HHsearch alignment for GI: 254780466 and conserved domain: pfam02384

>pfam02384 N6_Mtase N-6 DNA Methylase. Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The R-M system is a complex containing three polypeptides: M (this family), S (pfam01420), and R. This family consists of N-6 adenine-specific DNA methylase EC:2.1.1.72 from Type I and Type IC restriction systems. These methylases have the same sequence specificity as their corresponding restriction enzymes.
Probab=97.48  E-value=0.00042  Score=45.10  Aligned_cols=76  Identities=22%  Similarity=0.256  Sum_probs=43.8

Q ss_pred             CEECCCHHHHHHHCCCCCCCEEEECCCCCCCCCCCEECCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             08517259989728414711898477876155871333678513001344357789899999889999999986396872
Q gi|254780466|r   22 KIIKGNSISVLEKLPAKSVDLIFADPPYNLQLNGQLYRPDHSLVDAVTDSWDKFSSFEAYDAFTRAWLLACRRVLKPNGT  101 (375)
Q Consensus        22 kI~~GDcl~~l~~Lpd~sVDlI~tDPPYni~~~~~~~~~~~s~~~~~~d~wd~~~s~~~Y~~f~~~wl~e~~RvLK~~Gs  101 (375)
T Consensus       108 ~i~~gdsl~~~~~~~~~kfD~IlsNPPFg~k~~~~~~~~~~~~~~~~---~~~~~~~~e~-----~Fiqh~l~~Lk~~Gr  179 (312)
T pfam02384       108 GIRHGDTLLSPKFEEDKKFDVVVANPPFNQKWDANDNLENDPRFRAY---GVPPKSNADF-----AFLQHIIYHLSPNGR  179 (312)
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCHHCC---CCCCCCCHHH-----HHHHHHHHHCCCCCE
T ss_conf             52147765576766545511898378646676654321027211036---8788874429-----999999985699976


Q ss_pred             EEEE
Q ss_conf             9998
Q gi|254780466|r  102 LWVI  105 (375)
Q Consensus       102 i~v~  105 (375)
T Consensus       180 aaiV  183 (312)
T pfam02384       180 AAVV  183 (312)
T ss_pred             EEEE
T ss_conf             9999