689970